BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF025K03

Length=760
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009615190.1|  PREDICTED: ankyrin repeat protein SKIP35           288   4e-89   
ref|XP_009760838.1|  PREDICTED: ankyrin repeat protein SKIP35-like      285   4e-88   Nicotiana sylvestris
ref|XP_004244785.1|  PREDICTED: ankyrin repeat protein SKIP35 iso...    285   8e-88   Solanum lycopersicum
ref|XP_010324730.1|  PREDICTED: ankyrin repeat protein SKIP35 iso...    285   8e-88   Solanum lycopersicum
ref|XP_006351083.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    282   1e-86   Solanum tuberosum [potatoes]
ref|XP_006351081.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    282   1e-86   Solanum tuberosum [potatoes]
emb|CDP19148.1|  unnamed protein product                                274   6e-86   Coffea canephora [robusta coffee]
ref|XP_006344946.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    276   1e-84   Solanum tuberosum [potatoes]
ref|XP_006344945.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    276   1e-84   Solanum tuberosum [potatoes]
ref|XP_009797824.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    272   2e-83   Nicotiana sylvestris
ref|XP_009797820.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    272   2e-83   Nicotiana sylvestris
gb|AFK48259.1|  unknown                                                 258   1e-82   Lotus japonicus
gb|KDP29537.1|  hypothetical protein JCGZ_19250                         271   1e-82   Jatropha curcas
ref|XP_002533338.1|  conserved hypothetical protein                     270   4e-82   Ricinus communis
ref|XP_010313979.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    269   1e-81   
ref|XP_004251971.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    268   1e-81   Solanum lycopersicum
emb|CDP19146.1|  unnamed protein product                                267   2e-81   Coffea canephora [robusta coffee]
ref|XP_009618034.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    266   4e-81   Nicotiana tomentosiformis
ref|XP_009618028.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    266   4e-81   
emb|CAN70678.1|  hypothetical protein VITISV_044152                     265   1e-80   Vitis vinifera
ref|XP_010650761.1|  PREDICTED: ankyrin repeat protein SKIP35-like      265   2e-80   
ref|XP_002309709.2|  hypothetical protein POPTR_0007s00280g             265   3e-80   
ref|XP_011005246.1|  PREDICTED: ankyrin repeat protein SKIP35-like      264   4e-80   Populus euphratica
ref|XP_008243090.1|  PREDICTED: ankyrin repeat protein SKIP35-like      263   2e-79   Prunus mume [ume]
ref|XP_006441987.1|  hypothetical protein CICLE_v10019310mg             261   5e-79   
ref|XP_006478490.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    261   5e-79   Citrus sinensis [apfelsine]
gb|KHN22618.1|  F-box/ankyrin repeat protein SKIP35                     260   7e-79   Glycine soja [wild soybean]
ref|XP_006584140.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    260   7e-79   Glycine max [soybeans]
ref|XP_007026463.1|  Ankyrin repeat family protein isoform 1            259   2e-78   Theobroma cacao [chocolate]
ref|XP_011074019.1|  PREDICTED: ankyrin repeat protein SKIP35-like      259   3e-78   
ref|XP_007203611.1|  hypothetical protein PRUPE_ppa002867mg             259   3e-78   Prunus persica
ref|XP_010251448.1|  PREDICTED: ankyrin repeat protein SKIP35-like      259   3e-78   Nelumbo nucifera [Indian lotus]
emb|CBI24769.3|  unnamed protein product                                265   6e-78   Vitis vinifera
gb|KJB11213.1|  hypothetical protein B456_001G247600                    258   7e-78   Gossypium raimondii
gb|AJF94393.1|  F-box/ankyrin repeat protein SKIP35                     258   1e-77   Gossypium hirsutum [American cotton]
ref|XP_010277855.1|  PREDICTED: ankyrin repeat protein SKIP35           257   2e-77   Nelumbo nucifera [Indian lotus]
ref|XP_004288739.1|  PREDICTED: ankyrin repeat protein SKIP35-like      256   3e-77   Fragaria vesca subsp. vesca
gb|KHN27707.1|  F-box/ankyrin repeat protein SKIP35                     256   4e-77   Glycine soja [wild soybean]
ref|XP_006600252.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    256   4e-77   Glycine max [soybeans]
gb|KEH32772.1|  F-box/ankyrin repeat SKIP35-like protein                256   5e-77   Medicago truncatula
ref|XP_007153901.1|  hypothetical protein PHAVU_003G074400g             256   6e-77   Phaseolus vulgaris [French bean]
ref|XP_008394247.1|  PREDICTED: ankyrin repeat protein SKIP35           252   2e-75   
ref|XP_010930324.1|  PREDICTED: ankyrin repeat protein SKIP35           252   2e-75   Elaeis guineensis
ref|XP_010672531.1|  PREDICTED: ankyrin repeat protein SKIP35-like      252   2e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010067585.1|  PREDICTED: ankyrin repeat protein SKIP35-like      251   5e-75   Eucalyptus grandis [rose gum]
