BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF025N15

Length=904
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABH08755.1|  ubiquitin                                               417   5e-144   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567286.1|  ubiquitin 11                                          417   6e-144   Arabidopsis thaliana [mouse-ear cress]
gb|ABH08753.1|  ubiquitin                                               416   7e-144   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008358804.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    417   1e-143   
gb|ACJ85618.1|  unknown                                                 416   2e-143   Medicago truncatula
ref|XP_002872805.1|  hypothetical protein ARALYDRAFT_490270             419   2e-143   
gb|ACJ85643.1|  unknown                                                 416   2e-143   Medicago truncatula
gb|AIZ74335.1|  polyubiquitin 3                                         416   2e-143   Pinus massoniana [Chinese red pine]
ref|XP_003626479.1|  Ubiquitin-like protein                             417   2e-143   
gb|AAB36546.1|  polyubiquitin                                           414   3e-143   Phaseolus vulgaris [French bean]
dbj|BAC57955.1|  polyubiquitin                                          415   3e-143   Tripolium pannonicum [sea starwort]
ref|XP_010931017.1|  PREDICTED: polyubiquitin 11 isoform X1             415   4e-143   Elaeis guineensis
ref|XP_006370634.1|  hypothetical protein POPTR_0001s44440g             416   4e-143   
ref|XP_009114489.1|  PREDICTED: polyubiquitin-like                      417   4e-143   Brassica rapa
gb|AET06143.1|  ubiquitin                                               415   4e-143   Papaver somniferum
gb|AAM64530.1|  ubiquitin homolog                                       415   4e-143   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010490793.1|  PREDICTED: polyubiquitin 11-like                   415   4e-143   Camelina sativa [gold-of-pleasure]
ref|XP_004968120.1|  PREDICTED: polyubiquitin-like                      414   5e-143   Setaria italica
ref|XP_006288299.1|  hypothetical protein CARUB_v10001544mg             414   5e-143   
gb|EEC81189.1|  hypothetical protein OsI_24195                          414   5e-143   Oryza sativa Indica Group [Indian rice]
gb|ABH08754.1|  ubiquitin                                               414   5e-143   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002317213.1|  polyubiquitin family protein                       414   5e-143   Populus trichocarpa [western balsam poplar]
gb|AAF31707.1|AF221858_1  polyubiquitin                                 414   5e-143   Euphorbia esula [wolf's milk]
ref|XP_003570150.1|  PREDICTED: polyubiquitin 11 isoform X2             415   5e-143   Brachypodium distachyon [annual false brome]
emb|CAA48140.1|  ubiquitin                                              417   6e-143   Antirrhinum majus [garden snapdragon]
gb|ABK94002.1|  unknown                                                 417   6e-143   Populus trichocarpa [western balsam poplar]
gb|AAP31578.1|  ubiquitin                                               414   6e-143   Hevea brasiliensis [jebe]
gb|ABD96088.1|  polyubiquitin                                           416   6e-143   Malus domestica [apple tree]
emb|CAH59739.1|  polyubiquitin                                          414   7e-143   Plantago major [cart-track plant]
gb|EYU33610.1|  hypothetical protein MIMGU_mgv1a004315mg                414   7e-143   Erythranthe guttata [common monkey flower]
gb|KJB36627.1|  hypothetical protein B456_006G167800                    414   7e-143   Gossypium raimondii
gb|EPS72031.1|  polyubiquitin                                           416   8e-143   Genlisea aurea
ref|XP_010453358.1|  PREDICTED: polyubiquitin-like                      417   8e-143   Camelina sativa [gold-of-pleasure]
ref|NP_849292.1|  polyubiquitin 14                                      417   8e-143   Arabidopsis thaliana [mouse-ear cress]
gb|KDO51109.1|  hypothetical protein CISIN_1g026973mg                   414   8e-143   Citrus sinensis [apfelsine]
ref|XP_006428779.1|  hypothetical protein CICLE_v10012654mg             414   9e-143   Citrus clementina [clementine]
gb|AAO43307.1|  putative polyubiquitin                                  414   9e-143   Arabidopsis thaliana [mouse-ear cress]
gb|KJB81823.1|  hypothetical protein B456_013G163500                    417   9e-143   Gossypium raimondii
gb|KDO51955.1|  hypothetical protein CISIN_1g026932mg                   414   9e-143   Citrus sinensis [apfelsine]
ref|XP_003627152.1|  Ubiquitin                                          415   1e-142   
gb|AFY06654.1|  polyubiquitin                                           415   1e-142   Carica papaya [mamon]
gb|AEZ49160.1|  polyubiquitin                                           416   1e-142   Wolffia australiana
emb|CBY46745.1|  polyubiquitin 10 protein                               417   1e-142   Lepidium appelianum [hairy whitetop]
ref|XP_010235843.1|  PREDICTED: polyubiquitin 11 isoform X1             415   1e-142   Brachypodium distachyon [annual false brome]
gb|AGV54749.1|  ubiquitin 11                                            415   1e-142   Phaseolus vulgaris [French bean]
ref|XP_002872746.1|  hypothetical protein ARALYDRAFT_911794             414   1e-142   
gb|AAC35858.1|  polyubiquitin                                           415   1e-142   Capsicum chinense [bonnet pepper]
ref|XP_003590494.1|  Ubiquitin                                          416   1e-142   
gb|AFK41706.1|  unknown                                                 413   1e-142   Medicago truncatula
gb|KJB62484.1|  hypothetical protein B456_009G418900                    413   2e-142   Gossypium raimondii
ref|XP_002438839.1|  hypothetical protein SORBIDRAFT_10g027030          413   2e-142   Sorghum bicolor [broomcorn]
emb|CBI22349.3|  unnamed protein product                                416   2e-142   Vitis vinifera
ref|XP_006377830.1|  hypothetical protein POPTR_0011s13770g             415   2e-142   
gb|AES89866.2|  polyubiquitin 3                                         416   2e-142   Medicago truncatula
gb|ABY60454.1|  putative polyubiquitin                                  415   3e-142   Adonis aestivalis var. palaestina
ref|XP_007512209.1|  polyubiquitin                                      417   3e-142   Bathycoccus prasinos
ref|XP_008784557.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    412   3e-142   
ref|XP_006428822.1|  hypothetical protein CICLE_v10012652mg             412   3e-142   Citrus clementina [clementine]
ref|XP_007154495.1|  hypothetical protein PHAVU_003G1236001g            414   4e-142   Phaseolus vulgaris [French bean]
ref|XP_007014924.1|  Polyubiquitin 3                                    415   4e-142   Theobroma cacao [chocolate]
ref|XP_007211606.1|  hypothetical protein PRUPE_ppa005503mg             415   4e-142   
ref|XP_010492041.1|  PREDICTED: polyubiquitin-like                      415   4e-142   Camelina sativa [gold-of-pleasure]
ref|NP_851029.1|  polyubiquitin 3                                       415   4e-142   Arabidopsis thaliana [mouse-ear cress]
emb|CAA40323.1|  polyubiquitin protein                                  416   5e-142   Helianthus annuus
ref|XP_006396611.1|  hypothetical protein EUTSA_v10028730mg             415   5e-142   
ref|XP_002456845.1|  hypothetical protein SORBIDRAFT_03g043940          415   5e-142   Sorghum bicolor [broomcorn]
ref|XP_006428821.1|  hypothetical protein CICLE_v10012292mg             415   5e-142   Citrus clementina [clementine]
ref|XP_006480631.1|  PREDICTED: polyubiquitin-like                      415   5e-142   Citrus sinensis [apfelsine]
emb|CAC94926.1|  putative ubiquitin                                     412   5e-142   Pleurotus sp. 'Florida' [Florida oyster mushroom]
ref|XP_006302387.1|  hypothetical protein CARUB_v10020456mg             415   5e-142   
gb|EYU33609.1|  hypothetical protein MIMGU_mgv1a004315mg                415   5e-142   Erythranthe guttata [common monkey flower]
ref|XP_006654612.1|  PREDICTED: polyubiquitin-like                      415   5e-142   Oryza brachyantha
gb|AES89865.2|  polyubiquitin 3                                         414   5e-142   Medicago truncatula
gb|AFK43392.1|  unknown                                                 412   6e-142   Medicago truncatula
gb|AAO42469.1|  putative polyubiquitin                                  414   6e-142   Arabidopsis lyrata [lyrate rockcress]
sp|P69315.2|UBIQP_LINUS  RecName: Full=Polyubiquitin; Contains: R...    415   6e-142   Linum usitatissimum
dbj|BAJ85978.1|  predicted protein                                      415   6e-142   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002873083.1|  hypothetical protein ARALYDRAFT_487095             415   6e-142   
emb|CAH59740.1|  polyubiquitin                                          414   6e-142   Plantago major [cart-track plant]
gb|KDP39203.1|  hypothetical protein JCGZ_00960                         415   6e-142   Jatropha curcas
ref|XP_008796945.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    415   7e-142   Phoenix dactylifera
ref|XP_009112898.1|  PREDICTED: polyubiquitin                           414   7e-142   Brassica rapa
gb|AFW66439.1|  putative ubiquitin family protein                       414   7e-142   
ref|XP_007205620.1|  hypothetical protein PRUPE_ppa009116mg             414   7e-142   
gb|AAL09741.1|  AT4g05320/C17L7_240                                     417   7e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452435.1|  PREDICTED: polyubiquitin-like                      414   7e-142   Camelina sativa [gold-of-pleasure]
emb|CDP05795.1|  unnamed protein product                                417   8e-142   Coffea canephora [robusta coffee]
emb|CDP08569.1|  unnamed protein product                                414   8e-142   Coffea canephora [robusta coffee]
gb|KDP38838.1|  hypothetical protein JCGZ_04995                         414   8e-142   Jatropha curcas
ref|XP_010258950.1|  PREDICTED: polyubiquitin                           414   8e-142   Nelumbo nucifera [Indian lotus]
sp|P0CG84.1|UBI4P_NICSY  RecName: Full=Polyubiquitin; Contains: R...    417   8e-142   Nicotiana sylvestris
ref|XP_006428925.1|  hypothetical protein CICLE_v10012291mg             414   8e-142   Citrus clementina [clementine]
ref|XP_006428820.1|  hypothetical protein CICLE_v10012290mg             414   8e-142   Citrus clementina [clementine]
ref|XP_003537278.1|  PREDICTED: polyubiquitin-like                      414   8e-142   Glycine max [soybeans]
emb|CAA54603.1|  pentameric polyubiquitin                               416   8e-142   Nicotiana tabacum [American tobacco]
gb|ACD31680.1|  ubiquitin                                               414   9e-142   Gossypium hirsutum [American cotton]
gb|KJB14874.1|  hypothetical protein B456_002G147600                    416   9e-142   Gossypium raimondii
gb|KJB13592.1|  hypothetical protein B456_002G083000                    417   9e-142   Gossypium raimondii
ref|XP_009605659.1|  PREDICTED: polyubiquitin                           414   9e-142   Nicotiana tomentosiformis
ref|NP_849300.4|  polyubiquitin 10                                      417   9e-142   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001147027.1|  polyubiquitin containing 7 ubiquitin monomers      414   1e-141   
gb|KJB81825.1|  hypothetical protein B456_013G163500                    417   1e-141   Gossypium raimondii
ref|XP_009763135.1|  PREDICTED: polyubiquitin-like                      417   1e-141   Nicotiana sylvestris
ref|XP_011468094.1|  PREDICTED: polyubiquitin                           414   1e-141   Fragaria vesca subsp. vesca
ref|XP_010240921.1|  PREDICTED: polyubiquitin-like                      417   1e-141   Nelumbo nucifera [Indian lotus]
gb|AAB68045.1|  polyubiquitin                                           417   1e-141   Fragaria x ananassa
emb|CBY46746.1|  polyubiquitin 10 protein                               417   1e-141   Lepidium campestre [bastard cress]
ref|XP_009358096.1|  PREDICTED: polyubiquitin isoform X1                417   1e-141   Pyrus x bretschneideri [bai li]
prf||1604470A  poly-ubiquitin                                           413   1e-141
gb|KIM78981.1|  hypothetical protein PILCRDRAFT_10644                   411   1e-141   Piloderma croceum F 1598
gb|KIM78989.1|  hypothetical protein PILCRDRAFT_573034                  411   1e-141   Piloderma croceum F 1598
gb|AAB36545.1|  ubiquitin-like protein                                  418   1e-141   Phaseolus vulgaris [French bean]
gb|AAK68824.1|  Unknown protein                                         411   1e-141   Arabidopsis thaliana [mouse-ear cress]
gb|AEW46688.1|  polyubiquitin                                           410   1e-141   Ulva linza
gb|KJA26171.1|  hypothetical protein HYPSUDRAFT_354705                  411   1e-141   Hypholoma sublateritium FD-334 SS-4
gb|KIR83632.1|  polyubiquitin                                           410   1e-141   Cryptococcus gattii VGIV IND107
ref|XP_003574865.1|  PREDICTED: polyubiquitin-like                      415   1e-141   Brachypodium distachyon [annual false brome]
ref|XP_011077812.1|  PREDICTED: polyubiquitin 3                         415   1e-141   
gb|EJU04700.1|  polyubiquitin UbiD/Ubi4                                 411   1e-141   Dacryopinax primogenitus
ref|XP_006685644.1|  ubiquitin                                          411   1e-141   Yamadazyma tenuis ATCC 10573
ref|XP_010938693.1|  PREDICTED: polyubiquitin                           414   2e-141   Elaeis guineensis
ref|XP_009631616.1|  PREDICTED: polyubiquitin-like                      416   2e-141   Nicotiana tomentosiformis
gb|AAB95250.1|  ubiquitin                                               413   2e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006593989.1|  PREDICTED: polyubiquitin 10-like isoform X1        416   2e-141   
ref|XP_011110054.1|  hypothetical protein H072_4094                     410   2e-141   
gb|AAQ84316.1|  fiber polyubiquitin                                     410   2e-141   Gossypium barbadense [Egyptian cotton]
gb|KJB62487.1|  hypothetical protein B456_009G418900                    413   2e-141   Gossypium raimondii
ref|XP_007339454.1|  ubiquitin                                          413   2e-141   
ref|XP_007154496.1|  hypothetical protein PHAVU_003G1236001g            413   2e-141   Phaseolus vulgaris [French bean]
ref|XP_006288300.1|  hypothetical protein CARUB_v10001544mg             413   2e-141   Capsella rubella
gb|KIK28767.1|  hypothetical protein PISMIDRAFT_672939                  411   2e-141   Pisolithus microcarpus 441
gb|AIY27743.1|  polyubiquitin Ubi10                                     414   2e-141   Betula luminifera [liang ye hua]
gb|KEH31155.1|  polyubiquitin 3                                         416   3e-141   Medicago truncatula
ref|XP_010227188.1|  PREDICTED: polyubiquitin isoform X1                414   3e-141   
ref|NP_001148453.1|  LOC100282068                                       416   3e-141   Zea mays [maize]
ref|XP_719867.1|  hypothetical protein CaO19.6771                       410   3e-141   Candida albicans SC5314
gb|EGO00904.1|  hypothetical protein SERLA73DRAFT_178893                413   4e-141   Serpula lacrymans var. lacrymans S7.3
ref|XP_002872109.1|  predicted protein                                  416   4e-141   
gb|KDB11907.1|  ubiquitin                                               412   4e-141   Ustilaginoidea virens
gb|KIL68862.1|  hypothetical protein M378DRAFT_157997                   412   4e-141   Amanita muscaria Koide BX008
ref|XP_010911599.1|  PREDICTED: polyubiquitin 4                         415   5e-141   Elaeis guineensis
gb|ADP05114.1|  polyubiquitin 10                                        409   5e-141   Aponogeton madagascariensis [laceleaf]
emb|CDP08567.1|  unnamed protein product                                414   5e-141   Coffea canephora [robusta coffee]
ref|XP_002992988.1|  hypothetical protein SELMODRAFT_187148             409   5e-141   Selaginella moellendorffii
ref|XP_002508175.1|  ubiquitin                                          415   5e-141   Micromonas commoda
emb|CCL99875.1|  predicted protein                                      412   6e-141   Fibroporia radiculosa
gb|KJB62485.1|  hypothetical protein B456_009G418900                    412   6e-141   Gossypium raimondii
emb|CEF99839.1|  Ubiquitin conserved site                               413   6e-141   Ostreococcus tauri
ref|XP_006396612.1|  hypothetical protein EUTSA_v10028730mg             415   6e-141   Eutrema salsugineum [saltwater cress]
ref|XP_010240636.1|  PREDICTED: polyubiquitin isoform X1                415   6e-141   
ref|XP_009108753.1|  PREDICTED: polyubiquitin 11-like                   409   6e-141   Brassica rapa
ref|XP_002874006.1|  hypothetical protein ARALYDRAFT_488966             415   6e-141   
ref|NP_001174480.1|  Os05g0504766                                       415   6e-141   
ref|XP_007154493.1|  hypothetical protein PHAVU_003G123500g             417   6e-141   Phaseolus vulgaris [French bean]
gb|EYU18102.1|  hypothetical protein MIMGU_mgv1a008166mg                415   6e-141   Erythranthe guttata [common monkey flower]
ref|XP_006428816.1|  hypothetical protein CICLE_v10011684mg             415   6e-141   
ref|NP_568397.1|  ubiquitin 4                                           415   6e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010558157.1|  PREDICTED: polyubiquitin-like                      415   6e-141   Tarenaya hassleriana [spider flower]
gb|ABU40645.1|  polyubiquitin                                           415   6e-141   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010062974.1|  PREDICTED: polyubiquitin                           416   7e-141   Eucalyptus grandis [rose gum]
gb|AAY86773.1|  polyubiquitin                                           415   7e-141   Noccaea caerulescens
ref|XP_006381473.1|  polyubiquitin family protein                       412   7e-141   
ref|XP_002266370.1|  PREDICTED: polyubiquitin 4-like                    415   7e-141   Vitis vinifera
ref|XP_006302388.1|  hypothetical protein CARUB_v10020456mg             415   7e-141   Capsella rubella
ref|NP_001105376.1|  polyubiquitin                                      415   7e-141   
ref|XP_010696408.1|  PREDICTED: polyubiquitin 4                         415   7e-141   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001783045.1|  predicted protein                                  409   7e-141   
gb|EYU33608.1|  hypothetical protein MIMGU_mgv1a004315mg                415   7e-141   Erythranthe guttata [common monkey flower]
emb|CDR41572.1|  RHTO0S06e03070g1_1                                     409   7e-141   Rhodotorula toruloides
ref|XP_010324327.1|  PREDICTED: polyubiquitin isoform X2                415   7e-141   
ref|XP_001420612.1|  predicted protein                                  415   7e-141   Ostreococcus lucimarinus CCE9901
ref|XP_009596689.1|  PREDICTED: polyubiquitin-like                      415   7e-141   Nicotiana tomentosiformis
ref|XP_010454368.1|  PREDICTED: polyubiquitin 4-like                    415   8e-141   Camelina sativa [gold-of-pleasure]
ref|XP_010270791.1|  PREDICTED: polyubiquitin-like                      415   8e-141   Nelumbo nucifera [Indian lotus]
gb|ADD52202.1|  ubiquitin                                               415   8e-141   Catharanthus roseus [chatas]
gb|KIK92093.1|  hypothetical protein PAXRUDRAFT_830299                  409   8e-141   Paxillus rubicundulus Ve08.2h10
gb|AAQ07453.1|  ubiquitin                                               415   8e-141   Musa acuminata AAA Group [Cavendish banana]
sp|Q58G87.2|UBQ3_ORYSJ  RecName: Full=Polyubiquitin 3; Contains: ...    415   8e-141   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006372519.1|  polyubiquitin family protein                       412   9e-141   Populus trichocarpa [western balsam poplar]
gb|AAX40652.1|  polyubiquitin                                           414   9e-141   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001830230.1|  ubiquitin                                          412   9e-141   Coprinopsis cinerea okayama7#130
gb|ACS68205.1|  ubiquitin 10.2                                          414   9e-141   Brassica napus [oilseed rape]
gb|EMS65864.1|  Polyubiquitin                                           415   9e-141   Triticum urartu
ref|XP_003542730.1|  PREDICTED: polyubiquitin 10-like                   417   1e-140   
ref|NP_849299.4|  polyubiquitin 10                                      417   1e-140   Arabidopsis thaliana [mouse-ear cress]
gb|AHC00631.1|  polyubiquitin                                           412   1e-140   Ganoderma lucidum
gb|KJB13590.1|  hypothetical protein B456_002G083000                    417   1e-140   Gossypium raimondii
gb|AGV54228.1|  polyubiquitin-like protein                              414   1e-140   Phaseolus vulgaris [French bean]
ref|XP_009591312.1|  PREDICTED: polyubiquitin 4                         414   1e-140   Nicotiana tomentosiformis
ref|XP_010431529.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    417   1e-140   Camelina sativa [gold-of-pleasure]
ref|XP_006287868.1|  hypothetical protein CARUB_v10001095mg             415   1e-140   
gb|KJB81827.1|  hypothetical protein B456_013G163500                    417   1e-140   Gossypium raimondii
ref|XP_009784905.1|  PREDICTED: polyubiquitin-like isoform X1           417   1e-140   Nicotiana sylvestris
gb|KJB81824.1|  hypothetical protein B456_013G163500                    415   1e-140   Gossypium raimondii
ref|XP_010493589.1|  PREDICTED: polyubiquitin-like                      416   1e-140   Camelina sativa [gold-of-pleasure]
ref|XP_010421267.1|  PREDICTED: polyubiquitin 4-like                    414   1e-140   Camelina sativa [gold-of-pleasure]
ref|XP_001555417.1|  polyubiquitin                                      411   1e-140   Botrytis cinerea B05.10
ref|XP_008020911.1|  hypothetical protein SETTUDRAFT_162442             411   1e-140   Exserohilum turcica Et28A
gb|EWZ40370.1|  ubiquitin C                                             408   1e-140   Fusarium oxysporum Fo47
gb|KIR29996.1|  polyubiquitin                                           412   1e-140   Cryptococcus gattii VGII LA55
ref|XP_003030030.1|  polyubiquitin                                      411   1e-140   Schizophyllum commune H4-8
ref|XP_001598085.1|  polyubiquitin                                      411   1e-140   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_001764949.1|  predicted protein                                  412   1e-140   
ref|NP_001053957.1|  Os04g0628100                                       414   1e-140   
dbj|BAL61087.1|  polyubiquitin                                          408   1e-140   Dianthus caryophyllus [carnation]
gb|KIY45417.1|  ubiquitin                                               411   1e-140   Fistulina hepatica ATCC 64428
ref|XP_008441422.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    417   1e-140   Cucumis melo [Oriental melon]
gb|KIJ45725.1|  hypothetical protein M422DRAFT_106821                   411   1e-140   Sphaerobolus stellatus SS14
ref|XP_001828882.1|  ubiquitin C                                        411   1e-140   Coprinopsis cinerea okayama7#130
emb|CAB81074.1|  polyubiquitin (ubq10)                                  417   1e-140   Arabidopsis thaliana [mouse-ear cress]
gb|KIY53974.1|  polyubiquitin                                           411   2e-140   Fistulina hepatica ATCC 64428
ref|XP_011048569.1|  PREDICTED: polyubiquitin 3-like                    411   2e-140   Populus euphratica
gb|KDQ20365.1|  hypothetical protein BOTBODRAFT_123907                  411   2e-140   Botryobasidium botryosum FD-172 SS1
ref|XP_007763327.1|  polyubiquitin                                      411   2e-140   Coniophora puteana RWD-64-598 SS2
ref|XP_008244357.1|  PREDICTED: polyubiquitin isoform X1                417   2e-140   Prunus mume [ume]
gb|KIR63773.1|  polyubiquitin                                           411   2e-140   Cryptococcus gattii CA1873
ref|XP_003670049.1|  hypothetical protein NDAI_0D04930                  408   2e-140   Naumovozyma dairenensis CBS 421
gb|KIM67150.1|  hypothetical protein SCLCIDRAFT_1210637                 411   2e-140   Scleroderma citrinum Foug A
ref|XP_007366816.1|  polyubiquitin                                      410   2e-140   Dichomitus squalens LYAD-421 SS1
ref|XP_007205619.1|  hypothetical protein PRUPE_ppa009116mg             408   2e-140   
gb|KJB62483.1|  hypothetical protein B456_009G418900                    414   2e-140   Gossypium raimondii
ref|XP_007864655.1|  ubiquitin                                          414   2e-140   Gloeophyllum trabeum ATCC 11539
gb|KJB62486.1|  hypothetical protein B456_009G418900                    414   2e-140   Gossypium raimondii
ref|XP_002953480.1|  polyubiquitin                                      410   2e-140   Volvox carteri f. nagariensis
sp|P0CG73.1|UBI1P_CANAX  RecName: Full=Polyubiquitin; Contains: R...    407   3e-140   Candida albicans
emb|CCT70325.1|  UBI4-Ubiquitin                                         409   3e-140   Fusarium fujikuroi IMI 58289