gb|KHG16914.1|  F-box/ankyrin repeat SKIP35 -like protein               250   1e-74   Gossypium arboreum [tree cotton]
ref|XP_008801302.1|  PREDICTED: ankyrin repeat protein SKIP35           250   2e-74   Phoenix dactylifera
ref|XP_008445478.1|  PREDICTED: ankyrin repeat protein SKIP35-like      249   2e-74   Cucumis melo [Oriental melon]
ref|XP_010087440.1|  hypothetical protein L484_019643                   249   2e-74   
ref|XP_004144185.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    247   1e-73   Cucumis sativus [cucumbers]
gb|EYU22360.1|  hypothetical protein MIMGU_mgv1a017835mg                247   2e-73   Erythranthe guttata [common monkey flower]
ref|XP_004499381.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    246   3e-73   Cicer arietinum [garbanzo]
ref|XP_011085079.1|  PREDICTED: ankyrin repeat protein SKIP35-like      246   4e-73   Sesamum indicum [beniseed]
ref|XP_008389252.1|  PREDICTED: ankyrin repeat protein SKIP35           239   3e-72   
ref|XP_008354473.1|  PREDICTED: ankyrin repeat protein SKIP35-like      239   4e-72   
ref|XP_011004557.1|  PREDICTED: ankyrin repeat protein SKIP35           243   8e-72   Populus euphratica
ref|XP_010912734.1|  PREDICTED: ankyrin repeat protein SKIP35-like      243   1e-71   Elaeis guineensis
gb|EYU36630.1|  hypothetical protein MIMGU_mgv1a002704mg                242   2e-71   Erythranthe guttata [common monkey flower]
ref|XP_006372306.1|  hypothetical protein POPTR_0017s00410g             241   3e-71   
gb|KDO49748.1|  hypothetical protein CISIN_1g006847mg                   241   3e-71   Citrus sinensis [apfelsine]
ref|XP_009390785.1|  PREDICTED: ankyrin repeat protein SKIP35-like      239   1e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009379908.1|  PREDICTED: ankyrin repeat protein SKIP35-like      239   2e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009366266.1|  PREDICTED: ankyrin repeat protein SKIP35-like      238   5e-70   
ref|XP_008781953.1|  PREDICTED: ankyrin repeat protein SKIP35-like      238   7e-70   Phoenix dactylifera
ref|XP_009404918.1|  PREDICTED: ankyrin repeat protein SKIP35-like      236   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006397583.1|  hypothetical protein EUTSA_v10001361mg             235   3e-69   Eutrema salsugineum [saltwater cress]
ref|XP_007026464.1|  Ankyrin repeat family protein isoform 2            231   7e-68   
ref|XP_010524207.1|  PREDICTED: ankyrin repeat protein SKIP35           228   2e-66   Tarenaya hassleriana [spider flower]
gb|AAX96769.1|  expressed protein                                       227   4e-66   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001067610.1|  Os11g0246900                                       226   4e-66   
gb|ABA92347.2|  expressed protein                                       227   5e-66   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67953.1|  hypothetical protein OsI_35687                          226   6e-66   Oryza sativa Indica Group [Indian rice]
gb|EEE51919.1|  hypothetical protein OsJ_33524                          226   8e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002881948.1|  hypothetical protein ARALYDRAFT_483529             223   3e-65   
ref|XP_010508343.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    223   5e-65   
ref|NP_566008.1|  Ankyrin repeat family protein                         223   6e-65   Arabidopsis thaliana [mouse-ear cress]
gb|AAK82517.1|  At2g44090/F6E13.22                                      223   1e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508342.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    223   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_006662854.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    223   2e-64   Oryza brachyantha
emb|CDX79783.1|  BnaA05g03730D                                          222   3e-64   
ref|XP_009404281.1|  PREDICTED: ankyrin repeat protein SKIP35-like      222   5e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010517993.1|  PREDICTED: ankyrin repeat protein SKIP35-like      220   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_009142990.1|  PREDICTED: ankyrin repeat protein SKIP35           220   1e-63   Brassica rapa
ref|XP_010237787.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    219   3e-63   Brachypodium distachyon [annual false brome]
ref|XP_003577645.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    219   4e-63   Brachypodium distachyon [annual false brome]
ref|XP_009387780.1|  PREDICTED: ankyrin repeat protein SKIP35-like      219   4e-63   
ref|XP_004978971.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    219   4e-63   Setaria italica
ref|XP_004978972.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    219   5e-63   Setaria italica
gb|EPS60182.1|  hypothetical protein M569_14622                         219   6e-63   Genlisea aurea