gb|AAN31845.1|  putative polyubiquitin (UBQ10)                          416   3e-140   Arabidopsis thaliana [mouse-ear cress]
emb|CEP60563.1|  LALA0S01e13784g1_1                                     407   3e-140   Lachancea lanzarotensis
ref|XP_001931824.1|  ubiquitin                                          407   3e-140   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_007924320.1|  hypothetical protein MYCFIDRAFT_60610              407   3e-140   Pseudocercospora fijiensis CIRAD86
ref|XP_002419618.1|  ubiquitin, putative                                410   4e-140   Candida dubliniensis CD36
ref|XP_011038259.1|  PREDICTED: polyubiquitin-like                      410   4e-140   Populus euphratica
ref|XP_010324326.1|  PREDICTED: polyubiquitin isoform X1                416   4e-140   
ref|XP_007049060.1|  Polyubiquitin 10                                   416   4e-140   
gb|KII93501.1|  hypothetical protein PLICRDRAFT_694663                  412   4e-140   Plicaturopsis crispa FD-325 SS-3
gb|AAO43308.1|  putative polyubiquitin                                  408   4e-140   Arabidopsis thaliana [mouse-ear cress]
gb|EPX74297.1|  ubiquitin                                               407   4e-140   Schizosaccharomyces octosporus yFS286
dbj|GAK65396.1|  ubiquitin                                              411   5e-140   Moesziomyces antarcticus
ref|XP_007154492.1|  hypothetical protein PHAVU_003G123400g             412   5e-140   Phaseolus vulgaris [French bean]
ref|XP_004953565.1|  PREDICTED: polyubiquitin-like                      416   5e-140   Setaria italica
ref|XP_011037020.1|  PREDICTED: polyubiquitin-like                      413   5e-140   Populus euphratica
ref|XP_010436682.1|  PREDICTED: polyubiquitin 4-like                    416   5e-140   
ref|XP_004956019.1|  PREDICTED: polyubiquitin 4-like                    412   6e-140   Setaria italica
ref|XP_001755431.1|  predicted protein                                  407   6e-140   
ref|XP_002452705.1|  hypothetical protein SORBIDRAFT_04g031060          415   6e-140   Sorghum bicolor [broomcorn]
ref|XP_010262389.1|  PREDICTED: polyubiquitin                           415   6e-140   Nelumbo nucifera [Indian lotus]
gb|KDP42860.1|  hypothetical protein JCGZ_23802                         415   7e-140   Jatropha curcas
ref|XP_001755307.1|  predicted protein                                  409   7e-140   
emb|CAA40324.1|  hexaubiquitin protein                                  415   7e-140   Helianthus annuus
ref|XP_007211609.1|  hypothetical protein PRUPE_ppa005507mg             415   7e-140   Prunus persica
ref|XP_002891806.1|  predicted protein                                  412   7e-140   
ref|XP_006428817.1|  hypothetical protein CICLE_v10011684mg             415   7e-140   
ref|NP_001045980.1|  Os02g0161900                                       415   7e-140   
dbj|BAK02501.1|  predicted protein                                      415   7e-140   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002980153.1|  hypothetical protein SELMODRAFT_271419             409   7e-140   
ref|XP_010423744.1|  PREDICTED: polyubiquitin                           415   7e-140   Camelina sativa [gold-of-pleasure]
gb|EFN76024.1|  Ubiquitin                                               406   7e-140   Harpegnathos saltator
ref|XP_001797032.1|  hypothetical protein SNOG_06667                    407   7e-140   Parastagonospora nodorum SN15
gb|EKV18932.1|  hypothetical protein PDIP_25190                         406   8e-140   Penicillium digitatum Pd1
gb|AAB95251.1|  ubiquitin                                               415   8e-140   Arabidopsis thaliana [mouse-ear cress]
gb|EGA57707.1|  Ubi4p                                                   407   8e-140   Saccharomyces cerevisiae FostersB
gb|EYU33607.1|  hypothetical protein MIMGU_mgv1a004315mg                415   8e-140   Erythranthe guttata [common monkey flower]
dbj|BAK03691.1|  predicted protein                                      415   9e-140   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAB95252.1|  ubiquitin                                               412   1e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008345409.1|  PREDICTED: polyubiquitin-like                      415   1e-139   
ref|XP_002888365.1|  polyubiquitin                                      415   1e-139   Arabidopsis lyrata subsp. lyrata
ref|XP_010275241.1|  PREDICTED: polyubiquitin-like                      412   1e-139   Nelumbo nucifera [Indian lotus]
gb|AAD03343.1|  ubiquitin                                               415   1e-139   Pisum sativum [garden pea]
ref|XP_005644220.1|  polyubiquitin                                      409   1e-139   Coccomyxa subellipsoidea C-169
dbj|BAJ91912.1|  predicted protein                                      414   1e-139   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003542728.1|  PREDICTED: polyubiquitin-A-like isoform 1          417   1e-139   
ref|XP_011094250.1|  PREDICTED: polyubiquitin-like                      414   1e-139   Sesamum indicum [beniseed]
ref|XP_003627151.1|  Ubiquitin                                          417   1e-139   Medicago truncatula
ref|XP_003052575.1|  predicted protein                                  409   1e-139   [Nectria] haematococca mpVI 77-13-4
gb|AAM78180.1|  putative polyubiquitin                                  405   1e-139   Gossypium herbaceum [Arabian cotton]
ref|XP_011094650.1|  PREDICTED: polyubiquitin                           414   1e-139   Sesamum indicum [beniseed]
ref|XP_008350368.1|  PREDICTED: polyubiquitin                           414   1e-139   
gb|ACN40936.1|  unknown                                                 414   1e-139   Picea sitchensis
gb|EGO00841.1|  hypothetical protein SERLA73DRAFT_121253                411   1e-139   Serpula lacrymans var. lacrymans S7.3
gb|AAC16012.1|  polyubiquitin                                           414   1e-139   
gb|KII92029.1|  hypothetical protein PLICRDRAFT_172184                  412   1e-139   
gb|EUC59758.1|  polyubiquitin                                           412   1e-139   
gb|AAO43309.1|  putative polyubiquitin                                  406   1e-139   
gb|AGT38457.1|  polyubiquitin                                           415   1e-139   
gb|AFK47245.1|  unknown                                                 406   1e-139   
ref|XP_003196661.1|  ATP-dependent protein binding protein              411   1e-139   
ref|XP_003607669.1|  Multidrug resistance protein ABC transporter...    414   1e-139   
gb|KDR85168.1|  hypothetical protein GALMADRAFT_131895                  411   1e-139   
gb|EJU00136.1|  ubiquitin                                               411   1e-139   
ref|XP_001777816.1|  predicted protein                                  411   1e-139   
ref|XP_001880135.1|  ubiquitin                                          411   1e-139   
gb|KIK17147.1|  hypothetical protein PISMIDRAFT_685607                  411   2e-139   
gb|KDQ30621.1|  hypothetical protein PLEOSDRAFT_1088454                 411   2e-139   
gb|AIS40894.1|  polyubiquitin                                           415   2e-139   
gb|AGM32540.1|  polyubiquitin-B-like isoform                            407   2e-139   
gb|AFW70219.1|  polyubiquitin-like protein                              416   2e-139   
gb|AFR98116.1|  polyubiquitin                                           411   2e-139   
ref|XP_007316637.1|  hypothetical protein SERLADRAFT_368035             411   2e-139   
ref|XP_002888394.1|  hexaubiquitin protein                              415   2e-139   
emb|CCA70326.1|  related to UBI4-Ubiquitin                              405   2e-139   
gb|KIJ68260.1|  hypothetical protein HYDPIDRAFT_173033                  411   2e-139   
ref|XP_009618235.1|  PREDICTED: polyubiquitin-like isoform X1           417   2e-139   
gb|KIM22018.1|  hypothetical protein M408DRAFT_333137                   405   2e-139   
ref|XP_003010029.1|  polyubiquitin UbiD/Ubi4, putative                  405   2e-139   
gb|KIM48035.1|  hypothetical protein M413DRAFT_16078                    411   2e-139   
gb|KIM40192.1|  hypothetical protein M413DRAFT_73842                    411   2e-139   
ref|XP_009784908.1|  PREDICTED: polyubiquitin-like isoform X2           414   2e-139   
dbj|BAK61744.1|  ubiquitin                                              405   2e-139   
ref|XP_002551324.1|  ubiquitin                                          408   2e-139   
ref|XP_010046742.1|  PREDICTED: polyubiquitin-like                      414   2e-139   
ref|XP_001227036.1|  polyubiquitin                                      408   3e-139   
gb|KIM30634.1|  hypothetical protein M408DRAFT_328170                   405   3e-139   
dbj|GAA27344.2|  polyubiquitin-A                                        407   3e-139   
gb|ACX46987.1|  ubiquitin                                               413   3e-139   
gb|AAV65292.1|  polyubiquitin                                           407   3e-139   
ref|XP_001210780.1|  ubiquitin                                          407   3e-139   
ref|XP_010537590.1|  PREDICTED: polyubiquitin 11                        405   3e-139   
gb|AAC67552.1|  polyubiquitin                                           410   3e-139   
emb|CAA52290.1|  polyubiquitin                                          410   3e-139   
gb|KIW56414.1|  polyubiquitin                                           407   4e-139   
ref|XP_001266981.1|  polyubiquitin (UbiD), putative                     407   4e-139   
ref|XP_003607670.1|  Ubiquitin                                          416   4e-139   
ref|XP_002839703.1|  hypothetical protein                               407   4e-139   
gb|EKV13151.1|  hypothetical protein PDIG_39650                         407   4e-139   
gb|EYU38681.1|  hypothetical protein MIMGU_mgv1a004304mg                416   4e-139   
gb|AGM32487.1|  polyubiquitin-B-like isoform 1                          404   4e-139   
ref|XP_003402310.1|  PREDICTED: polyubiquitin-B-like isoform 1          404   4e-139   
dbj|BAP70433.1|  Ubiquitin                                              407   4e-139   
gb|AAO43306.1|  putative polyubiquitin                                  408   5e-139   
emb|CCG34086.1|  Polyubiquitin                                          407   5e-139   
gb|AEZ66647.1|  putative beta-1,6-glucanase                             410   5e-139   
emb|CCO30833.1|  Polyubiquitin                                          411   5e-139   
gb|KEZ40313.1|  Polyubiquitin                                           407   5e-139   
ref|XP_002494205.1|  Ubiquitin                                          407   5e-139   
ref|XP_010451655.1|  PREDICTED: polyubiquitin 4-like                    416   5e-139   
ref|XP_659604.1|  hypothetical protein AN2000.2                         408   5e-139   
gb|ETN78467.1|  ubiquitin family protein                                404   6e-139   
gb|EEH07231.1|  ubiquitin                                               407   6e-139   
gb|AAL91103.1|  ubiquitin                                               405   6e-139   
gb|EMS60894.1|  Polyubiquitin                                           413   6e-139   
gb|AFW66445.1|  ubiquitin2                                              416   6e-139   
gb|KDR10312.1|  Ubiquitin                                               404   6e-139   
gb|EZF98642.1|  polyubiquitin                                           404   6e-139   
dbj|GAA55031.1|  ubiquitin C                                            404   6e-139   
gb|EEQ88150.1|  ubiquitin                                               407   6e-139   
ref|XP_008645269.1|  PREDICTED: polyubiquitin                           415   6e-139   
ref|XP_004505453.1|  PREDICTED: polyubiquitin-A-like                    415   6e-139   
gb|AAA82978.1|  polyubiquitin                                           410   6e-139   
ref|XP_002976481.1|  hypothetical protein SELMODRAFT_271198             410   7e-139   
ref|XP_006350990.1|  PREDICTED: polyubiquitin-A-like                    415   7e-139   
ref|XP_010553005.1|  PREDICTED: polyubiquitin-like                      415   7e-139   
gb|AAC49013.1|  polyubiquitin containing 7 ubiquitin monomers           415   7e-139   
emb|CAA51679.1|  ubiquitin                                              415   7e-139   
gb|EYC42800.1|  hypothetical protein Y032_0517g2809                     404   7e-139   
emb|CCA16073.1|  polyubiquitin putative                                 415   8e-139   
ref|XP_003350608.1|  hypothetical protein SMAC_07925                    404   8e-139   
gb|EYU33611.1|  hypothetical protein MIMGU_mgv1a004315mg                415   8e-139   
gb|EYU18101.1|  hypothetical protein MIMGU_mgv1a004289mg                415   8e-139   
gb|ABD32351.2|  Ubiquitin                                               415   8e-139   
ref|XP_007410937.1|  hypothetical protein MELLADRAFT_87680              415   8e-139   
ref|XP_009620669.1|  PREDICTED: polyubiquitin-like                      417   8e-139   
ref|XP_002992907.1|  hypothetical protein SELMODRAFT_162680             409   9e-139   
gb|EGE85556.1|  hypothetical protein BDDG_08501                         407   9e-139   
ref|XP_006694532.1|  hypothetical protein CTHT_0041260                  407   9e-139   
ref|XP_751791.1|  polyubiquitin UbiD/Ubi4                               407   9e-139   
ref|XP_010756991.1|  polyubiquitin                                      407   9e-139   
ref|XP_003608276.1|  Ubiquitin                                          415   9e-139   
ref|XP_011302492.1|  PREDICTED: polyubiquitin-B                         407   9e-139   
gb|EEH20847.2|  polyubiquitin                                           407   9e-139   
ref|XP_004249885.1|  PREDICTED: polyubiquitin-like                      415   9e-139   
tpd|FAA00317.1|  TPA: polyubiquitin                                     406   9e-139   
ref|XP_006480550.1|  PREDICTED: polyubiquitin-A-like                    415   1e-138   
emb|CDH08450.1|  ubiquitin and ubiquitin-like proteins                  406   1e-138   
gb|AAO43310.1|  putative polyubiquitin                                  404   1e-138   
gb|KIY97628.1|  ubiquitin C                                             406   1e-138   
ref|XP_008816966.1|  polyubiquitin                                      406   1e-138   
gb|KHN45015.1|  Polyubiquitin-A                                         417   1e-138   
ref|XP_009150698.1|  PREDICTED: polyubiquitin                           415   1e-138   
ref|XP_002791169.1|  ubiquitin                                          406   1e-138   
dbj|BAK61751.1|  ubiquitin                                              403   1e-138   
sp|P23324.2|UBIQP_EUPEU  RecName: Full=Polyubiquitin; Contains: R...    403   1e-138   
ref|XP_006352490.1|  PREDICTED: polyubiquitin-A-like isoform X1         417   1e-138   
dbj|BAL61084.1|  polyubiqutin                                           409   1e-138   
tpe|CBF85986.1|  TPA: Polyubiquitin Fragment [Source:UniProtKB/Tr...    406   1e-138   
gb|AAO43305.1|  putative polyubiquitin                                  407   1e-138   
sp|P0CH27.1|RL402_TRYCR  RecName: Full=Ubiquitin-60S ribosomal pr...    408   1e-138   
ref|XP_003607668.1|  Multidrug resistance protein ABC transporter...    413   2e-138   
ref|XP_007808982.1|  ubiquitin                                          407   2e-138   
ref|XP_002171731.1|  ubiquitin                                          409   2e-138   
emb|CDI53149.1|  probable Polyubiquitin protein                         406   2e-138   
gb|ABV22331.1|  ubiquitin                                               405   2e-138   
ref|XP_008034069.1|  ubiquitin 10.1                                     412   2e-138   
ref|XP_002267017.1|  PREDICTED: polyubiquitin-like                      414   2e-138   
ref|XP_567862.1|  ATP-dependent protein binding protein                 411   2e-138   
ref|XP_007307433.1|  polyubiquitin                                      411   2e-138   
ref|XP_001246797.1|  polyubiquitin                                      405   2e-138   
ref|XP_007861169.1|  polyubiquitin                                      411   2e-138   
emb|CAN71997.1|  hypothetical protein VITISV_004025                     414   2e-138   
ref|XP_004341200.1|  polyubiquitin, putative                            403   2e-138   
dbj|GAA87419.1|  polyubiquitin                                          405   2e-138   
tpd|FAA00319.1|  TPA: polyubiquitin                                     411   2e-138   
gb|EWS74283.1|  polyubiquitin                                           403   2e-138   
gb|AAY33920.2|  polyubiquitin                                           409   2e-138   
gb|AAL91109.1|  ubiquitin                                               405   2e-138   
ref|XP_011388891.1|  putative ubiquitin                                 411   2e-138   
ref|XP_004365491.1|  polyubiquitin 5                                    402   3e-138   
ref|XP_001538486.1|  polyubiquitin                                      405   3e-138   
gb|KJB62482.1|  hypothetical protein B456_009G418900                    408   3e-138   
gb|EMS24129.1|  ubiquitin C                                             403   3e-138   
ref|XP_002842034.1|  hypothetical protein                               405   3e-138   
gb|ADD24466.1|  Ubiquitin                                               402   3e-138   
gb|EJD76734.1|  polyubiquitin, variant 2                                406   3e-138   
gb|ABF66639.1|  ubiquitin                                               405   3e-138   
ref|XP_005056764.1|  PREDICTED: polyubiquitin-C-like isoform X2         402   3e-138   
ref|XP_011275993.1|  ubiquitin C                                        408   3e-138   
ref|XP_453980.1|  hypothetical protein                                  408   4e-138   
gb|KDQ63803.1|  hypothetical protein JAAARDRAFT_29850                   411   4e-138   
gb|AEH41483.1|  ubiquitin                                               405   4e-138   
emb|CAI83758.1|  Polyubiqutin 5                                         402   4e-138   
ref|NP_013061.1|  ubiquitin                                             408   4e-138   
emb|CAJ41447.1|  polyubiquitin                                          405   4e-138   
gb|ELR08709.1|  polyubiquitin                                           408   4e-138   
ref|XP_003675939.1|  hypothetical protein NCAS_0C05850                  408   5e-138   
ref|XP_003290908.1|  ubiquitin                                          402   5e-138   
emb|CCA40372.1|  Ubiquitin cross-reactive protein                       408   5e-138   
ref|XP_002627625.1|  ubiquitin                                          407   5e-138   
dbj|BAO38900.1|  ubiquitin                                              407   5e-138   
tpd|FAA00316.1|  TPA: polyubiquitin                                     407   5e-138   
ref|NP_983342.1|  ACL062Cp                                              407   5e-138   
ref|NP_595409.1|  ubiquitin                                             407   5e-138   
ref|XP_005831810.1|  ubiquitin                                          402   6e-138   
ref|XP_002723083.2|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    402   7e-138   
gb|KFY77115.1|  hypothetical protein V499_03430                         407   8e-138   
gb|AAA31133.1|  poly-ubiquitin precursor                                402   8e-138   
ref|XP_004946726.1|  PREDICTED: polyubiquitin-C-like isoform X8         402   8e-138   
ref|XP_003331105.1|  polyubiquitin-A                                    415   8e-138   
ref|XP_007545871.1|  PREDICTED: polyubiquitin-B isoform X2              402   9e-138   
ref|XP_958803.1|  ubiquitin                                             404   9e-138   
ref|XP_001774326.1|  predicted protein                                  409   1e-137   
ref|XP_002973843.1|  hypothetical protein SELMODRAFT_173723             409   1e-137   
ref|XP_007057723.1|  PREDICTED: polyubiquitin-C isoform X1              401   1e-137   
ref|XP_004946727.1|  PREDICTED: polyubiquitin-C-like isoform X9         401   1e-137   
ref|XP_008243902.1|  PREDICTED: polyubiquitin-like isoform X1           412   1e-137   
emb|CAA72799.1|  polyubiquitin precursor                                407   1e-137   
ref|XP_004505084.1|  PREDICTED: polyubiquitin-A-like                    417   1e-137   
ref|XP_008426285.1|  PREDICTED: polyubiquitin-B isoform X1              402   1e-137   
gb|KIZ01427.1|  ubiquitin C                                             407   1e-137   
ref|XP_011152175.1|  PREDICTED: polyubiquitin                           407   1e-137   
ref|XP_006593991.1|  PREDICTED: polyubiquitin 10-like isoform X3        417   2e-137   
ref|XP_667472.1|  ubiquitin B                                           400   2e-137   
ref|XP_010602597.1|  PREDICTED: polyubiquitin-C                         400   2e-137   
gb|ACL98140.1|  ubiquitin C variant                                     401   2e-137   
ref|XP_003843815.1|  hypothetical protein LEMA_P014660.1                407   2e-137   
ref|XP_009901570.1|  PREDICTED: polyubiquitin-B isoform X1              400   2e-137   
ref|XP_006306291.1|  hypothetical protein CARUB_v10012156mg             409   2e-137   
ref|XP_010177726.1|  PREDICTED: polyubiquitin-B isoform X5              401   2e-137   
ref|XP_011094688.1|  PREDICTED: polyubiquitin-like                      414   2e-137   
gb|EDM13555.1|  rCG21222, isoform CRA_a                                 402   2e-137   
ref|XP_008924878.1|  PREDICTED: polyubiquitin isoform X5                401   2e-137   
ref|XP_002099886.1|  GE16472                                            400   2e-137   
ref|XP_001018501.1|  Ubiquitin family protein                           400   2e-137   
gb|AAA28997.1|  ubiquitin                                               400   2e-137   
ref|XP_002771956.1|  polyubiquitin, putative                            400   2e-137   
emb|CAX72421.1|  ubiquitin C                                            400   2e-137   
ref|XP_002553736.1|  KLTH0E05852p                                       407   2e-137   
gb|AAP80689.1|  polyubiquitin                                           400   2e-137   
ref|XP_008003373.1|  PREDICTED: polyubiquitin-C                         400   2e-137   
ref|XP_001610925.1|  polyubiquitin                                      400   2e-137   
gb|KIJ26545.1|  hypothetical protein M422DRAFT_216245                   412   2e-137   
gb|AAC84175.1|  ubiquitin                                               400   3e-137   
ref|XP_001766873.1|  predicted protein                                  404   3e-137   
emb|CAX72419.1|  polyubiquitin                                          400   3e-137   
dbj|BAE40351.1|  unnamed protein product                                402   3e-137   
gb|EKC42613.1|  Ubiquitin                                               399   3e-137   
ref|XP_008300055.1|  PREDICTED: polyubiquitin-B                         400   3e-137   
gb|EJD76736.1|  polyubiquitin, variant 1                                405   3e-137   
ref|XP_004395987.1|  PREDICTED: polyubiquitin-B-like isoform 1          400   3e-137   
gb|AGZ15412.1|  fiber polyubiquitin                                     400   3e-137   
gb|AFD53810.1|  ubiquitin                                               401   3e-137   
ref|XP_626192.1|  polyubiquitin with 3 Ub domains                       400   3e-137   
ref|XP_002674746.1|  polyubiquitin                                      400   3e-137   
ref|XP_005023176.1|  PREDICTED: polyubiquitin-C isoform X2              400   3e-137   
ref|NP_001133175.1|  polyubiquitin                                      400   3e-137   
ref|XP_010298601.1|  PREDICTED: polyubiquitin-B isoform X3              399   3e-137   
gb|AAO43303.1|  putative polyubiquitin                                  403   3e-137   
ref|XP_003142560.1|  ubiquitin C II                                     406   3e-137   
emb|CAJ32646.1|  ubiquitin                                              399   3e-137   
gb|AAO43304.1|  putative polyubiquitin                                  403   4e-137   
ref|XP_005620147.1|  PREDICTED: polyubiquitin-B isoform X2              399   4e-137   
ref|XP_005620146.1|  PREDICTED: polyubiquitin-B isoform X1              400   4e-137   
emb|CAA11269.1|  polyubiquitin                                          405   4e-137   
ref|XP_005439794.1|  PREDICTED: polyubiquitin-B isoform X3              399   4e-137   
ref|XP_010298600.1|  PREDICTED: polyubiquitin-B isoform X2              399   4e-137   
ref|NP_061828.1|  polyubiquitin-B precursor                             399   4e-137   
ref|XP_001616591.1|  polyubiquitin 5                                    405   4e-137   
gb|KFY10578.1|  hypothetical protein V492_04946                         407   4e-137   
pir||T02358  ubiquitin homolog T8F5.13 - Arabidopsis thaliana           403   4e-137
ref|XP_002498336.1|  ZYRO0G07854p                                       408   4e-137   
gb|ABI53721.1|  polyubiquitin                                           408   4e-137   
ref|XP_004205544.1|  PREDICTED: polyubiquitin-B-like isoform 2          402   4e-137   



>gb|ABH08755.1| ubiquitin [Arabidopsis thaliana]
Length=221

 Score =   417 bits (1071),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  13   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  72

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  73   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  132

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  133  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  192

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  193  QLEDGRTLADYNIQKESTLHLVLRLRGGF  221


 Score =   286 bits (733),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  526  TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  347
            TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH
Sbjct  1    TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  60

Query  346  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  167
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  61   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  120

Query  166  GRTLADYNIQKESTLHLVLRLRGGF  92
            GRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  GRTLADYNIQKESTLHLVLRLRGGM  145



>ref|NP_567286.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_849291.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001031585.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_567247.2| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118936.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|XP_002305607.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006370636.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_007157173.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 ref|XP_007211604.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211605.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211608.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008349294.1| PREDICTED: polyubiquitin 11 [Malus domestica]
 ref|XP_010437606.1| PREDICTED: polyubiquitin 11 isoform X1 [Camelina sativa]
 ref|XP_010437607.1| PREDICTED: polyubiquitin 11 isoform X2 [Camelina sativa]
 ref|XP_010491428.1| PREDICTED: polyubiquitin 11 [Camelina sativa]
 sp|P0CH33.1|UBQ11_ARATH RecName: Full=Polyubiquitin 11; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD48980.1|AF162444_12 contains similarity to Pfam family PF00240 - Ubiquitin family; 
score=526.5, E=1.9e-154, N=3 [Arabidopsis thaliana]
 emb|CAA10056.1| polyubiquitin [Vicia faba]
 emb|CAB81047.1| AT4g05050 [Arabidopsis thaliana]
 emb|CAC27335.1| putative polyubiquitin [Picea abies]
 gb|AAK96565.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL06940.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL09770.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAM19968.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAN65052.1| Unknown protein [Arabidopsis thaliana]
 gb|AAV92464.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92465.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92466.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92467.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92468.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92469.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92470.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92471.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92472.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92473.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92474.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92475.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92476.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92477.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92478.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92479.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92480.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92481.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92482.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92483.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92484.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92485.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92486.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92487.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92488.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92489.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92490.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 dbj|BAE98552.1| hypothetical protein [Arabidopsis thaliana]
 gb|EEE86118.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|AEE82244.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82245.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82468.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82469.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82470.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AFP43343.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12803.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12804.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12807.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|AGV54265.1| ubiquitin 11 [Phaseolus vulgaris]
 gb|ERP67205.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESW29167.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 gb|AES82698.2| polyubiquitin 3 [Medicago truncatula]
 gb|AJA29686.1| polyubiquitin Ubi4 [Betula luminifera]
 gb|KJB67136.1| hypothetical protein B456_010G177000 [Gossypium raimondii]
 gb|KJB69250.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69251.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69252.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=229

 Score =   417 bits (1071),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   302 bits (773),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ABH08753.1| ubiquitin [Arabidopsis thaliana]
Length=219

 Score =   416 bits (1070),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  11   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  70

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  71   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  130

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  131  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  190

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  191  QLEDGRTLADYNIQKESTLHLVLRLRGGF  219


 Score =   282 bits (722),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  520  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  341
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  60

Query  340  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  161
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  61   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  120

Query  160  TLADYNIQKESTLHLVLRLRGGF  92
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  121  TLADYNIQKESTLHLVLRLRGGM  143



>ref|XP_008358804.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like, partial 
[Malus domestica]
Length=260

 Score =   417 bits (1072),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   317 bits (811),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  236
            STLHLVLRLRGGMQIFVKT TGKTITLE ESSDTIDNVKAK
Sbjct  217  STLHLVLRLRGGMQIFVKTXTGKTITLEXESSDTIDNVKAK  257


 Score =   304 bits (778),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ACJ85618.1| unknown [Medicago truncatula]
Length=229

 Score =   416 bits (1068),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGY  229


 Score =   302 bits (773),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002872805.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49064.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   419 bits (1076),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   330 bits (845),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/166 (99%), Positives = 166/166 (100%), Gaps = 0/166 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  221
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK+
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKK  262


 Score =   305 bits (781),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ACJ85643.1| unknown [Medicago truncatula]
Length=229

 Score =   416 bits (1068),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   300 bits (769),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AIZ74335.1| polyubiquitin 3, partial [Pinus massoniana]
Length=244

 Score =   416 bits (1069),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  10   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  69

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  70   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  129

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  130  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  189

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  190  QLEDGRTLADYNIQKESTLHLVLRLRGGM  218


 Score =   315 bits (807),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 158/159 (99%), Positives = 159/159 (100%), Gaps = 0/159 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  86   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  145

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  146  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  205

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  242
            STLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  206  STLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  244


 Score =   281 bits (718),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/142 (99%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = -1

Query  517  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  338
            TITLE+ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
Sbjct  1    TITLELESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  60

Query  337  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  158
            RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  61   RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  120

Query  157  LADYNIQKESTLHLVLRLRGGF  92
            LADYNIQKESTLHLVLRLRGG 
Sbjct  121  LADYNIQKESTLHLVLRLRGGM  142



>ref|XP_003626479.1| Ubiquitin-like protein [Medicago truncatula]
 gb|AES82697.1| polyubiquitin 3 [Medicago truncatula]
Length=277

 Score =   417 bits (1072),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  69   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  128

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  129  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  188

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  189  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  248

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  249  QLEDGRTLADYNIQKESTLHLVLRLRGGF  277


 Score =   302 bits (774),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  49   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  108

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  109  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  168

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  169  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  201



>gb|AAB36546.1| polyubiquitin [Phaseolus vulgaris]
Length=215

 Score =   414 bits (1065),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  7    DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  66

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  67   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  126

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  127  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  186

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  187  QLEDGRTLADYNIQKESTLHLVLRLRGGL  215


 Score =   276 bits (705),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 138/139 (99%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -1

Query  508  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  329
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  1    LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  60

Query  328  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  149
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  61   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  120

Query  148  YNIQKESTLHLVLRLRGGF  92
            YNIQKESTLHLVLRLRGG 
Sbjct  121  YNIQKESTLHLVLRLRGGM  139



>dbj|BAC57955.1| polyubiquitin [Aster tripolium]
Length=229

 Score =   415 bits (1066),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGL  229


 Score =   302 bits (774),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010931017.1| PREDICTED: polyubiquitin 11 isoform X1 [Elaeis guineensis]
 ref|XP_010931026.1| PREDICTED: polyubiquitin 11 isoform X2 [Elaeis guineensis]
 ref|XP_010923942.1| PREDICTED: polyubiquitin 11 [Elaeis guineensis]
Length=229

 Score =   415 bits (1066),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   302 bits (774),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006370634.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67203.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
Length=261

 Score =   416 bits (1069),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   313 bits (802),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 157/157 (100%), Positives = 157/157 (100%), Gaps = 0/157 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  248
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  253


 Score =   303 bits (776),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009114489.1| PREDICTED: polyubiquitin-like [Brassica rapa]
Length=305

 Score =   417 bits (1073),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   411 bits (1057),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   299 bits (765),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 46.2 bits (108),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -3

Query  809  FHLVXRXRGGMQIFVKTXTGKTITLR  732
             HLV R RGGMQIFVKT TGKTITL 
Sbjct  67   LHLVLRLRGGMQIFVKTLTGKTITLE  92


 Score = 30.0 bits (66),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  852  GXTLAXYNIQKESTLPL  802
            G TLA YNIQKESTL L
Sbjct  53   GRTLADYNIQKESTLHL  69



>gb|AET06143.1| ubiquitin [Papaver somniferum]
Length=229

 Score =   415 bits (1066),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAM64530.1| ubiquitin homolog [Arabidopsis thaliana]
Length=229

 Score =   415 bits (1066),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL LRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLXLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   300 bits (767),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLXLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010490793.1| PREDICTED: polyubiquitin 11-like [Camelina sativa]
Length=230

 Score =   415 bits (1066),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_004968120.1| PREDICTED: polyubiquitin-like [Setaria italica]
 ref|XP_009404996.1| PREDICTED: polyubiquitin 11 [Musa acuminata subsp. malaccensis]
 gb|ABS18744.1| ubiqutin ligase-like protein [Oryza sativa Japonica Group]
 dbj|BAJ88219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score =   414 bits (1065),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006288299.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21197.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=230

 Score =   414 bits (1065),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   302 bits (774),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EEC81189.1| hypothetical protein OsI_24195 [Oryza sativa Indica Group]
Length=223

 Score =   414 bits (1064),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  15   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  74

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  75   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  134

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  135  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  194

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  195  QLEDGRTLADYNIQKESTLHLVLRLRGG  222


 Score =   276 bits (706),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -1

Query  511  TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  332
            T EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL
Sbjct  8    TCEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  67

Query  331  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  152
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  68   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  127

Query  151  DYNIQKESTLHLVLRLRGGF  92
            DYNIQKESTLHLVLRLRGG 
Sbjct  128  DYNIQKESTLHLVLRLRGGM  147



>gb|ABH08754.1| ubiquitin [Arabidopsis thaliana]
Length=220

 Score =   414 bits (1064),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  11   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  70

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  71   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  130

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  131  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  190

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  191  QLEDGRTLADYNIQKESTLHLVLRLRGG  218


 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  520  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  341
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  60

Query  340  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  161
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  61   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  120

Query  160  TLADYNIQKESTLHLVLRLRGGF  92
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  121  TLADYNIQKESTLHLVLRLRGGM  143



>ref|XP_002317213.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ABK95814.1| unknown [Populus trichocarpa]
 gb|EEE97825.1| polyubiquitin family protein [Populus trichocarpa]
Length=229

 Score =   414 bits (1065),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGI  229


 Score =   302 bits (774),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAF31707.1|AF221858_1 polyubiquitin [Euphorbia esula]
Length=215

 Score =   414 bits (1063),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  7    DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  66

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  67   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  126

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  127  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  186

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  187  QLEDGRTLADYNIQKESTLHLVLRLRGG  214


 Score =   276 bits (705),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/139 (99%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -1

Query  508  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  329
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  1    LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  60

Query  328  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  149
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  61   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  120

Query  148  YNIQKESTLHLVLRLRGGF  92
            YNIQKESTLHLVLRLRGG 
Sbjct  121  YNIQKESTLHLVLRLRGGM  139



>ref|XP_003570150.1| PREDICTED: polyubiquitin 11 isoform X2 [Brachypodium distachyon]
Length=241

 Score =   415 bits (1066),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 211/216 (98%), Gaps = 0/216 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF*IP*CPN  71
            QLEDGRTLADYNIQKESTLHLVLRLRGG  +  C N
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGALMQWCLN  236


 Score =   301 bits (771),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CAA48140.1| ubiquitin [Antirrhinum majus]
Length=296

 Score =   417 bits (1071),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  88   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  147

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  148  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  207

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  208  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  267

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  268  QLEDGRTLADYNIQKESTLHLVLRLRGGF  296


 Score =   414 bits (1065),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  12   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  71

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  72   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  131

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  132  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  191