ref|XP_004978970.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    219   7e-63   
gb|KFK37227.1|  hypothetical protein AALP_AA4G230300                    218   7e-63   Arabis alpina [alpine rockcress]
emb|CDY23417.1|  BnaC04g49450D                                          216   1e-62   Brassica napus [oilseed rape]
emb|CDY17887.1|  BnaC04g03320D                                          217   2e-62   Brassica napus [oilseed rape]
dbj|BAJ86308.1|  predicted protein                                      216   5e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU29406.1|  hypothetical protein MIMGU_mgv1a003332mg                214   3e-61   Erythranthe guttata [common monkey flower]
ref|NP_001169323.1|  uncharacterized protein LOC100383189               211   6e-60   Zea mays [maize]
ref|XP_010469258.1|  PREDICTED: ankyrin repeat protein SKIP35           208   4e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010512283.1|  PREDICTED: ankyrin repeat protein SKIP35-like      208   4e-59   Camelina sativa [gold-of-pleasure]
ref|XP_002450553.1|  hypothetical protein SORBIDRAFT_05g006915          208   5e-59   Sorghum bicolor [broomcorn]
ref|XP_002878304.1|  hypothetical protein ARALYDRAFT_486455             207   9e-59   
ref|NP_191550.1|  Ankyrin repeat family protein                         207   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010413621.1|  PREDICTED: ankyrin repeat protein SKIP35-like      207   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_006402640.1|  hypothetical protein EUTSA_v10005846mg             206   3e-58   Eutrema salsugineum [saltwater cress]
gb|EMS56943.1|  hypothetical protein TRIUR3_08812                       206   4e-58   Triticum urartu
ref|XP_009116666.1|  PREDICTED: ankyrin repeat protein SKIP35           205   9e-58   Brassica rapa
emb|CDX71861.1|  BnaC08g30130D                                          203   3e-57   
ref|XP_006290752.1|  hypothetical protein CARUB_v10016852mg             203   3e-57   
gb|EMT24392.1|  hypothetical protein F775_29756                         203   7e-57   
emb|CDY05963.1|  BnaA09g38170D                                          202   1e-56   
ref|XP_008370850.1|  PREDICTED: ankyrin repeat protein SKIP35-like      199   3e-56   
emb|CDY30455.1|  BnaA04g25560D                                          201   4e-56   Brassica napus [oilseed rape]
ref|XP_008788289.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    192   9e-55   Phoenix dactylifera
ref|XP_008788288.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    192   4e-54   Phoenix dactylifera
ref|XP_008788287.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    192   2e-53   
ref|XP_008788283.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    192   3e-53   Phoenix dactylifera
ref|XP_002985572.1|  hypothetical protein SELMODRAFT_122416             191   8e-53   
ref|XP_002987003.1|  hypothetical protein SELMODRAFT_125287             190   9e-53   
ref|XP_006848543.1|  hypothetical protein AMTR_s00169p00037240          190   5e-52   Amborella trichopoda
ref|XP_001775776.1|  predicted protein                                  182   7e-50   
ref|XP_001771374.1|  predicted protein                                  181   2e-49   
ref|XP_001760791.1|  predicted protein                                  179   1e-48   
dbj|BAD15575.1|  unknown protein                                        170   5e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001755132.1|  predicted protein                                  177   5e-48   
ref|NP_001047152.1|  Os02g0562400                                       170   1e-45   
ref|XP_006647390.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    169   5e-45   Oryza brachyantha
gb|EAZ23465.1|  hypothetical protein OsJ_07159                          169   5e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006858696.1|  hypothetical protein AMTR_s00066p00097810          168   2e-44   Amborella trichopoda
ref|XP_004952744.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    165   3e-43   
ref|XP_002962852.1|  hypothetical protein SELMODRAFT_62282              160   7e-42   
gb|ACN33692.1|  unknown                                                 160   7e-42   Zea mays [maize]
ref|XP_002989433.1|  hypothetical protein SELMODRAFT_42326              159   1e-41   
ref|XP_008344056.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin repe...    101   7e-21   
gb|EAY86310.1|  hypothetical protein OsI_07683                        85.9    1e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_001765794.1|  predicted protein                                78.6    5e-13   
ref|XP_001757638.1|  predicted protein                                77.8    6e-13   
ref|XP_001759714.1|  predicted protein                                77.8    7e-13   
ref|XP_001770027.1|  predicted protein                                75.5    4e-12   



>ref|XP_009615190.1| PREDICTED: ankyrin repeat protein SKIP35 [Nicotiana tomentosiformis]
 ref|XP_009615191.1| PREDICTED: ankyrin repeat protein SKIP35 [Nicotiana tomentosiformis]
 ref|XP_009615192.1| PREDICTED: ankyrin repeat protein SKIP35 [Nicotiana tomentosiformis]
 emb|CAI84657.1| hypothetical protein [Nicotiana tabacum]
Length=621

 Score =   288 bits (736),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLLSSDFLGDPAATYAVADSIA+S+DEAVAPELRSF
Sbjct  449  LAALSIEILKAAGERSGGSLDGVAFLLSSDFLGDPAATYAVADSIAKSDDEAVAPELRSF  508

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  +G RQG+EHYLN+VRI+  GESP+CL DLP PLR+AIAYLPLYRECVKA
Sbjct  509  LREHWSEAAFSDGLRQGQEHYLNIVRILKWGESPVCLADLPGPLRVAIAYLPLYRECVKA  568

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            GGCLLSQRLRGQLVEAAKRL GV LE+  QGRELL +LEH++P FL+NA
Sbjct  569  GGCLLSQRLRGQLVEAAKRLDGVVLEEVNQGRELLAVLEHHIPPFLVNA  617



>ref|XP_009760838.1| PREDICTED: ankyrin repeat protein SKIP35-like [Nicotiana sylvestris]
 ref|XP_009760839.1| PREDICTED: ankyrin repeat protein SKIP35-like [Nicotiana sylvestris]
Length=621

 Score =   285 bits (729),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLLSSDFLGDPAATYAVADSIA+ +DEAVAPELRSF
Sbjct  449  LAALSIEILKAAGERSGGSLDGVAFLLSSDFLGDPAATYAVADSIAKLDDEAVAPELRSF  508