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  192  QLEDGRTLADYNIQKESTLHLVLRLRGGM  220


 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = -1

Query  523  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  344
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  343  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  164
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  163  RTLADYNIQKESTLHLVLRLRGGF  92
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGM  144



>gb|ABK94002.1| unknown [Populus trichocarpa]
Length=305

 Score =   417 bits (1072),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   411 bits (1056),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD NIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAP31578.1| ubiquitin [Hevea brasiliensis]
Length=230

 Score =   414 bits (1064),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   302 bits (774),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ABD96088.1| polyubiquitin [Malus domestica]
Length=270

 Score =   416 bits (1069),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  62   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  121

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  122  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  181

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  182  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  241

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  242  QLEDGRTLADYNIQKESTLHLVLRLRGGF  270


 Score =   384 bits (987),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 193/194 (99%), Positives = 193/194 (99%), Gaps = 0/194 (0%)
 Frame = -1

Query  673  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  494
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  60

Query  493  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  314
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  313  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  134
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180

Query  133  ESTLHLVLRLRGGF  92
            ESTLHLVLRLRGG 
Sbjct  181  ESTLHLVLRLRGGM  194



>emb|CAH59739.1| polyubiquitin [Plantago major]
Length=232

 Score =   414 bits (1065),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGL  229


 Score =   302 bits (773),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   267 bits (682),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIF  311
            STLHLVLRLRGG+  F
Sbjct  217  STLHLVLRLRGGLTGF  232



>gb|EYU33610.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=229

 Score =   414 bits (1064),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   302 bits (774),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   266 bits (679),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/133 (99%), Positives = 133/133 (100%), Gaps = 0/133 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGM  320
            STLHLVLRLRGG+
Sbjct  217  STLHLVLRLRGGV  229



>gb|KJB36627.1| hypothetical protein B456_006G167800 [Gossypium raimondii]
Length=229

 Score =   414 bits (1064),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   302 bits (774),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EPS72031.1| polyubiquitin, partial [Genlisea aurea]
Length=274

 Score =   416 bits (1068),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  66   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  125

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  126  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  185

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  186  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  245

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  246  QLEDGRTLADYNIQKESTLHLVLRLRGGF  274


 Score =   392 bits (1008),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 197/198 (99%), Positives = 197/198 (99%), Gaps = 0/198 (0%)
 Frame = -1

Query  685  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  506
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  1    DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  60

Query  505  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  326
            EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  61   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  120

Query  325  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  146
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  121  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  180

Query  145  NIQKESTLHLVLRLRGGF  92
            NIQKESTLHLVLRLRGG 
Sbjct  181  NIQKESTLHLVLRLRGGM  198



>ref|XP_010453358.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   417 bits (1071),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   413 bits (1062),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|NP_849292.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118922.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_974516.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002316978.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_002874829.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_004146845.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004165599.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004293260.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_006383941.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006377831.1| polyubiquitin family protein [Populus trichocarpa]
 ref|XP_006377832.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377833.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372945.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 ref|XP_006396614.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396615.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006589609.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_006593990.1| PREDICTED: polyubiquitin 10-like isoform X2 [Glycine max]
 ref|XP_006606032.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_007211603.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008454542.1| PREDICTED: polyubiquitin [Cucumis melo]
 ref|XP_009134330.1| PREDICTED: polyubiquitin [Brassica rapa]
 ref|XP_010422419.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_011007895.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011010177.1| PREDICTED: polyubiquitin [Populus euphratica]
 sp|P69325.2|UBIQP_SOYBN RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Glycine max]
 sp|Q3E7T8.2|UBQ14_ARATH RecName: Full=Polyubiquitin 14; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 pir||S49332 polyubiquitin 4 - common sunflower
 pir||G85036 polyubiquitin [imported] - Arabidopsis thaliana
 dbj|BAA03764.1| ubiquitin [Glycine max]
 dbj|BAA05670.1| ubiquitin [Glycine max]
 emb|CAA84440.1| seed tetraubiquitin [Helianthus annuus]
 dbj|BAA05085.1| Ubiquitin [Glycine max]
 gb|AAD15340.1| putative polyubiquitin [Arabidopsis thaliana]
 emb|CAB77774.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAM65295.1| polyubiquitin (UBQ14) [Arabidopsis thaliana]
 emb|CAH59738.1| polyubiquitin [Plantago major]
 dbj|BAH19554.1| AT4G02890 [Arabidopsis thaliana]
 gb|EEE97590.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|EFH51088.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE82246.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82247.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82503.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AFP43341.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12802.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|ERP50742.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 gb|ERP55628.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP55629.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55630.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP61738.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|ESQ38067.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38068.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 dbj|BAO57270.1| ubiquitin 10 [Ipomoea nil]
 gb|KHN02680.1| Polyubiquitin [Glycine soja]
 gb|KHN15806.1| Polyubiquitin [Glycine soja]
 gb|KJB13594.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB69249.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 prf||2111434A tetraubiquitin
Length=305

 Score =   417 bits (1071),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   414 bits (1064),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   302 bits (773),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KDO51109.1| hypothetical protein CISIN_1g026973mg [Citrus sinensis]
Length=230

 Score =   414 bits (1064),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   302 bits (773),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006428779.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 ref|XP_006594132.1| PREDICTED: polyubiquitin-like [Glycine max]
 gb|ESR42019.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 gb|KDO45140.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KDO45141.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KHN48309.1| Polyubiquitin [Glycine soja]
Length=230

 Score =   414 bits (1064),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   302 bits (773),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAO43307.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   414 bits (1065),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  41   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  100

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  101  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  160

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  161  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  220

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  221  QLEDGRTLADYNIQKESTLHLVLRLRGG  248


 Score =   343 bits (880),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = -1

Query  610  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  431
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  430  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  251
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  250  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173


 Score = 46.2 bits (108),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -3

Query  809  FHLVXRXRGGMQIFVKTXTGKTITLR  732
             HLV R RGGMQIFVKT TGKTITL 
Sbjct  11   LHLVLRLRGGMQIFVKTLTGKTITLE  36


 Score = 25.0 bits (53),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -2

Query  840  AXYNIQKESTLPL  802
            A YNIQKESTL L
Sbjct  1    ADYNIQKESTLHL  13



>gb|KJB81823.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=305

 Score =   417 bits (1071),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   412 bits (1059),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (768),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KDO51955.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
 gb|KDO51956.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
Length=230

 Score =   414 bits (1063),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   302 bits (773),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_003627152.1| Ubiquitin [Medicago truncatula]
 gb|KEH18411.1| polyubiquitin 3 [Medicago truncatula]
Length=270

 Score =   415 bits (1067),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   331 bits (849),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 174/209 (83%), Gaps = 35/209 (17%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTIT                                  
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTIT----------------------------------  242

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
             LEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  243  -LEDGRTLADYNIQKESTLHLVLRLRGGF  270


 Score =   303 bits (775),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AFY06654.1| polyubiquitin, partial [Carica papaya]
Length=264

 Score =   415 bits (1066),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  56   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  115

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  116  VKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  175

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  176  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  235

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  236  QLEDGRTLADYNIQKESTLHLVLRLRGGF  264


 Score =   341 bits (874),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 173/177 (98%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -1

Query  622  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  443
            G TLADYNIQKESTL LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  12   GGTLADYNIQKESTLLLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  71

Query  442  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  263
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS
Sbjct  72   PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  131

Query  262  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  132  DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  188



>gb|AEZ49160.1| polyubiquitin, partial [Wolffia australiana]
Length=281

 Score =   416 bits (1068),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  41   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  100

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  101  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  160

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  161  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  220

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  221  QLEDGRTLADYNIQKESTLHLVLRLRGGM  249


 Score =   325 bits (833),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 164/165 (99%), Positives = 164/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  117  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  176

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  177  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  236

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  224
            STLHLVLRLRGGMQIFVKTLTGKTITLEV SSDTIDNVKAKIQDK
Sbjct  237  STLHLVLRLRGGMQIFVKTLTGKTITLEVASSDTIDNVKAKIQDK  281


 Score =   306 bits (784),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 154/158 (97%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = -1

Query  565  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  386
            RL+  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  16   RLQSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  75

Query  385  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  206
            LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD
Sbjct  76   LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  135

Query  205  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  136  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173



>emb|CBY46745.1| polyubiquitin 10 protein, partial [Lepidium appelianum]
Length=308

 Score =   417 bits (1071),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  100  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  159

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  160  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  219

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  220  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  279

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  280  QLEDGRTLADYNIQKESTLHLVLRLRGGF  308


 Score =   414 bits (1064),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  24   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  83

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  84   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  143

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  144  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  203

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  204  QLEDGRTLADYNIQKESTLHLVLRLRGGM  232


 Score =   308 bits (790),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = -1

Query  559  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  380
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  379  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  200
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  61   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  120

Query  199  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  156



>ref|XP_010235843.1| PREDICTED: polyubiquitin 11 isoform X1 [Brachypodium distachyon]
Length=265

 Score =   415 bits (1066),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 211/216 (98%), Gaps = 0/216 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  45   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  104

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  105  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  164

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  165  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  224

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF*IP*CPN  71
            QLEDGRTLADYNIQKESTLHLVLRLRGG  +  C N
Sbjct  225  QLEDGRTLADYNIQKESTLHLVLRLRGGALMQWCLN  260


 Score =   303 bits (777),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 154/159 (97%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -1

Query  568  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  389
            L  R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  19   LECRKMMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  78

Query  388  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  209
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  79   TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  138

Query  208  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  139  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  177



>gb|AGV54749.1| ubiquitin 11 [Phaseolus vulgaris]
Length=269

 Score =   415 bits (1067),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  61   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  120

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  121  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  180

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  181  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  240

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  241  QLEDGRTLADYNIQKESTLHLVLRLRGGF  269


 Score =   301 bits (770),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  41   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  100

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  101  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  160

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  161  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  193



>ref|XP_002872746.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002872769.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49005.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49028.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   414 bits (1063),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   302 bits (774),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAC35858.1| polyubiquitin [Capsicum chinense]
Length=265

 Score =   415 bits (1066),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  57   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  116

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  117  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  176

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGK
Sbjct  177  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGK  236

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  237  QLEDGRTLADYNIQKESTLHLVLRLRGGF  265


 Score =   373 bits (958),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 188/189 (99%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -1

Query  658  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  479
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  60

Query  478  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  299
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL
Sbjct  61   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  120

Query  298  TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  119
            TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH
Sbjct  121  TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  180

Query  118  LVLRLRGGF  92
            LVLRLRGG 
Sbjct  181  LVLRLRGGM  189


 Score = 46.2 bits (108),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  809  FHLVXRXRGGMQIFVKTXTGKTITL  735
             HLV R RGGMQIFVKT TGKTITL
Sbjct  27   LHLVLRLRGGMQIFVKTLTGKTITL  51


 Score = 30.0 bits (66),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  852  GXTLAXYNIQKESTLPL  802
            G TLA YNIQKESTL L
Sbjct  13   GRTLADYNIQKESTLHL  29



>ref|XP_003590494.1| Ubiquitin [Medicago truncatula]
Length=312

 Score =   416 bits (1070),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   304 bits (778),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AFK41706.1| unknown [Medicago truncatula]
 gb|AES60745.2| pentameric polyubiquitin [Medicago truncatula]
Length=233

 Score =   413 bits (1062),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJB62484.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=229

 Score =   413 bits (1062),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 207/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (771),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002438839.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
 gb|EER90206.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
Length=229

 Score =   413 bits (1061),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 207/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQK+STLHLVLRLRGG
Sbjct  201  QLEDGRTLADYNIQKDSTLHLVLRLRGG  228


 Score =   302 bits (774),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CBI22349.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   416 bits (1068),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  48   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  107

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  108  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  167

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  168  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  227

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  228  QLEDGRTLADYNIQKESTLHLVLRLRGGM  256


 Score =   332 bits (851),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 167/168 (99%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  124  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  183

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  184  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  243

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  215
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG+
Sbjct  244  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGM  291


 Score =   303 bits (775),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  28   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  87

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  88   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  147

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  148  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  180



>ref|XP_006377830.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55627.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
Length=297

 Score =   415 bits (1067),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   392 bits (1006),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 196/197 (99%), Positives = 197/197 (100%), Gaps = 0/197 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKES  128
            QLEDGRTLADYNIQKE+
Sbjct  277  QLEDGRTLADYNIQKEN  293


 Score =   303 bits (776),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AES89866.2| polyubiquitin 3 [Medicago truncatula]
Length=305

 Score =   416 bits (1068),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGY  305


 Score =   414 bits (1065),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   302 bits (774),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ABY60454.1| putative polyubiquitin [Adonis aestivalis var. palaestina]
Length=281

 Score =   415 bits (1066),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  32   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  91

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  92   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  151

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  152  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  211

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  212  QLEDGRTLADYNIQKESTLHLVLRLRGGM  240


 Score =   346 bits (888),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/174 (100%), Positives = 174/174 (100%), Gaps = 0/174 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  108  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  167

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  168  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  227

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  197
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  228  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  281


 Score =   324 bits (831),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 163/164 (99%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -1

Query  583  TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  404
            TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ
Sbjct  1    TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  60

Query  403  LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  224
            LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK
Sbjct  61   LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  120

Query  223  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  164



>ref|XP_007512209.1| polyubiquitin [Bathycoccus prasinos]
 emb|CCO66297.1| polyubiquitin [Bathycoccus prasinos]
Length=359

 Score =   417 bits (1073),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  148  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  207

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  208  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  267

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  268  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  327

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  328  QLEDGRTLADYNIQKESTLHLVLRLRGG  355


 Score =   394 bits (1012),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 209/262 (80%), Positives = 209/262 (80%), Gaps = 51/262 (19%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEG---------------------------------------------  674
            DTIDNVKAKIQDKEG                                             
Sbjct  21   DTIDNVKAKIQDKEGTFRVKSRRLKFCLLALLDSATTIESSLALRSKKSSERREREKESA  80

Query  673  ------IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI  512
                  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI
Sbjct  81   LSRARGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI  140

Query  511  TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  332
            TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL
Sbjct  141  TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  200

Query  331  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  152
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  201  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  260

Query  151  DYNIQKESTLHLVLRLRGGF*I  86
            DYNIQKESTLHLVLRLRGG  I
Sbjct  261  DYNIQKESTLHLVLRLRGGMQI  282


 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 153/206 (74%), Gaps = 51/206 (25%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE--------------------------  449
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE                          
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTFRVKSRRLKFCLLALLDSATTIES  60

Query  448  -------------------------GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  344
                                     GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   SLALRSKKSSERREREKESALSRARGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  343  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  164
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  121  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  180

Query  163  RTLADYNIQKESTLHLVLRLRGGF*I  86
            RTLADYNIQKESTLHLVLRLRGG  I
Sbjct  181  RTLADYNIQKESTLHLVLRLRGGMQI  206



>ref|XP_008784557.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like [Phoenix 
dactylifera]
Length=229

 Score =   412 bits (1060),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 207/208 (99%), Positives = 207/208 (99%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV RLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVXRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (769),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVXRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006428822.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
 ref|XP_006480632.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 ref|XP_006480634.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 gb|ESR42062.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
Length=230

 Score =   412 bits (1060),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 207/208 (99%), Positives = 207/208 (99%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGR LADYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRNLADYNIQKESTLHLVLRLRGG  228


 Score =   302 bits (774),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007154495.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26489.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=269

 Score =   414 bits (1063),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   343 bits (880),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 173/173 (100%), Gaps = 0/173 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  200
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  269


 Score =   303 bits (775),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007014924.1| Polyubiquitin 3 [Theobroma cacao]
 gb|EOY32543.1| Polyubiquitin 3 [Theobroma cacao]
Length=305

 Score =   415 bits (1067),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1066),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007211606.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12805.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
Length=309

 Score =   415 bits (1067),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   412 bits (1060),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 207/207 (100%), Positives = 207/207 (100%), Gaps = 0/207 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRG  98
            QLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRG  303


 Score =   303 bits (775),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010492041.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   415 bits (1067),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAG QLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGTQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   412 bits (1060),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG QLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGTQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (768),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAG QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGTQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|NP_851029.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_568112.2| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_001031824.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|XP_006288303.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
 ref|XP_009122723.1| PREDICTED: polyubiquitin 3 [Brassica rapa]
 sp|Q1EC66.1|UBQ3_ARATH RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB86091.1| polyubiquitin (ubq3) [Arabidopsis thaliana]
 dbj|BAB08384.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAO00780.1| polyubiquitin (UBQ3) [Arabidopsis thaliana]
 gb|ABF85770.1| At5g03240 [Arabidopsis thaliana]
 dbj|BAH19791.1| AT5G03240 [Arabidopsis thaliana]
 gb|AED90574.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90575.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90576.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|EOA21201.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
Length=306

 Score =   415 bits (1067),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1066),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CAA40323.1| polyubiquitin protein [Helianthus annuus]
Length=334

 Score =   416 bits (1069),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   416 bits (1069),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   322 bits (825),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 162/162 (100%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  233
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  334


 Score =   303 bits (777),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006396611.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 gb|AAL27563.1|AF429429_1 polyubiquitin OUB1 [Olea europaea]
 gb|ESQ38064.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=305

 Score =   415 bits (1066),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGL  305


 Score =   415 bits (1066),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   302 bits (774),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002456845.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 ref|XP_002453347.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 ref|XP_003574869.1| PREDICTED: polyubiquitin [Brachypodium distachyon]
 ref|XP_007695807.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_009412665.1| PREDICTED: polyubiquitin isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412666.1| PREDICTED: polyubiquitin isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_010227192.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 sp|P69309.2|UBIQP_AVEFA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Avena fatua]
 pir||S28426 polyubiquitin 4 - wild oat
 emb|CAA49200.1| tetraubiquitin [Avena fatua]
 gb|AAC37466.1| polyubiquitin [Saccharum hybrid cultivar H65-7052]
 gb|AAM28291.1| tetrameric ubiquitin [Ananas comosus]
 gb|EES01965.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 gb|EES06323.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 gb|AEE65379.1| ubiquitin 1 [Panicum virgatum]
 gb|EMD68114.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD93446.1| hypothetical protein COCHEDRAFT_1202381 [Bipolaris maydis C5]
 gb|EMS58836.1| Polyubiquitin [Triticum urartu]
 gb|ENI07106.1| hypothetical protein COCC4DRAFT_70576 [Bipolaris maydis ATCC 
48331]
 gb|AGT16802.1| polyubiquitin-like protein [Saccharum hybrid cultivar R570]
 gb|EUN28034.1| hypothetical protein COCVIDRAFT_96666 [Bipolaris victoriae FI3]
Length=305

 Score =   415 bits (1066),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1065),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006428821.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
 ref|XP_006480633.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
 gb|ESR42061.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
Length=306

 Score =   415 bits (1066),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1065),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006480631.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
Length=306

 Score =   415 bits (1066),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1065),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CAC94926.1| putative ubiquitin [Pleurotus sp. 'Florida']
Length=243

 Score =   412 bits (1060),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  2    DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  61

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  62   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  121

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  122  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  181

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  182  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  210


 Score =   317 bits (811),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  78   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  137

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  138  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  197

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  236
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA+
Sbjct  198  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAR  238


 Score =   266 bits (679),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/134 (98%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = -1

Query  493  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  314
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQI
Sbjct  1    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQI  60

Query  313  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  134
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  61   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  120

Query  133  ESTLHLVLRLRGGF  92
            ESTLHLVLRLRGG 
Sbjct  121  ESTLHLVLRLRGGM  134



>ref|XP_006302387.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35285.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=307

 Score =   415 bits (1066),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1065),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EYU33609.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
 gb|EYU33612.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=305

 Score =   415 bits (1066),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1065),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (774),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/133 (99%), Positives = 133/133 (100%), Gaps = 0/133 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGM  320
            STLHLVLRLRGG+
Sbjct  293  STLHLVLRLRGGV  305



>ref|XP_006654612.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
Length=305

 Score =   415 bits (1066),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   413 bits (1061),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 207/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QL+DGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLDDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AES89865.2| polyubiquitin 3 [Medicago truncatula]
Length=278

 Score =   414 bits (1063),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (772),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   294 bits (753),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLE  275
            STLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLE  244


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 33/61 (54%), Gaps = 1/61 (2%)
 Frame = -3

Query  902  PPXQQRIXXAXKXAXGXXVpspxttsrrspPFHLVXRXRGGMQIFVKTXTGKTITLRGGE  723
            PP QQR+  A K              ++    HLV R RGGMQIFVKT TGKTITL G  
Sbjct  189  PPDQQRLIFAGKQLEDGR-TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGNN  247

Query  722  L  720
            L
Sbjct  248  L  248



>gb|AFK43392.1| unknown [Medicago truncatula]
Length=233

 Score =   412 bits (1059),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 207/208 (99%), Positives = 207/208 (99%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (769),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAO42469.1| putative polyubiquitin [Arabidopsis lyrata]
Length=289

 Score =   414 bits (1064),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  12   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  71

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  72   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  131

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  132  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  191

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  192  QLEDGRTLADYNIQKESTLHLVLRLRGGM  220


 Score =   390 bits (1001),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 199/208 (96%), Positives = 200/208 (96%), Gaps = 8/208 (4%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  88   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  147

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  148  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  207

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESS+        IQDKEGIPPDQQRLIFAGK
Sbjct  208  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSE--------IQDKEGIPPDQQRLIFAGK  259

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  260  QLEDGRTLADYNIQKESTLHLVLRLRGG  287


 Score =   285 bits (728),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = -1

Query  523  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  344
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  343  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  164
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  163  RTLADYNIQKESTLHLVLRLRGGF  92
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGM  144



>sp|P69315.2|UBIQP_LINUS RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Contains: RecName: Full=Ubiquitin-related; Flags: Precursor, 
partial [Linum usitatissimum]
 gb|AAA33401.1| ubiquitin, partial [Linum usitatissimum]
Length=305

 Score =   415 bits (1066),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  62   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  121

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  122  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  181

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  182  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  241

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  242  QLEDGRTLADYNIQKESTLHLVLRLRGGM  270


 Score =   385 bits (988),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/194 (99%), Positives = 193/194 (99%), Gaps = 0/194 (0%)
 Frame = -1

Query  673  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  494
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFLKTLTGKTITLEVES  60

Query  493  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  314
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  313  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  134
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180

Query  133  ESTLHLVLRLRGGF  92
            ESTLHLVLRLRGG 
Sbjct  181  ESTLHLVLRLRGGM  194


 Score =   332 bits (852),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/168 (100%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  138  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  197

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  198  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  257

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  215
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  258  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  305



>dbj|BAJ85978.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   415 bits (1066),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   414 bits (1063),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002873083.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49342.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score =   415 bits (1066),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   413 bits (1062),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CAH59740.1| polyubiquitin [Plantago major]
Length=305

 Score =   414 bits (1065),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1065),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (774),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KDP39203.1| hypothetical protein JCGZ_00960 [Jatropha curcas]
Length=317

 Score =   415 bits (1067),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1067),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   272 bits (695),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 135/136 (99%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIF  311
            STLHLVLRLRGGMQI 
Sbjct  293  STLHLVLRLRGGMQIL  308



>ref|XP_008796945.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Phoenix dactylifera]
Length=309

 Score =   415 bits (1066),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   413 bits (1062),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009112898.1| PREDICTED: polyubiquitin [Brassica rapa]
Length=305

 Score =   414 bits (1065),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1065),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGI  305


 Score =   302 bits (774),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AFW66439.1| putative ubiquitin family protein [Zea mays]
Length=297

 Score =   414 bits (1064),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   393 bits (1010),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 200/209 (96%), Positives = 201/209 (96%), Gaps = 8/209 (4%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSD        IQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSD--------IQDKEGIPPDQQRLIFAGK  268

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  269  QLEDGRTLADYNIQKESTLHLVLRLRGGY  297


 Score =   302 bits (773),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007205620.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 ref|XP_007205621.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06819.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06820.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=306

 Score =   414 bits (1065),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1065),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAL09741.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
Length=381

 Score =   417 bits (1073),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   412 bits (1059),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   412 bits (1059),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL LRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLSLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   300 bits (768),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVL LRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLSLRGGM  153



>ref|XP_010452435.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   414 bits (1065),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQD+EGIPPDQQR IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDQEGIPPDQQRFIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   412 bits (1058),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 206/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR IFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (767),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR I
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CDP05795.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   417 bits (1072),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   413 bits (1061),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   413 bits (1061),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   300 bits (769),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CDP08569.1| unnamed protein product [Coffea canephora]
Length=306

 Score =   414 bits (1065),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGI  305


 Score =   413 bits (1062),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KDP38838.1| hypothetical protein JCGZ_04995 [Jatropha curcas]
Length=308

 Score =   414 bits (1065),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1064),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (774),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010258950.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
Length=306

 Score =   414 bits (1065),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1065),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGI  305


 Score =   302 bits (774),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>sp|P0CG84.1|UBI4P_NICSY RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor, partial [Nicotiana sylvestris]
 gb|AAA34124.1| pentameric polyubiquitin, partial [Nicotiana sylvestris]
Length=377

 Score =   417 bits (1072),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  169  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  228

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  229  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  288

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  289  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  348

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  349  QLEDGRTLADYNIQKESTLHLVLRLRGGF  377


 Score =   414 bits (1065),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  17   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  76

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  77   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  136

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  137  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  196

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  197  QLEDGRTLADYNIQKESTLHLVLRLRGGM  225


 Score =   414 bits (1065),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  93   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  152

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  153  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  212

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  213  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  272

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  273  QLEDGRTLADYNIQKESTLHLVLRLRGGM  301


 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = -1

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  1    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  60

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  61   STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  120

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  QLEDGRTLADYNIQKESTLHLVLRLRGGM  149



>ref|XP_006428925.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
 gb|ESR42165.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
Length=306

 Score =   414 bits (1065),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1064),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (774),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006428820.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
 gb|ESR42060.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
Length=306

 Score =   414 bits (1065),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   412 bits (1058),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (767),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_003537278.1| PREDICTED: polyubiquitin-like [Glycine max]
 ref|XP_010454744.1| PREDICTED: polyubiquitin 3 [Camelina sativa]
 gb|KHN39094.1| Polyubiquitin [Glycine soja]
Length=306

 Score =   414 bits (1065),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1064),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (774),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CAA54603.1| pentameric polyubiquitin [Nicotiana tabacum]
Length=346

 Score =   416 bits (1069),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   416 bits (1069),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   336 bits (862),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/169 (100%), Positives = 169/169 (100%), Gaps = 0/169 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  212
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ACD31680.1| ubiquitin [Gossypium hirsutum]
Length=305

 Score =   414 bits (1065),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL DYNIQKESTLHLVLRLRGGF
Sbjct  277  QLEDGRTLPDYNIQKESTLHLVLRLRGGF  305


 Score =   412 bits (1059),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (768),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJB14874.1| hypothetical protein B456_002G147600, partial [Gossypium raimondii]
Length=344

 Score =   416 bits (1068),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  62   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  121

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  122  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  181

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  182  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  241

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  242  QLEDGRTLADYNIQKESTLHLVLRLRGGM  270


 Score =   413 bits (1062),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 207/207 (100%), Positives = 207/207 (100%), Gaps = 0/207 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  138  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  197

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  198  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  257

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  258  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  317

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRG  98
            QLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  318  QLEDGRTLADYNIQKESTLHLVLRLRG  344


 Score =   357 bits (916),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 179/180 (99%), Positives = 179/180 (99%), Gaps = 0/180 (0%)
 Frame = -1

Query  631  LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  452
            LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK
Sbjct  15   LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  74

Query  451  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  272
            EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV
Sbjct  75   EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  134

Query  271  ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  135  ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  194


 Score = 46.2 bits (108),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -3

Query  809  FHLVXRXRGGMQIFVKTXTGKTITLR  732
             HLV R RGGMQIFVKT TGKTITL 
Sbjct  32   LHLVLRLRGGMQIFVKTLTGKTITLE  57


 Score = 30.0 bits (66),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  852  GXTLAXYNIQKESTLPL  802
            G TLA YNIQKESTL L
Sbjct  18   GRTLADYNIQKESTLHL  34



>gb|KJB13592.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
Length=385

 Score =   417 bits (1072),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   302 bits (774),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/135 (98%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  249  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  309  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  368

Query  358  STLHLVLRLRGGMQI  314
            STLHLVLRLRGG ++
Sbjct  369  STLHLVLRLRGGFRM  383



>ref|XP_009605659.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
Length=305

 Score =   414 bits (1064),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED RTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDERTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   412 bits (1058),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED RTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDERTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   299 bits (766),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLED RTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDERTLADYNIQKESTLHLVLRLRGGM  153



>ref|NP_849300.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_567291.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_001078353.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_004134747.1| PREDICTED: polyubiquitin-like isoform 1 [Cucumis sativus]
 ref|XP_004134748.1| PREDICTED: polyubiquitin-like isoform 2 [Cucumis sativus]
 ref|XP_004496773.1| PREDICTED: polyubiquitin-like [Cicer arietinum]
 ref|XP_006360087.1| PREDICTED: polyubiquitin-like isoform X2 [Solanum tuberosum]
 ref|XP_006287939.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 ref|XP_006370633.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370635.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370637.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006380307.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 ref|XP_006377834.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377835.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372946.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_006396616.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396617.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006452184.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 ref|XP_007021032.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021033.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021035.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007025987.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007143204.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 ref|XP_007211430.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 ref|XP_007211607.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008244360.1| PREDICTED: polyubiquitin isoform X2 [Prunus mume]
 ref|XP_009365167.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009358097.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009358098.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343085.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343086.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009611794.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
 ref|XP_009792849.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_009793738.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_010267760.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
 ref|XP_010423137.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010447068.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010455857.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010644407.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_011026350.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011030849.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011048300.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011460984.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_011460993.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 sp|P69322.2|UBIQP_PEA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Pisum sativum]
 emb|CAA34886.1| unnamed protein product [Pisum sativum]
 gb|AAD03344.1| ubiquitin [Pisum sativum]
 gb|AAK96602.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
 dbj|BAD26592.1| polyubiquitin [Populus nigra]
 gb|ABB73307.1| ubiquitin [Lotus japonicus]
 gb|ABK92512.1| unknown [Populus trichocarpa]
 gb|ABK93264.1| unknown [Populus trichocarpa]
 gb|ABK95903.1| unknown [Populus trichocarpa]
 gb|ABK96012.1| unknown [Populus trichocarpa]
 gb|ABK96127.1| unknown [Populus trichocarpa]
 gb|ACK56276.1| ubiquitin [Populus trichocarpa]
 gb|AEE82501.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82504.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82505.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|EMJ12629.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 gb|EMJ12806.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EOA20837.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 gb|EOY12557.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12558.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12560.1| Polyubiquitin 10 [Theobroma cacao]
 gb|EOY28609.1| Polyubiquitin 10 [Theobroma cacao]
 gb|ERP50743.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ERP55631.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55632.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP58104.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 gb|ERP67202.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67204.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67206.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESQ38069.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38070.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESR65424.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 gb|ESW15198.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 gb|KDO52961.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDP20793.1| hypothetical protein JCGZ_21264 [Jatropha curcas]
 gb|AET01628.2| polyubiquitin 3 [Medicago truncatula]
 gb|KEH30745.1| polyubiquitin 3 [Medicago truncatula]
 gb|KJB13593.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB62633.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
 prf||1603402A poly-ubiquitin
Length=381

 Score =   417 bits (1072),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   302 bits (774),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|NP_001147027.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|ACG25128.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
Length=311

 Score =   414 bits (1065),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  103  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  162

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  163  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  222

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  223  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  282

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  283  QLEDGRTLADYNIQKESTLHLVLRLRGG  310


 Score =   360 bits (923),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 189/217 (87%), Positives = 191/217 (88%), Gaps = 10/217 (5%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR--------  563
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L      + +  H            
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNLIFSPFARNA--HTARSPISDPRSP  78

Query  562  LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  383
             R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  79   RRSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  138

Query  382  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  203
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  139  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  198

Query  202  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  199  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  235


 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 135/161 (84%), Gaps = 10/161 (6%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L    
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNLIFSP  60

Query  370  IQKESTLHLVLR--------LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  215
              + +  H             R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  61   FARNA--HTARSPISDPRSPRRSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  118

Query  214  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  119  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  159



>gb|KJB81825.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
 gb|KJB81826.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=381

 Score =   417 bits (1071),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   412 bits (1060),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009763135.1| PREDICTED: polyubiquitin-like [Nicotiana sylvestris]
Length=381

 Score =   417 bits (1071),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   412 bits (1058),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 206/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (767),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_011468094.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
Length=306

 Score =   414 bits (1064),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   414 bits (1063),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (772),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010240921.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=381

 Score =   417 bits (1071),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   414 bits (1063),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN+QKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNVQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            +QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   VQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAB68045.1| polyubiquitin [Fragaria x ananassa]
Length=381

 Score =   417 bits (1071),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   412 bits (1059),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   412 bits (1059),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   300 bits (768),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CBY46746.1| polyubiquitin 10 protein, partial [Lepidium campestre]
Length=381

 Score =   417 bits (1071),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   414 bits (1063),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009358096.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
 ref|XP_009343084.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
Length=401

 Score =   417 bits (1073),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  193  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  252

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  253  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  312

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  313  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  372

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  373  QLEDGRTLADYNIQKESTLHLVLRLRGGF  401


 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  41   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  100

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  101  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  160

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  161  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  220

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  221  QLEDGRTLADYNIQKESTLHLVLRLRGGM  249


 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  117  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  176

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  177  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  236

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  237  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  296

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  297  QLEDGRTLADYNIQKESTLHLVLRLRGGM  325


 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  140

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173



>prf||1604470A poly-ubiquitin
Length=272

 Score =   413 bits (1061),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  64   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  123

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  124  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  183

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  184  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  243

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  244  QLEDGRTLADYNIQKESTLHLVLRLRGG  271


 Score =   387 bits (993),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 194/195 (99%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -1

Query  676  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  497
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE
Sbjct  2    GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  61

Query  496  SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  317
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ
Sbjct  62   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  121

Query  316  IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  137
            IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ
Sbjct  122  IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  181

Query  136  KESTLHLVLRLRGGF  92
            KESTLHLVLRLRGG 
Sbjct  182  KESTLHLVLRLRGGM  196



>gb|KIM78981.1| hypothetical protein PILCRDRAFT_10644 [Piloderma croceum F 1598]
Length=229

 Score =   411 bits (1056),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 205/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (769),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   263 bits (673),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 130/133 (98%), Positives = 133/133 (100%), Gaps = 0/133 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  216

Query  358  STLHLVLRLRGGM  320
            STLHLVLRLRGG+
Sbjct  217  STLHLVLRLRGGV  229



>gb|KIM78989.1| hypothetical protein PILCRDRAFT_573034 [Piloderma croceum F 1598]
Length=229

 Score =   411 bits (1056),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 205/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (768),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|AAB36545.1| ubiquitin-like protein [Phaseolus vulgaris]
Length=407

 Score =   418 bits (1074),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  199  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  258

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  259  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  318

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  319  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  378

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  379  QLEDGRTLADYNIQKESTLHLVLRLRGGF  407


 Score =   415 bits (1067),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  123  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  182

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  183  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  242

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  243  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  302

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  303  QLEDGRTLADYNIQKESTLHLVLRLRGGM  331


 Score =   360 bits (925),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 181/183 (99%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -1

Query  640  GKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  461
             KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
Sbjct  73   AKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  132

Query  460  QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  281
            QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT
Sbjct  133  QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  192

Query  280  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  101
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  193  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  252

Query  100  GGF  92
            GG 
Sbjct  253  GGM  255


 Score = 46.2 bits (108),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -3

Query  809  FHLVXRXRGGMQIFVKTXTGKTITLR  732
             HLV R RGGMQIFVKT TGKTITL 
Sbjct  93   LHLVLRLRGGMQIFVKTLTGKTITLE  118


 Score = 30.4 bits (67),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  852  GXTLAXYNIQKESTLPL  802
            G TLA YNIQKESTL L
Sbjct  79   GRTLADYNIQKESTLHL  95



>gb|AAK68824.1| Unknown protein [Arabidopsis thaliana]
Length=229

 Score =   411 bits (1056),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVK L GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   301 bits (772),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AEW46688.1| polyubiquitin, partial [Ulva linza]
Length=226

 Score =   410 bits (1055),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLR  101
            QLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLR  226


 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJA26171.1| hypothetical protein HYPSUDRAFT_354705 [Hypholoma sublateritium 
FD-334 SS-4]
Length=229

 Score =   411 bits (1056),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 205/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (768),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|KIR83632.1| polyubiquitin, partial [Cryptococcus gattii IND107]
Length=218

 Score =   410 bits (1055),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 205/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  10   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  69

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  70   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  129

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  130  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  189

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  190  QLEDGRTLSDYNIQKESTLHLVLRLRGG  217


 Score =   278 bits (712),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = -1

Query  517  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  338
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVL
Sbjct  1    TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  60

Query  337  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  158
            RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  61   RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  120

Query  157  LADYNIQKESTLHLVLRLRGGF  92
            L+DYNIQKESTLHLVLRLRGG 
Sbjct  121  LSDYNIQKESTLHLVLRLRGGM  142



>ref|XP_003574865.1| PREDICTED: polyubiquitin-like [Brachypodium distachyon]
Length=341

 Score =   415 bits (1067),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  57   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  116

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  117  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  176

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  177  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  236

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  237  QLEDGRTLADYNIQKESTLHLVLRLRGGM  265


 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  133  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  192

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  193  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  252

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  253  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  312

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  313  QLEDGRTLADYNIQKESTLHLVLRLRGG  340


 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  37   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  96

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  97   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  156

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  157  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  189



>ref|XP_011077812.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
 ref|XP_011077813.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
Length=334

 Score =   415 bits (1066),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  49   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  108

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  109  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  168

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  169  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  228

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  229  QLEDGRTLADYNIQKESTLHLVLRLRGGM  257


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  125  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  184

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  185  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  244

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  245  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  304

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  305  QLEDGRTLADYNIQKESTLHLVLRLRGG  332


 Score =   332 bits (850),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 167/168 (99%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -1

Query  595  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  416
            QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
Sbjct  14   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  73

Query  415  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  236
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK
Sbjct  74   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  133

Query  235  IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  134  IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  181



>gb|EJU04700.1| polyubiquitin UbiD/Ubi4 [Dacryopinax sp. DJM-731 SS1]
Length=229

 Score =   411 bits (1056),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 205/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (768),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_006685644.1| ubiquitin [Candida tenuis ATCC 10573]
 gb|EGV64838.1| ubiquitin [Candida tenuis ATCC 10573]
Length=229

 Score =   411 bits (1056),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 205/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (768),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010938693.1| PREDICTED: polyubiquitin [Elaeis guineensis]
Length=307

 Score =   414 bits (1063),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            +KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   IKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   412 bits (1059),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 207/208 (99%), Positives = 207/208 (99%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009631616.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=381

 Score =   416 bits (1070),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDN+KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNIKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   410 bits (1055),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 206/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGCTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDN+KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNIKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   409 bits (1052),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG TLADYNIQKE
Sbjct  81   VKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGCTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN+KAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNIKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (762),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDG TLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGCTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAB95250.1| ubiquitin [Arabidopsis thaliana]
Length=304

 Score =   413 bits (1062),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ+E
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQRE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   413 bits (1062),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQRESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQRESTLHLVLRLRGGM  153



>ref|XP_006593989.1| PREDICTED: polyubiquitin 10-like isoform X1 [Glycine max]
Length=381

 Score =   416 bits (1070),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_011110054.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
 gb|EPS41950.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
Length=229

 Score =   410 bits (1055),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 205/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (767),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|AAQ84316.1| fiber polyubiquitin [Gossypium barbadense]
Length=229

 Score =   410 bits (1055),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTL LVLRLRGGF
Sbjct  201  QLEDGRTLADYNIQKESTLPLVLRLRGGF  229


 Score =   300 bits (768),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJB62487.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   413 bits (1062),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   412 bits (1060),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 206/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (768),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007339454.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EJD52725.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|KIM81538.1| hypothetical protein PILCRDRAFT_821319 [Piloderma croceum F 1598]
Length=305

 Score =   413 bits (1062),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 206/209 (99%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  277  QLEDGRTLSDYNIQKESTLHLVLRLRGGF  305


 Score =   410 bits (1055),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (767),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_007154496.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
 gb|ESW26490.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
Length=305

 Score =   413 bits (1062),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGL  305


 Score =   413 bits (1062),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   302 bits (774),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006288300.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21198.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=306

 Score =   413 bits (1062),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   413 bits (1061),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 207/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KIK28767.1| hypothetical protein PISMIDRAFT_672939, partial [Pisolithus microcarpus 
441]
Length=247

 Score =   411 bits (1056),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  39   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  98

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  99   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  158

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  159  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  218

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  219  QLEDGRTLSDYNIQKESTLHLVLRLRGGL  247


 Score =   336 bits (862),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = -1

Query  604  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  425
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  60

Query  424  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  245
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  61   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  120

Query  244  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  171



>gb|AIY27743.1| polyubiquitin Ubi10, partial [Betula luminifera]
Length=330

 Score =   414 bits (1064),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 206/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  95   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  154

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            V+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  155  VRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  214

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  215  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  274

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  275  QLEDGRTLADYNIQKESTLHLVLRLRGGM  303


 Score =   409 bits (1051),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 203/207 (98%), Positives = 205/207 (99%), Gaps = 0/207 (0%)
 Frame = -1

Query  712  IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  533
            IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV RLRGGMQIFVK
Sbjct  21   IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVFRLRGGMQIFVK  80

Query  532  TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKEST  353
            TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKEST
Sbjct  81   TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKEST  140

Query  352  LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  173
            LHLVLRLRGGMQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQL
Sbjct  141  LHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQL  200

Query  172  EDGRTLADYNIQKESTLHLVLRLRGGF  92
            EDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  EDGRTLADYNIQKESTLHLVLRLRGGM  227


 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  171  DTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  230

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  231  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  290

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  239
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  291  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  330



>gb|KEH31155.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   416 bits (1069),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   414 bits (1065),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   413 bits (1062),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  305


 Score =   302 bits (774),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010227188.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=339

 Score =   414 bits (1064),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  55   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  114

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  115  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  174

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  175  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  234

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  235  QLEDGRTLADYNIQKESTLHLVLRLRGGM  263


 Score =   414 bits (1064),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  131  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  190

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  191  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  250

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  251  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  310

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  311  QLEDGRTLADYNIQKESTLHLVLRLRGG  338


 Score =   308 bits (790),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = -1

Query  559  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  380
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  32   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  91

Query  379  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  200
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  92   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  151

Query  199  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  152  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  187



>ref|NP_001148453.1| LOC100282068 [Zea mays]
 ref|XP_002299930.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_003607671.1| Ubiquitin [Medicago truncatula]
 gb|AAC49014.1| ubiquitin [Zea mays]
 gb|ACG31521.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|EEE84735.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ACR37911.1| unknown [Zea mays]
 gb|AES89868.1| polyubiquitin 3 [Medicago truncatula]
 gb|AFW66440.1| putative ubiquitin family protein isoform 1 [Zea mays]
 gb|AFW66441.1| putative ubiquitin family protein isoform 2 [Zea mays]
Length=381

 Score =   416 bits (1068),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGY  381


 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   302 bits (774),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_719867.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 ref|XP_719750.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 emb|CAA76783.1| polyubiquitin [Candida albicans]
 gb|EAL00878.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 gb|EAL01003.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 gb|EEQ44747.1| hypothetical protein CAWG_03035 [Candida albicans WO-1]
 emb|CCE42351.1| hypothetical protein CPAR2_809000 [Candida parapsilosis]
 gb|EMG49099.1| hypothetical protein G210_0209 [Candida maltosa Xu316]
 gb|KHC79264.1| polyubiquitin [Candida albicans SC5314]
Length=229

 Score =   410 bits (1053),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 203/209 (97%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGF  229


 Score =   297 bits (761),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|EGO00904.1| hypothetical protein SERLA73DRAFT_178893 [Serpula lacrymans var. 
lacrymans S7.3]
Length=312

 Score =   413 bits (1061),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   401 bits (1030),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 199/203 (98%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVL  110
            QLEDGRTL+DYNIQKESTLHLV 
Sbjct  277  QLEDGRTLSDYNIQKESTLHLVF  299


 Score =   301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_002872109.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48368.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=383

 Score =   416 bits (1068),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  98   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  157

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  158  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  217

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  218  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  277

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  278  QLEDGRTLADYNIQKESTLHLVLRLRGGM  306


 Score =   415 bits (1066),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 207/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  174  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  233

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  234  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  293

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG+PPDQQRLIFAGK
Sbjct  294  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGVPPDQQRLIFAGK  353

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  354  QLEDGRTLADYNIQKESTLHLVLRLRGG  381


 Score =   412 bits (1058),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  22   DTIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  81

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  82   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  141

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  142  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  201

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  202  QLEDGRTLADYNIQKESTLHLVLRLRGGM  230


 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  2    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYN  61

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  62   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  121

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  122  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  154


 Score = 46.6 bits (109),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -3

Query  809  FHLVXRXRGGMQIFVKTXTGKTITLR  732
             HLV R RGGMQIFVKT TGKTITL 
Sbjct  68   LHLVLRLRGGMQIFVKTLTGKTITLE  93


 Score = 30.0 bits (66),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  852  GXTLAXYNIQKESTLPL  802
            G TLA YNIQKESTL L
Sbjct  54   GRTLADYNIQKESTLHL  70



>gb|KDB11907.1| ubiquitin [Ustilaginoidea virens]
Length=305

 Score =   412 bits (1060),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 206/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   412 bits (1059),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 206/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KIL68862.1| hypothetical protein M378DRAFT_157997 [Amanita muscaria Koide 
BX008]
Length=305

 Score =   412 bits (1060),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 206/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLSDYNIQKESTLHLVLRLRGGL  305


 Score =   412 bits (1060),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 206/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010911599.1| PREDICTED: polyubiquitin 4 [Elaeis guineensis]
Length=384

 Score =   415 bits (1067),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1067),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   415 bits (1067),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ADP05114.1| polyubiquitin 10 [Aponogeton madagascariensis]
Length=221

 Score =   409 bits (1051),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 205/207 (99%), Positives = 206/207 (99%), Gaps = 0/207 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  15   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  74

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTG+T TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  75   VKTLTGETTTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  134

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  135  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  194

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRG  98
            QLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  195  QLEDGRTLADYNIQKESTLHLVLRLRG  221


 Score =   285 bits (730),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/146 (98%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -1

Query  529  LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  350
            LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL
Sbjct  2    LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  61

Query  349  HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  170
            HLVLRLRGGMQIFVKTLTG+T TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE
Sbjct  62   HLVLRLRGGMQIFVKTLTGETTTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  121

Query  169  DGRTLADYNIQKESTLHLVLRLRGGF  92
            DGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  122  DGRTLADYNIQKESTLHLVLRLRGGM  147



>emb|CDP08567.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   414 bits (1065),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 209/211 (99%), Positives = 209/211 (99%), Gaps = 0/211 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  74   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  133

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  134  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  193

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  194  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  253

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF*I  86
            QLEDGRTLADYNIQKESTLHLVLRLRGG  I
Sbjct  254  QLEDGRTLADYNIQKESTLHLVLRLRGGMQI  284


 Score =   385 bits (990),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 196/209 (94%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  150  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  209

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  210  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  269

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  270  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  329

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNI   +   L  + R  F
Sbjct  330  QLEDGRTLADYNITPLTMSRLRSKTRRAF  358


 Score =   302 bits (773),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  54   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  113

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  114  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  173

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  174  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  206



>ref|XP_002992988.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
 ref|XP_002994514.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ04422.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ05934.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
Length=229

 Score =   409 bits (1052),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002508175.1| ubiquitin [Micromonas sp. RCC299]
 ref|XP_003061956.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|EEH53668.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|ACO69433.1| ubiquitin [Micromonas sp. RCC299]
 gb|KEH20642.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   415 bits (1067),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1067),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   415 bits (1066),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CCL99875.1| predicted protein [Fibroporia radiculosa]
Length=312

 Score =   412 bits (1060),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  104  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  163

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  164  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  223

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  224  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  283

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  284  QLEDGRTLSDYNIQKESTLHLVLRLRGGL  312


 Score =   412 bits (1060),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  28   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  87

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  88   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  147

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  148  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  207

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  208  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  236


 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  8    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  67

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  68   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  127

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  128  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  160



>gb|KJB62485.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   412 bits (1059),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 206/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   411 bits (1057),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (768),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CEF99839.1| Ubiquitin conserved site [Ostreococcus tauri]
Length=339

 Score =   413 bits (1062),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  55   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  114

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  115  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  174

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  175  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  234

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  235  QLEDGRTLADYNIQKESTLHLVLRLRGGM  263


 Score =   413 bits (1062),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  131  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  190

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  191  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  250

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  251  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  310

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  311  QLEDGRTLADYNIQKESTLHLVLRLRGG  338


 Score =   301 bits (772),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  94

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  95   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  154

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  155  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  187



>ref|XP_006396612.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 ref|XP_010537979.1| PREDICTED: polyubiquitin [Tarenaya hassleriana]
 emb|CAJ86369.1| OSIGBa0117N13.13 [Oryza sativa Indica Group]
 emb|CAJ86419.1| H0303G06.8 [Oryza sativa Indica Group]
 gb|EAY95663.1| hypothetical protein OsI_17529 [Oryza sativa Indica Group]
 gb|ESQ38065.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=381

 Score =   415 bits (1067),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGL  381


 Score =   415 bits (1066),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1066),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010240636.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
 ref|XP_010240784.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=383

 Score =   415 bits (1067),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  23   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  82

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  83   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  142

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  143  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  202

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  203  QLEDGRTLADYNIQKESTLHLVLRLRGGM  231


 Score =   415 bits (1067),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  99   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  158

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  159  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  218

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  219  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  278

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  279  QLEDGRTLADYNIQKESTLHLVLRLRGGM  307


 Score =   415 bits (1066),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  175  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  234

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  235  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  294

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  295  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  354

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  355  QLEDGRTLADYNIQKESTLHLVLRLRGG  382


 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  3    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  62

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  63   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  122

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  123  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  155



>ref|XP_009108753.1| PREDICTED: polyubiquitin 11-like [Brassica rapa]
Length=229

 Score =   409 bits (1051),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE+ LHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKETNLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKNLTGKTITLEVESSDTIDNVKAKIQDKEDIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKE+ LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKETNLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002874006.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50265.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   415 bits (1067),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1067),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   415 bits (1066),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|NP_001174480.1| Os05g0504766 [Oryza sativa Japonica Group]
 ref|XP_002438904.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 ref|XP_006656385.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
 ref|XP_007027294.1| Ubiquitin 4 [Theobroma cacao]
 ref|XP_010240640.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 ref|XP_010240789.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 gb|AAD30173.1|AF148448_1 polyubiquitin [Sporobolus stapfianus]
 gb|AAW56906.1| polyubiquitin [Oryza sativa Japonica Group]
 gb|EAY98614.1| hypothetical protein OsI_20535 [Oryza sativa Indica Group]
 gb|EEE64284.1| hypothetical protein OsJ_19121 [Oryza sativa Japonica Group]
 gb|EER90271.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 dbj|BAH93208.1| Os05g0504766 [Oryza sativa Japonica Group]
 dbj|BAJ91806.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04112.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFH53939.1| polyubiquitin 4 [Brachypodium distachyon]
 gb|AFH53940.1| polyubiquitin 10 [Brachypodium distachyon]
 gb|EOY07796.1| Ubiquitin 4 [Theobroma cacao]
 gb|AGT16803.1| polyubiquitin [Saccharum hybrid cultivar R570]
Length=381

 Score =   415 bits (1066),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1066),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   415 bits (1066),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007154493.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
 gb|ESW26487.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
Length=429

 Score =   417 bits (1071),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  221  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  280

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  281  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  340

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  341  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  400

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  401  QLEDGRTLADYNIQKESTLHLVLRLRGGF  429


 Score =   414 bits (1064),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  69   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  128

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  129  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  188

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  189  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  248

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  249  QLEDGRTLADYNIQKESTLHLVLRLRGGM  277


 Score =   414 bits (1064),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  145  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  204

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  205  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  264

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  265  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  324

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  325  QLEDGRTLADYNIQKESTLHLVLRLRGGM  353


 Score =   302 bits (773),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  49   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  108

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  109  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  168

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  169  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  201



>gb|EYU18102.1| hypothetical protein MIMGU_mgv1a008166mg [Erythranthe guttata]
Length=383

 Score =   415 bits (1067),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   415 bits (1066),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   413 bits (1062),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 206/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DT+DNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTVDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDT+DNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006428816.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
 gb|ESR42056.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
Length=382

 Score =   415 bits (1066),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1066),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   415 bits (1066),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|NP_568397.1| ubiquitin 4 [Arabidopsis thaliana]
 ref|XP_002881273.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010420904.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 ref|XP_010493166.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 sp|P0CH32.1|UBQ4_ARATH RecName: Full=Polyubiquitin 4; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA31331.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAB53929.1| polyubiquitin [Arabidopsis thaliana]
 gb|EFH57532.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED92867.1| ubiquitin 4 [Arabidopsis thaliana]
 prf||1515347A poly-ubiquitin
Length=382

 Score =   415 bits (1066),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1066),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   415 bits (1066),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010558157.1| PREDICTED: polyubiquitin-like [Tarenaya hassleriana]
Length=382

 Score =   415 bits (1066),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1066),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   415 bits (1066),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ABU40645.1| polyubiquitin [Triticum aestivum]
Length=380

 Score =   415 bits (1066),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1066),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   414 bits (1065),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010062974.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
Length=425

 Score =   416 bits (1070),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  217  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  276

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  277  VKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  336

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  337  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  396

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  397  QLEDGRTLADYNIQKESTLHLVLRLRGGF  425


 Score =   414 bits (1063),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  65   DTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  124

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  125  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  184

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  185  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  244

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  245  QLEDGRTLADYNIQKESTLHLVLRLRGGM  273


 Score =   414 bits (1063),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  141  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  200

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  201  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  260

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  261  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGK  320

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  321  QLEDGRTLADYNIQKESTLHLVLRLRGGM  349


 Score =   303 bits (777),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 162/174 (93%), Gaps = 6/174 (3%)
 Frame = -1

Query  613  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  434
            L+ +++ K S+L      R  MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPD
Sbjct  30   LSPFDLSKFSSL------RVKMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPD  83

Query  433  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI  254
            QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI
Sbjct  84   QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI  143

Query  253  DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  144  DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  197



>gb|AAY86773.1| polyubiquitin [Noccaea caerulescens]
Length=382

 Score =   415 bits (1066),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1066),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   414 bits (1065),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006381473.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP59270.1| polyubiquitin family protein [Populus trichocarpa]
Length=306

 Score =   412 bits (1059),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 207/208 (99%), Positives = 207/208 (99%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   410 bits (1055),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 206/209 (99%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   299 bits (765),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVE+SDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVENSDTIDNVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002266370.1| PREDICTED: polyubiquitin 4-like [Vitis vinifera]
Length=383

 Score =   415 bits (1066),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1066),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   415 bits (1066),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006302388.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35286.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=383

 Score =   415 bits (1066),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1066),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   415 bits (1066),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|NP_001105376.1| polyubiquitin [Zea mays]
 gb|AAC49025.1| polyubiquitin [Zea mays]
Length=381

 Score =   415 bits (1066),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1063),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLV+RLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVVRLRGGM  305


 Score =   413 bits (1062),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 207/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLV+RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVVRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010696408.1| PREDICTED: polyubiquitin 4 [Beta vulgaris subsp. vulgaris]
Length=382

 Score =   415 bits (1066),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1066),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   413 bits (1061),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 207/208 (99%), Positives = 207/208 (99%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_001783045.1| predicted protein [Physcomitrella patens]
 gb|EDQ52114.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   409 bits (1051),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 205/208 (99%), Positives = 205/208 (99%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EYU33608.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=381

 Score =   415 bits (1066),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1066),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   414 bits (1065),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/133 (99%), Positives = 133/133 (100%), Gaps = 0/133 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  249  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  309  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  368

Query  358  STLHLVLRLRGGM  320
            STLHLVLRLRGG+
Sbjct  369  STLHLVLRLRGGV  381



>emb|CDR41572.1| RHTO0S06e03070g1_1 [Rhodosporidium toruloides]
Length=230

 Score =   409 bits (1051),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 204/208 (98%), Positives = 207/208 (99%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN+QKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNVQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLQDYNIQKESTLHLVLRLRGG  228


 Score =   299 bits (766),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYN+QKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGM  153



>ref|XP_010324327.1| PREDICTED: polyubiquitin isoform X2 [Solanum lycopersicum]
Length=381

 Score =   415 bits (1066),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPSDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   412 bits (1059),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   412 bits (1059),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 46.2 bits (108),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -3

Query  809  FHLVXRXRGGMQIFVKTXTGKTITLR  732
             HLV R RGGMQIFVKT TGKTITL 
Sbjct  219  LHLVLRLRGGMQIFVKTLTGKTITLE  244


 Score = 30.0 bits (66),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  852  GXTLAXYNIQKESTLPL  802
            G TLA YNIQKESTL L
Sbjct  205  GRTLADYNIQKESTLHL  221



>ref|XP_001420612.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98905.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|KHN17791.1| Polyubiquitin 4 [Glycine soja]
Length=381

 Score =   415 bits (1066),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1066),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   302 bits (774),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009596689.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=382

 Score =   415 bits (1066),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1066),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010454368.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   415 bits (1066),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010270791.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=382

 Score =   415 bits (1066),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1064),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   414 bits (1064),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGI  381


 Score =   302 bits (774),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ADD52202.1| ubiquitin [Catharanthus roseus]
 gb|AEK98798.1| ubiquitin [Carthamus tinctorius]
Length=381

 Score =   415 bits (1066),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI AGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLILAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   409 bits (1051),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 206/209 (99%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DT DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD NIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTTDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADCNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   407 bits (1046),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAK QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKTQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD NIQKE
Sbjct  81   VKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADCNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   295 bits (754),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAK QDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKTQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLAD NIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADCNIQKESTLHLVLRLRGGM  153



>gb|KIK92093.1| hypothetical protein PAXRUDRAFT_830299, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=229

 Score =   409 bits (1050),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 205/208 (99%), Positives = 207/208 (99%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   298 bits (764),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|AAQ07453.1| ubiquitin [Musa acuminata AAA Group]
Length=381

 Score =   415 bits (1066),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   413 bits (1061),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITL+VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   412 bits (1060),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 207/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITL+VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   302 bits (774),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>sp|Q58G87.2|UBQ3_ORYSJ RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin-related; 
Contains: RecName: Full=Ubiquitin; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE04243.3| OSJNBa0089N06.4 [Oryza sativa Japonica Group]
 gb|EAZ32071.1| hypothetical protein OsJ_16259 [Oryza sativa Japonica Group]
Length=381

 Score =   415 bits (1066),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGL  381


 Score =   414 bits (1065),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1065),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   300 bits (768),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006372519.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP50316.1| polyubiquitin family protein [Populus trichocarpa]
Length=305

 Score =   412 bits (1058),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 206/209 (99%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   409 bits (1051),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAX40652.1| polyubiquitin [Oryza sativa Japonica Group]
Length=381

 Score =   414 bits (1065),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1064),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL+FAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLVFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGL  381


 Score =   414 bits (1064),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL+FAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLVFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   300 bits (768),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_001830230.1| ubiquitin [Coprinopsis cinerea okayama7#130]
 gb|EAU91601.1| ubiquitin [Coprinopsis cinerea okayama7#130]
Length=305

 Score =   412 bits (1058),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  277  QLEDGRTLSDYNIQKESTLHLVLRLRGGF  305


 Score =   409 bits (1051),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 204/209 (98%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (763),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|ACS68205.1| ubiquitin 10.2 [Brassica napus]
Length=381

 Score =   414 bits (1065),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1065),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGI  381


 Score =   302 bits (774),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EMS65864.1| Polyubiquitin [Triticum urartu]
Length=405

 Score =   415 bits (1067),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1067),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   415 bits (1067),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_003542730.1| PREDICTED: polyubiquitin 10-like [Glycine max]
 gb|KHN09976.1| Polyubiquitin 10 [Glycine soja]
Length=457

 Score =   417 bits (1072),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  249  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  309  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  368

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  369  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  428

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  429  QLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   414 bits (1065),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   414 bits (1065),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   413 bits (1062),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|NP_849299.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_849301.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002872749.1| hexameric polyubiquitin [Arabidopsis lyrata subsp. lyrata]
 ref|XP_004145098.1| PREDICTED: polyubiquitin 10-like [Cucumis sativus]
 ref|XP_004153450.1| PREDICTED: polyubiquitin 10-like [Cucumis sativus]
 ref|XP_004248312.1| PREDICTED: polyubiquitin [Solanum lycopersicum]
 ref|XP_006360086.1| PREDICTED: polyubiquitin-like isoform X1 [Solanum tuberosum]
 ref|XP_006289516.1| hypothetical protein CARUB_v10003053mg [Capsella rubella]
 ref|XP_006393349.1| hypothetical protein EUTSA_v10011466mg [Eutrema salsugineum]
 ref|XP_006452179.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 ref|XP_006452180.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 ref|XP_006452185.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 ref|XP_006452187.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 ref|XP_006475213.1| PREDICTED: polyubiquitin 10-like [Citrus sinensis]
 ref|XP_007154502.1| hypothetical protein PHAVU_003G123900g [Phaseolus vulgaris]
 ref|XP_007211602.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008371127.1| PREDICTED: polyubiquitin [Malus domestica]
 ref|XP_009357406.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009340939.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009594377.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
 ref|XP_009792248.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_010023555.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
 ref|XP_010538672.1| PREDICTED: polyubiquitin [Tarenaya hassleriana]
 ref|XP_010694241.1| PREDICTED: polyubiquitin [Beta vulgaris subsp. vulgaris]
 ref|XP_010644404.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_010644405.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_010644406.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_011097919.1| PREDICTED: polyubiquitin [Sesamum indicum]
 sp|P0CG85.1|UBI1P_NICSY RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Nicotiana sylvestris]
 sp|Q8H159.2|UBQ10_ARATH RecName: Full=Polyubiquitin 10; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAA34123.1| hexameric polyubiquitin [Nicotiana sylvestris]
 gb|AAA68878.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAD03341.1| ubiquitin [Pisum sativum]
 gb|AAD03342.1| ubiquitin [Pisum sativum]
 gb|AAM98141.1| polyubiquitin UBQ10 [Arabidopsis thaliana]
 gb|ABK92469.1| unknown [Populus trichocarpa]
 emb|CAN64480.1| hypothetical protein VITISV_002813 [Vitis vinifera]
 gb|ACS68204.1| ubiquitin 10.1 [Brassica napus]
 gb|EFH49008.1| hexameric polyubiquitin [Arabidopsis lyrata subsp. lyrata]
 dbj|BAJ34175.1| unnamed protein product [Thellungiella halophila]
 gb|AEE82500.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82502.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|EMJ12801.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EOA22414.1| hypothetical protein CARUB_v10003053mg [Capsella rubella]
 emb|CCQ25958.1| polyubiquitin 10 [Coffea arabica]
 gb|ESQ30635.1| hypothetical protein EUTSA_v10011466mg [Eutrema salsugineum]
 gb|ESR65419.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 gb|ESR65420.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 gb|ESR65425.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 gb|ESR65427.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 gb|ESW26496.1| hypothetical protein PHAVU_003G123900g [Phaseolus vulgaris]
 gb|EYU19215.1| hypothetical protein MIMGU_mgv1a004313mg [Erythranthe guttata]
 gb|KDO52958.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDO52959.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDO52960.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KEH18409.1| polyubiquitin 3 [Medicago truncatula]
 gb|KEH18410.1| polyubiquitin 3 [Medicago truncatula]
 gb|KGN49132.1| hypothetical protein Csa_6G514925 [Cucumis sativus]
 gb|KHN15480.1| Polyubiquitin 10 [Glycine soja]
 gb|AJA36490.1| ubiquitin [Prunus persica]
 gb|KJB62627.1| hypothetical protein B456_009G426900 [Gossypium raimondii]
 gb|KJB62631.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
 gb|KJB62632.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
Length=457

 Score =   417 bits (1072),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  249  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  309  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  368

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  369  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  428

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  429  QLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   414 bits (1065),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1065),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   414 bits (1065),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   302 bits (774),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AHC00631.1| polyubiquitin [Ganoderma lucidum]
Length=319

 Score =   412 bits (1059),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  111  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  170

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  171  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  230

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  231  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  290

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  291  QLEDGRTLSDYNIQKESTLHLVLRLRGGL  319


 Score =   412 bits (1059),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  35   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  94

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  95   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  154

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  155  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  214

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  215  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  243


 Score =   301 bits (770),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 151/157 (96%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  562  LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  383
            L   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  11   LAYSMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  70

Query  382  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  203
            +DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  71   SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  130

Query  202  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  131  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  167



>gb|KJB13590.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
 gb|KJB13591.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
Length=461

 Score =   417 bits (1073),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  249  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  309  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  368

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  369  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  428

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  429  QLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   415 bits (1066),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1066),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   415 bits (1066),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   302 bits (774),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   266 bits (680),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 132/135 (98%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  325  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  384

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  385  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  444

Query  358  STLHLVLRLRGGMQI  314
            STLHLVLRLRGG ++
Sbjct  445  STLHLVLRLRGGFRM  459



>gb|AGV54228.1| polyubiquitin-like protein [Phaseolus vulgaris]
Length=381

 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGL  381


 Score =   409 bits (1050),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 206/209 (99%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLV  LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   409 bits (1050),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 206/209 (99%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  LRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVSWLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   296 bits (759),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLV  LRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVSWLRGGM  153



>ref|XP_009591312.1| PREDICTED: polyubiquitin 4 [Nicotiana tomentosiformis]
 ref|XP_011468093.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 4-like [Fragaria 
vesca subsp. vesca]
Length=382

 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   414 bits (1064),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   302 bits (774),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010431529.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Camelina 
sativa]
Length=457

 Score =   417 bits (1072),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  249  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  309  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  368

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  369  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  428

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  429  QLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   414 bits (1065),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   412 bits (1060),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFV TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVXTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   412 bits (1060),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            V TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VXTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   302 bits (774),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006287868.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
 gb|EOA20766.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
Length=407

 Score =   415 bits (1067),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  46   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  105

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  106  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  165

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  166  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  225

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  226  QLEDGRTLADYNIQKESTLHLVLRLRGGM  254


 Score =   415 bits (1067),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  122  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  181

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  182  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  241

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  242  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  301

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  302  QLEDGRTLADYNIQKESTLHLVLRLRGGM  330


 Score =   415 bits (1067),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  198  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  257

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  258  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  317

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  318  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  377

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  378  QLEDGRTLADYNIQKESTLHLVLRLRGG  405


 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  85

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  86   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  145

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  146  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  178



>gb|KJB81827.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=457

 Score =   417 bits (1072),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  249  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  309  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  368

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  369  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  428

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  429  QLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   414 bits (1065),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   414 bits (1065),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   412 bits (1060),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009784905.1| PREDICTED: polyubiquitin-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009784906.1| PREDICTED: polyubiquitin-like isoform X1 [Nicotiana sylvestris]
Length=457

 Score =   417 bits (1072),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  249  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  309  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  368

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  369  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  428

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  429  QLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   412 bits (1060),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   412 bits (1060),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   412 bits (1060),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   302 bits (774),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJB81824.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=393

 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   413 bits (1061),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 197/199 (99%), Positives = 198/199 (99%), Gaps = 0/199 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTL  122
            QLEDGRTLADYNIQKE+ L
Sbjct  353  QLEDGRTLADYNIQKENPL  371


 Score =   301 bits (770),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010493589.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=430

 Score =   416 bits (1069),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  220  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  279

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  280  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  339

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  340  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  399

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  400  QLEDGRTLADYNIQKESTLHLVLRLRGG  427


 Score =   414 bits (1064),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  68   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  127

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG TLADYNIQKE
Sbjct  128  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGHTLADYNIQKE  187

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  188  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  247

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  248  QLEDGRTLADYNIQKESTLHLVLRLRGGM  276


 Score =   414 bits (1064),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  144  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGHTLADYNIQKESTLHLVLRLRGGMQIF  203

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  204  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  263

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  264  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  323

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  324  QLEDGRTLADYNIQKESTLHLVLRLRGGM  352


 Score =   301 bits (771),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  48   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  107

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  108  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  167

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDG TLADYNIQKESTLHLVLRLRGG 
Sbjct  168  FAGKQLEDGHTLADYNIQKESTLHLVLRLRGGM  200



>ref|XP_010421267.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   413 bits (1062),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKE+TLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKETTLHLVLRLRGGM  305


 Score =   413 bits (1061),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 207/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            +TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  TTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_001555417.1| polyubiquitin [Botrytis cinerea B05.10]
 ref|XP_001906054.1| hypothetical protein [Podospora anserina S mat+]
 ref|XP_007336907.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 ref|XP_007390409.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 ref|XP_011121602.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 gb|AAC15225.1| polyubiquitin [Botrytis cinerea]
 emb|CAP66720.1| unnamed protein product [Podospora anserina S mat+]
 gb|EGX49548.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 emb|CCD51422.1| similar to polyubiquitin protein [Botrytis cinerea T4]
 gb|EJD55630.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EKM60970.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EMR84820.1| putative polyubiquitin protein [Botrytis cinerea BcDW1]
 emb|CDP28455.1| Putative Ubiquitin [Podospora anserina S mat+]
 gb|KIP12035.1| hypothetical protein PHLGIDRAFT_17814 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=305

 Score =   411 bits (1057),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   411 bits (1056),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   300 bits (768),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_008020911.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
 gb|EOA91885.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
Length=305

 Score =   411 bits (1057),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   411 bits (1056),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   300 bits (768),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EWZ40370.1| ubiquitin C [Fusarium oxysporum Fo47]
Length=229

 Score =   408 bits (1049),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 203/208 (98%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KIR29996.1| polyubiquitin [Cryptococcus gattii LA55]
 gb|KIR37417.1| polyubiquitin [Cryptococcus gattii MMRL2647]
 gb|KIR43885.1| polyubiquitin [Cryptococcus gattii Ram5]
 gb|KIR92886.1| polyubiquitin [Cryptococcus gattii CBS 10090]
 gb|KIY60273.1| polyubiquitin [Cryptococcus gattii 99/473]
Length=315

 Score =   412 bits (1058),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  305


 Score =   410 bits (1055),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 204/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   277 bits (709),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 137/139 (99%), Positives = 139/139 (100%), Gaps = 0/139 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKT  302
            STLHLVLRLRGGMQIFVKT
Sbjct  293  STLHLVLRLRGGMQIFVKT  311



>ref|XP_003030030.1| polyubiquitin [Schizophyllum commune H4-8]
 ref|XP_006678580.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 ref|XP_007396817.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|AAB94630.1| polyubiquitin [Schizophyllum commune]
 gb|EFI95127.1| polyubiquitin [Schizophyllum commune H4-8]
 gb|EGF80702.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 gb|EKM54116.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EPT04446.1| hypothetical protein FOMPIDRAFT_1021745 [Fomitopsis pinicola 
FP-58527 SS1]
 gb|KDQ24213.1| hypothetical protein PLEOSDRAFT_1058300 [Pleurotus ostreatus 
PC15]
 gb|KDQ28506.1| hypothetical protein PLEOSDRAFT_1089714 [Pleurotus ostreatus 
PC15]
 gb|KDQ53556.1| hypothetical protein JAAARDRAFT_72512 [Jaapia argillacea MUCL 
33604]
 gb|KIK09182.1| hypothetical protein K443DRAFT_671672 [Laccaria amethystina LaAM-08-1]
 gb|KIK44225.1| hypothetical protein CY34DRAFT_648259 [Suillus luteus UH-Slu-Lm8-n1]
 gb|KIM51102.1| hypothetical protein SCLCIDRAFT_144015 [Scleroderma citrinum 
Foug A]
 gb|KIN98337.1| hypothetical protein M404DRAFT_856969 [Pisolithus tinctorius 
Marx 270]
 gb|KIN98894.1| hypothetical protein M404DRAFT_966612 [Pisolithus tinctorius 
Marx 270]
Length=305

 Score =   411 bits (1057),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLSDYNIQKESTLHLVLRLRGGL  305


 Score =   411 bits (1057),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (768),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_001598085.1| polyubiquitin [Sclerotinia sclerotiorum 1980]
 gb|EDN90771.1| polyubiquitin [Sclerotinia sclerotiorum 1980 UF-70]
Length=305

 Score =   411 bits (1057),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   410 bits (1053),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 205/208 (99%), Positives = 207/208 (99%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLLDYNIQKESTLHLVLRLRGG  304


 Score =   300 bits (768),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_001764949.1| predicted protein [Physcomitrella patens]
 gb|EDQ70165.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   412 bits (1058),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 206/209 (99%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   410 bits (1053),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   273 bits (698),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTIT  281
            STLHLVLRLRGGM+I   TL  K IT
Sbjct  293  STLHLVLRLRGGMEIIEDTLASKIIT  318



>ref|NP_001053957.1| Os04g0628100 [Oryza sativa Japonica Group]
 dbj|BAF15871.1| Os04g0628100 [Oryza sativa Japonica Group]
Length=392

 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  184  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  243

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  244  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  303

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  304  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  363

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  364  QLEDGRTLADYNIQKESTLHLVLRLRGGL  392


 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  32   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  91

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  92   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  151

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  152  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  211

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  212  QLEDGRTLADYNIQKESTLHLVLRLRGGM  240


 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  108  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  167

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  168  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  227

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  228  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  287

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  288  QLEDGRTLADYNIQKESTLHLVLRLRGGM  316


 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  12   MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  71

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  72   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  131

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  132  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  164



>dbj|BAL61087.1| polyubiquitin [Dianthus caryophyllus]
Length=229

 Score =   408 bits (1049),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/208 (99%), Positives = 205/208 (99%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   298 bits (764),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KIY45417.1| ubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   411 bits (1057),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   411 bits (1056),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   300 bits (768),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_008441422.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Cucumis melo]
Length=457

 Score =   417 bits (1071),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  249  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  309  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  368

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  369  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  428

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  429  QLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   414 bits (1065),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   413 bits (1061),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIF KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFCKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   413 bits (1061),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
             KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  CKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   302 bits (773),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KIJ45725.1| hypothetical protein M422DRAFT_106821, partial [Sphaerobolus 
stellatus SS14]
Length=305

 Score =   411 bits (1057),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   411 bits (1057),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  305


 Score =   300 bits (768),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_001828882.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 ref|XP_001873268.1| ubiquitin [Laccaria bicolor S238N-H82]
 ref|XP_003037536.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 ref|XP_006454479.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 ref|XP_007316692.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 ref|XP_007325267.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 ref|XP_007378433.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 ref|XP_007842308.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 ref|XP_007879465.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|EAU92889.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 gb|EDR15060.1| ubiquitin [Laccaria bicolor S238N-H82]
 gb|EFJ02634.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 gb|EGO26519.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EIN13516.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 gb|EKM83733.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKV51498.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 dbj|GAC72194.1| ubiquitin and ubiquitin-like proteins [Pseudozyma antarctica 
T-34]
 dbj|GAC93128.1| ubiquitin [Pseudozyma hubeiensis SY62]
 gb|EPQ28867.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|ESK98373.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 gb|AHA61591.1| ubiquitin [Volvariella volvacea]
 gb|KIK04252.1| hypothetical protein K443DRAFT_4723 [Laccaria amethystina LaAM-08-1]
 gb|KIO31281.1| hypothetical protein M407DRAFT_241831 [Tulasnella calospora MUT 
4182]
Length=305

 Score =   411 bits (1057),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   411 bits (1056),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   300 bits (768),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>emb|CAB81074.1| polyubiquitin (ubq10) [Arabidopsis thaliana]
Length=464

 Score =   417 bits (1072),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   417 bits (1072),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   417 bits (1072),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   330 bits (846),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/166 (100%), Positives = 166/166 (100%), Gaps = 0/166 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  249  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  309  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  368

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  221
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE
Sbjct  369  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  414


 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KIY53974.1| polyubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   411 bits (1056),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   409 bits (1051),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 204/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DY+IQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLSDYSIQKESTLHLVLRLRGGL  305


 Score =   300 bits (768),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_011048569.1| PREDICTED: polyubiquitin 3-like [Populus euphratica]
Length=306

 Score =   411 bits (1056),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 206/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK+
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKD  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLE+GRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEEGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   411 bits (1056),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 206/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK+STLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKDSTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQK+STLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKDSTLHLVLRLRGGM  153



>gb|KDQ20365.1| hypothetical protein BOTBODRAFT_123907 [Botryobasidium botryosum 
FD-172 SS1]
Length=305

 Score =   411 bits (1056),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   410 bits (1055),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   300 bits (768),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_007763327.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EIW86558.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EUC62408.1| polyubiquitin [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KDQ12738.1| hypothetical protein BOTBODRAFT_34195 [Botryobasidium botryosum 
FD-172 SS1]
 gb|KEP53373.1| polyubiquitin [Rhizoctonia solani 123E]
 gb|KIJ12827.1| hypothetical protein PAXINDRAFT_82237 [Paxillus involutus ATCC 
200175]
 gb|KIK47355.1| hypothetical protein CY34DRAFT_799527 [Suillus luteus UH-Slu-Lm8-n1]
Length=305

 Score =   411 bits (1056),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   410 bits (1055),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   300 bits (768),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_008244357.1| PREDICTED: polyubiquitin isoform X1 [Prunus mume]
 ref|XP_008244358.1| PREDICTED: polyubiquitin isoform X1 [Prunus mume]
 ref|XP_008244359.1| PREDICTED: polyubiquitin isoform X1 [Prunus mume]
Length=466

 Score =   417 bits (1072),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  258  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  317

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  318  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  377

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  378  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  437

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  438  QLEDGRTLADYNIQKESTLHLVLRLRGGF  466


 Score =   414 bits (1065),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  182  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  241

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  242  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  301

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  302  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  361

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  362  QLEDGRTLADYNIQKESTLHLVLRLRGGM  390


 Score =   397 bits (1021),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 204/218 (94%), Positives = 205/218 (94%), Gaps = 9/218 (4%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+QIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGVQIF  156

Query  538  V---------KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  386
                      KT TG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  157  EETHQTQIFEKTHTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  216

Query  385  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  206
            LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD
Sbjct  217  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  276

Query  205  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  314


 Score =   393 bits (1010),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 202/218 (93%), Positives = 204/218 (94%), Gaps = 9/218 (4%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV RLRGG+QIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVRRLRGGLQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGM---------QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  206
            STLHLVLRLRGG+         QIF KT TG TITLEVESSDTIDNVKAKIQDKEGIPPD
Sbjct  141  STLHLVLRLRGGVQIFEETHQTQIFEKTHTGNTITLEVESSDTIDNVKAKIQDKEGIPPD  200

Query  205  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  238


 Score =   298 bits (762),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLV RLRGG+QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVRRLRGGLQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  95
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  152



>gb|KIR63773.1| polyubiquitin [Cryptococcus gattii CA1873]
 gb|KIR98208.1| polyubiquitin [Cryptococcus gattii 2001/935-1]
Length=305

 Score =   411 bits (1056),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   410 bits (1053),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 204/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   299 bits (765),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_003670049.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 ref|XP_003959063.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 ref|XP_004181533.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
 emb|CCD24806.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 emb|CCF59928.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 emb|CCH62014.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
Length=229

 Score =   408 bits (1048),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 202/209 (97%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (762),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|KIM67150.1| hypothetical protein SCLCIDRAFT_1210637 [Scleroderma citrinum 
Foug A]
Length=305

 Score =   411 bits (1056),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   407 bits (1047),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 204/209 (98%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQVKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   296 bits (759),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQVKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_007366816.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
 gb|EJF60398.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
Length=305

 Score =   410 bits (1055),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLSDYNIQKESTLHLVLRLRGGL  305


 Score =   408 bits (1049),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 204/209 (98%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRPLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (761),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRPLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_007205619.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06818.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=232

 Score =   408 bits (1048),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 204/205 (99%), Positives = 204/205 (99%), Gaps = 0/205 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRL  104
            QLEDGRTLADYNIQKESTLHLVLR 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRF  225


 Score =   303 bits (775),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJB62483.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=381

 Score =   414 bits (1063),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 207/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   412 bits (1060),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 206/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   411 bits (1057),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (768),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007864655.1| ubiquitin [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ57585.1| ubiquitin [Gloeophyllum trabeum ATCC 11539]
 gb|KIP08465.1| hypothetical protein PHLGIDRAFT_18910 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=381

 Score =   414 bits (1063),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 206/209 (99%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  353  QLEDGRTLSDYNIQKESTLHLVLRLRGGF  381


 Score =   411 bits (1056),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   411 bits (1056),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  305


 Score =   300 bits (767),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|KJB62486.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=383

 Score =   414 bits (1063),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 207/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  175  DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  234

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  235  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  294

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  295  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  354

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  355  QLEDGRTLADYNIQKESTLHLVLRLRGG  382


 Score =   407 bits (1047),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 206/211 (98%), Positives = 208/211 (99%), Gaps = 2/211 (1%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  --VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  365
              VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ
Sbjct  157  IFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  216

Query  364  KESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA  185
            KESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA
Sbjct  217  KESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA  276

Query  184  GKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            GKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  GKQLEDGRTLADYNIQKESTLHLVLRLRGGM  307


 Score =   406 bits (1044),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 205/211 (97%), Positives = 208/211 (99%), Gaps = 2/211 (1%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQ--IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA  185
            STLHLVLRLRGGMQ  IFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFA
Sbjct  141  STLHLVLRLRGGMQIFIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFA  200

Query  184  GKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            GKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  GKQLEDGRTLADYNIQKESTLHLVLRLRGGM  231


 Score =   300 bits (768),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002953480.1| polyubiquitin [Volvox carteri f. nagariensis]
 gb|EFJ45453.1| polyubiquitin [Volvox carteri f. nagariensis]
Length=305

 Score =   410 bits (1055),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGL  305


 Score =   410 bits (1055),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (767),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>sp|P0CG73.1|UBI1P_CANAX RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin-related; 
Contains: RecName: Full=Ubiquitin; Flags: Precursor 
[Candida albicans]
 gb|AAA84868.1| ubiquitin precursor [Candida albicans]
Length=229

 Score =   407 bits (1047),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 202/209 (97%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLR RGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRSRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGF  229


 Score =   295 bits (755),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 147/153 (96%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLR RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRSRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>emb|CCT70325.1| UBI4-Ubiquitin [Fusarium fujikuroi IMI 58289]
Length=281

 Score =   409 bits (1052),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 203/208 (98%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  73   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  132

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  133  VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  192

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK
Sbjct  193  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK  252

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  253  QLEDGRTLSDYNIQKESTLHLVLRLRGG  280


 Score =   352 bits (904),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 175/180 (97%), Positives = 179/180 (99%), Gaps = 0/180 (0%)
 Frame = -1

Query  631  LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  452
            LEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDK
Sbjct  26   LEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDK  85

Query  451  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  272
            EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV
Sbjct  86   EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  145

Query  271  ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            ESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  146  ESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  205


 Score = 46.6 bits (109),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -3

Query  809  FHLVXRXRGGMQIFVKTXTGKTITLR  732
             HLV R RGGMQIFVKT TGKTITL 
Sbjct  43   LHLVLRLRGGMQIFVKTLTGKTITLE  68


 Score = 28.9 bits (63),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  852  GXTLAXYNIQKESTLPL  802
            G TL+ YNIQKESTL L
Sbjct  29   GRTLSDYNIQKESTLHL  45



>gb|AAN31845.1| putative polyubiquitin (UBQ10) [Arabidopsis thaliana]
Length=464

 Score =   416 bits (1070),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   416 bits (1070),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   416 bits (1070),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   344 bits (882),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 172/172 (100%), Positives = 172/172 (100%), Gaps = 0/172 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  249  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  309  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  368

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  203
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  369  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  420


 Score =   303 bits (777),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CEP60563.1| LALA0S01e13784g1_1 [Lachancea lanzarotensis]
Length=229

 Score =   407 bits (1047),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 202/209 (97%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGI  229


 Score =   298 bits (762),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_001931824.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 ref|XP_003305664.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 ref|XP_003854274.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 ref|XP_007275950.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 ref|XP_007376605.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 ref|XP_007674454.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 ref|XP_007741026.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 ref|XP_009261437.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 ref|XP_009650785.1| ubiquitin [Verticillium dahliae VdLs.17]
 ref|XP_011319955.1| ubiquitin [Fusarium graminearum PH-1]
 gb|EDU40929.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EFQ86204.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 gb|EGP89250.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 gb|EGW31827.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 gb|EGY14431.1| ubiquitin [Verticillium dahliae VdLs.17]
 gb|EHK44351.1| hypothetical protein TRIATDRAFT_300588 [Trichoderma atroviride 
IMI 206040]
 gb|EJT46666.1| hypothetical protein A1Q1_04737 [Trichosporon asahii var. asahii 
CBS 2479]
 gb|EKJ69797.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 gb|ELA35078.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 gb|EMC98317.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 gb|EME45125.1| hypothetical protein DOTSEDRAFT_70987 [Dothistroma septosporum 
NZE10]
 gb|ENH81500.1| ubiquitin [Colletotrichum orbiculare MAFF 240422]
 gb|ESU14530.1| ubiquitin [Fusarium graminearum PH-1]
 emb|CDK27817.1| unnamed protein product [Kuraishia capsulata CBS 1993]
 gb|EXJ73926.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 gb|EYB28525.1| hypothetical protein FG05_08768 [Fusarium graminearum]
 gb|KEQ58801.1| ubiquitin [Aureobasidium melanogenum CBS 110374]
 gb|KEQ70291.1| ubiquitin [Aureobasidium pullulans var. namibiae CBS 147.97]
 gb|KEQ87814.1| ubiquitin [Aureobasidium pullulans EXF-150]
 gb|KER00813.1| hypothetical protein AUEXF2481DRAFT_25097 [Aureobasidium subglaciale 
EXF-2481]
 emb|CEF77191.1| unnamed protein product [Fusarium graminearum]
 gb|KIV95571.1| polyubiquitin [Exophiala mesophila]
 gb|KIW22916.1| polyubiquitin [Cladophialophora immunda]
 gb|KIW83318.1| polyubiquitin [Fonsecaea pedrosoi CBS 271.37]
 gb|KIW87781.1| polyubiquitin [Cladophialophora bantiana CBS 173.52]
 gb|KIX98997.1| polyubiquitin [Fonsecaea multimorphosa CBS 102226]
Length=229

 Score =   407 bits (1046),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 202/208 (97%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   298 bits (762),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_007924320.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EHN05782.1| Ubi4p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EME83800.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EWH17145.1| Ubi4p [Saccharomyces cerevisiae P283]
Length=229

 Score =   407 bits (1046),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 202/208 (97%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   298 bits (762),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_002419618.1| ubiquitin, putative [Candida dubliniensis CD36]
 sp|P0CG74.1|UBI4P_CANAX RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Candida albicans]
 emb|CAA90901.1| polyubiquitin [Candida albicans]
 emb|CAX43214.1| ubiquitin, putative [Candida dubliniensis CD36]
 gb|KGU10731.1| polyubiquitin [Candida albicans L26]
Length=305

 Score =   410 bits (1054),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 203/209 (97%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  277  QLEDGRTLSDYNIQKESTLHLVLRLRGGF  305


 Score =   407 bits (1047),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 202/209 (97%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (761),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_011038259.1| PREDICTED: polyubiquitin-like [Populus euphratica]
 ref|XP_011038263.1| PREDICTED: polyubiquitin-like [Populus euphratica]
Length=305

 Score =   410 bits (1054),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLE+GRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   407 bits (1047),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 204/209 (98%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLE+GRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLE+GRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEEGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010324326.1| PREDICTED: polyubiquitin isoform X1 [Solanum lycopersicum]
Length=457

 Score =   416 bits (1068),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1067),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  249  DTIDNVKAKIQDKEGIPSDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  309  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  368

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  369  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  428

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  429  QLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   412 bits (1060),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   412 bits (1060),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   303 bits (776),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 46.6 bits (109),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -3

Query  809  FHLVXRXRGGMQIFVKTXTGKTITLR  732
             HLV R RGGMQIFVKT TGKTITL 
Sbjct  295  LHLVLRLRGGMQIFVKTLTGKTITLE  320


 Score = 30.0 bits (66),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  852  GXTLAXYNIQKESTLPL  802
            G TLA YNIQKESTL L
Sbjct  281  GRTLADYNIQKESTLHL  297



>ref|XP_007049060.1| Polyubiquitin 10 [Theobroma cacao]
 gb|EOX93217.1| Polyubiquitin 10 [Theobroma cacao]
Length=457

 Score =   416 bits (1068),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 209/209 (100%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  249  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  309  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  368

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEV+SSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  369  STLHLVLRLRGGMQIFVKTLTGKTITLEVDSSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  428

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  429  QLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   414 bits (1065),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   414 bits (1065),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   414 bits (1065),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   302 bits (774),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KII93501.1| hypothetical protein PLICRDRAFT_694663 [Plicaturopsis crispa 
FD-325 SS-3]
Length=348

 Score =   412 bits (1058),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  64   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  123

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  124  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  183

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  184  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  243

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  244  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  272


 Score =   411 bits (1057),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 205/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  140  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  199

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  200  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  259

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  260  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  319

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  320  QLEDGRTLSDYNIQKESTLHLVLRLRGG  347


 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/154 (97%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = -1

Query  553  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  374
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  43   SMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  102

Query  373  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  194
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  103  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  162

Query  193  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  163  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  196



>gb|AAO43308.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   408 bits (1048),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 206/208 (99%), Positives = 206/208 (99%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  41   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  100

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  101  VKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYNIQKE  160

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  161  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  220

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLA YNIQKESTLHLVLRLRGG
Sbjct  221  QLEDGRTLAVYNIQKESTLHLVLRLRGG  248


 Score =   340 bits (871),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = -1

Query  610  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  431
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  430  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  251
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  250  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            NVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  NVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173


 Score = 46.2 bits (108),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -3

Query  809  FHLVXRXRGGMQIFVKTXTGKTITLR  732
             HLV R RGGMQIFVKT TGKTITL 
Sbjct  11   LHLVLRLRGGMQIFVKTLTGKTITLE  36


 Score = 24.6 bits (52),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -2

Query  840  AXYNIQKESTLPL  802
            A YNIQKESTL L
Sbjct  1    ADYNIQKESTLHL  13



>gb|EPX74297.1| ubiquitin [Schizosaccharomyces octosporus yFS286]
Length=230

 Score =   407 bits (1046),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 202/208 (97%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  201  QLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   297 bits (761),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>dbj|GAK65396.1| ubiquitin [Pseudozyma antarctica]
Length=334

 Score =   411 bits (1056),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  50   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  109

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  110  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  169

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  170  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  229

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  230  QLEDGRTLSDYNIQKESTLHLVLRLRGGM  258


 Score =   410 bits (1055),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 205/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIF
Sbjct  126  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF  185

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE
Sbjct  186  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE  245

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  246  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  305

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  306  QLEDGRTLSDYNIQKESTLHLVLRLRGG  333


 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/154 (97%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = -1

Query  553  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  374
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  29   AMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  88

Query  373  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  194
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  89   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  148

Query  193  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  149  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  182



>ref|XP_007154492.1| hypothetical protein PHAVU_003G123400g [Phaseolus vulgaris]
 gb|ESW26486.1| hypothetical protein PHAVU_003G123400g [Phaseolus vulgaris]
Length=358

 Score =   412 bits (1058),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ E
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQME  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   387 bits (994),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 207/262 (79%), Positives = 207/262 (79%), Gaps = 53/262 (20%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ ESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQMESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEG-----------------------------  446
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEG                             
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  445  ------------------------IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  338
                                    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
Sbjct  217  STLHLVLRLRGGMQIFAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  276

Query  337  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  158
            RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  277  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  336

Query  157  LADYNIQKESTLHLVLRLRGGF  92
            LADYNIQKESTLHLVLRLRGG 
Sbjct  337  LADYNIQKESTLHLVLRLRGGL  358


 Score =   300 bits (767),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQ ESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQMESTLHLVLRLRGGM  153



>ref|XP_004953565.1| PREDICTED: polyubiquitin-like [Setaria italica]
Length=459

 Score =   416 bits (1068),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  249  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  309  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  368

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  369  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  428

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  429  QLEDGRTLADYNIQKESTLHLVLRLRGGL  457


 Score =   416 bits (1068),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   416 bits (1068),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   416 bits (1068),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   303 bits (776),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_011037020.1| PREDICTED: polyubiquitin-like [Populus euphratica]
Length=388

 Score =   413 bits (1061),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  180  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  239

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  240  VKTLTGKTITLEVESLDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  299

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  300  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  359

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  360  QLEDGRTLADYNIQKESTLHLVLRLRGGF  388


 Score =   400 bits (1029),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 206/216 (95%), Positives = 206/216 (95%), Gaps = 7/216 (3%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK-------QLEDGRTLA  380
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  K       QLEDGRTLA
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFRWKDEGWCLYQLEDGRTLA  140

Query  379  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  200
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  141  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  200

Query  199  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  236


 Score =   398 bits (1022),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 205/216 (95%), Positives = 205/216 (95%), Gaps = 7/216 (3%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGK-------QLEDGRTLADYNIQKESTLHLVLRL  560
            DTIDNVKAKIQDKEGIPPDQQRLIF  K       QLEDGRTLADYNIQKESTLHLVLRL
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFRWKDEGWCLYQLEDGRTLADYNIQKESTLHLVLRL  156

Query  559  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  380
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  157  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  216

Query  379  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  200
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQ
Sbjct  217  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESLDTIDNVKAKIQDKEGIPPDQQ  276

Query  199  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  312


 Score =   289 bits (739),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 150/160 (94%), Gaps = 7/160 (4%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGK-------QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            F  K       QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FRWKDEGWCLYQLEDGRTLADYNIQKESTLHLVLRLRGGM  160


 Score = 46.2 bits (108),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -3

Query  809  FHLVXRXRGGMQIFVKTXTGKTITLR  732
             HLV R RGGMQIFVKT TGKTITL 
Sbjct  150  LHLVLRLRGGMQIFVKTLTGKTITLE  175


 Score = 30.0 bits (66),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  852  GXTLAXYNIQKESTLPL  802
            G TLA YNIQKESTL L
Sbjct  136  GRTLADYNIQKESTLHL  152



>ref|XP_010436682.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=462

 Score =   416 bits (1068),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  101  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  160

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  161  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  220

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  221  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  280

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  281  QLEDGRTLADYNIQKESTLHLVLRLRGGM  309


 Score =   416 bits (1068),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  177  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  236

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  237  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  296

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  297  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  356

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  357  QLEDGRTLADYNIQKESTLHLVLRLRGGM  385


 Score =   415 bits (1067),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  253  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  312

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  313  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  372

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  373  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  432

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  433  QLEDGRTLADYNIQKESTLHLVLRLRGG  460


 Score =   393 bits (1010),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 197/209 (94%), Positives = 203/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTI+NVKA+IQD+EGIP DQQRLIF+GK L+DG TLADYNIQKES LHL LRLRGG+QIF
Sbjct  25   DTINNVKAQIQDREGIPLDQQRLIFSGKLLDDGLTLADYNIQKESILHLALRLRGGIQIF  84

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  85   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  144

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  145  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  204

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  205  QLEDGRTLADYNIQKESTLHLVLRLRGGM  233


 Score =   269 bits (688),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQI  KTLT KTITL+V+SSDTI+NVKA+IQD+EGIP DQQRLIF+GK L+DG TLADYN
Sbjct  5    MQIHAKTLTEKTITLDVKSSDTINNVKAQIQDREGIPLDQQRLIFSGKLLDDGLTLADYN  64

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKES LHL LRLRGG+QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  65   IQKESILHLALRLRGGIQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  124

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  125  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  157


 Score = 42.4 bits (98),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = -3

Query  809  FHLVXRXRGGMQIFVKTXTGKTITLR  732
             HL  R RGG+QIFVKT TGKTITL 
Sbjct  71   LHLALRLRGGIQIFVKTLTGKTITLE  96


 Score = 29.3 bits (64),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -2

Query  852  GXTLAXYNIQKESTLPLGXPXQG  784
            G TLA YNIQKES L L    +G
Sbjct  57   GLTLADYNIQKESILHLALRLRG  79



>ref|XP_004956019.1| PREDICTED: polyubiquitin 4-like [Setaria italica]
Length=381

 Score =   412 bits (1060),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID+VKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDHVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   412 bits (1060),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 207/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTID+VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDHVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   412 bits (1059),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 207/208 (99%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTID+VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDHVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   302 bits (774),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_001755431.1| predicted protein [Physcomitrella patens]
 gb|EDQ79911.1| predicted protein [Physcomitrella patens]
Length=231

 Score =   407 bits (1045),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 204/207 (99%), Positives = 204/207 (99%), Gaps = 0/207 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRG  98
            QLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRG  227


 Score =   299 bits (765),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002452705.1| hypothetical protein SORBIDRAFT_04g031060 [Sorghum bicolor]
 gb|EES05681.1| hypothetical protein SORBIDRAFT_04g031060 [Sorghum bicolor]
Length=459

 Score =   415 bits (1067),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1067),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   415 bits (1067),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   415 bits (1066),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  249  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  309  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  368

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  369  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  428

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  429  QLEDGRTLADYNIQKESTLHLVLRLRGG  456


 Score =   303 bits (775),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010262389.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
Length=461

 Score =   415 bits (1067),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  249  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  309  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  368

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  369  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  428

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  429  QLEDGRTLADYNIQKESTLHLVLRLRGGL  457


 Score =   415 bits (1067),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1067),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   415 bits (1067),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   303 bits (775),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KDP42860.1| hypothetical protein JCGZ_23802 [Jatropha curcas]
Length=457

 Score =   415 bits (1067),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1067),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   415 bits (1067),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   414 bits (1065),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  249  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  309  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  368

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP QQRLIFAGK
Sbjct  369  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPVQQRLIFAGK  428

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  429  QLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   303 bits (775),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_001755307.1| predicted protein [Physcomitrella patens]
 gb|EDQ79787.1| predicted protein [Physcomitrella patens]
Length=305

 Score =   409 bits (1052),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 205/209 (98%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   409 bits (1051),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 205/208 (99%), Positives = 205/208 (99%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   299 bits (765),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CAA40324.1| hexaubiquitin protein [Helianthus annuus]
 emb|CAA40325.1| hexaubiquitin protein [Helianthus annuus]
Length=457

 Score =   415 bits (1067),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1067),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   415 bits (1067),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   415 bits (1066),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  249  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  309  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  368

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  369  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  428

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGG  95
            QLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  429  QLEDGRTLADYNIQKESTLHLVLRLRGG  456


 Score =   303 bits (775),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007211609.1| hypothetical protein PRUPE_ppa005507mg [Prunus persica]
 gb|AAL27564.1|AF429430_1 polyubiquitin OUB2 [Olea europaea]
 gb|EMJ12808.1| hypothetical protein PRUPE_ppa005507mg [Prunus persica]
Length=457

 Score =   415 bits (1067),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  249  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  308

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  309  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  368

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  369  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  428

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  429  QLEDGRTLADYNIQKESTLHLVLRLRGGL  457


 Score =   415 bits (1066),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  21   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  80

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  81   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  140

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  141  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  200

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  QLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   415 bits (1066),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  97   DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  156

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  157  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  217  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  276

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  277  QLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   415 bits (1066),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = -1

Query  718  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  539
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  173  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  232

Query  538  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  359
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  233  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  292

Query  358  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  179
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  293  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  352

Query  178  QLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  QLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   303 bits (775),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  550  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  371
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  370  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  191
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  190  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  92
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2022102100800