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  +G RQG+EHYLN+VRI+  GESP+CL DLP PLR+AIAYLPLYRECVKA
Sbjct  509  LREHWSEAAFSDGLRQGQEHYLNIVRILKWGESPVCLGDLPGPLRVAIAYLPLYRECVKA  568

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            GGCLLSQRLRGQLVEAAKRL GV LE+  QGRELL +LEH++P FL+NA
Sbjct  569  GGCLLSQRLRGQLVEAAKRLDGVVLEEVNQGRELLAVLEHHIPPFLVNA  617



>ref|XP_004244785.1| PREDICTED: ankyrin repeat protein SKIP35 isoform X2 [Solanum 
lycopersicum]
Length=635

 Score =   285 bits (728),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERSSGSLDGVAFLLSSDFLGDP ATYAVADSIA+S+DEAVAP LRSF
Sbjct  462  LAALSIEILKAAGERSSGSLDGVAFLLSSDFLGDPIATYAVADSIAKSDDEAVAPALRSF  521

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  +G RQG+EHY NL+RIM  GESP+CLRD+P PLRIAIAYLPLYRECVKA
Sbjct  522  LREHWSEAAFSDGLRQGQEHYCNLLRIMKWGESPVCLRDIPGPLRIAIAYLPLYRECVKA  581

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GGCLLSQRL+GQLVEAAKRL GV LE+ +QGRELL +LEH+LP FL N
Sbjct  582  GGCLLSQRLKGQLVEAAKRLDGVVLEEVKQGRELLAVLEHHLPPFLHN  629



>ref|XP_010324730.1| PREDICTED: ankyrin repeat protein SKIP35 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010324731.1| PREDICTED: ankyrin repeat protein SKIP35 isoform X1 [Solanum 
lycopersicum]
Length=636

 Score =   285 bits (728),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERSSGSLDGVAFLLSSDFLGDP ATYAVADSIA+S+DEAVAP LRSF
Sbjct  463  LAALSIEILKAAGERSSGSLDGVAFLLSSDFLGDPIATYAVADSIAKSDDEAVAPALRSF  522

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  +G RQG+EHY NL+RIM  GESP+CLRD+P PLRIAIAYLPLYRECVKA
Sbjct  523  LREHWSEAAFSDGLRQGQEHYCNLLRIMKWGESPVCLRDIPGPLRIAIAYLPLYRECVKA  582

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GGCLLSQRL+GQLVEAAKRL GV LE+ +QGRELL +LEH+LP FL N
Sbjct  583  GGCLLSQRLKGQLVEAAKRLDGVVLEEVKQGRELLAVLEHHLPPFLHN  630



>ref|XP_006351083.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X3 
[Solanum tuberosum]
Length=635

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A SIEILKAAGERSSGSLDGVAFLLSSDFLGDP ATYAVADSIA+S+DEAVAP LRSF
Sbjct  462  LTALSIEILKAAGERSSGSLDGVAFLLSSDFLGDPIATYAVADSIAKSDDEAVAPALRSF  521

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  +G RQG+EHY NLVRI+  GESP+CLRD+P PLRIAIAYLPLYRECVKA
Sbjct  522  LREHWSEAAFSDGLRQGQEHYCNLVRIIKWGESPVCLRDIPGPLRIAIAYLPLYRECVKA  581

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFL  263
            GGCLLSQRL+GQLVEAAKRL GV LE+ +QGRELL +LEH+LP FL
Sbjct  582  GGCLLSQRLKGQLVEAAKRLDGVVLEEVKQGRELLAVLEHHLPPFL  627



>ref|XP_006351081.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X1 
[Solanum tuberosum]
 ref|XP_006351082.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X2 
[Solanum tuberosum]
Length=636

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A SIEILKAAGERSSGSLDGVAFLLSSDFLGDP ATYAVADSIA+S+DEAVAP LRSF
Sbjct  463  LTALSIEILKAAGERSSGSLDGVAFLLSSDFLGDPIATYAVADSIAKSDDEAVAPALRSF  522

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  +G RQG+EHY NLVRI+  GESP+CLRD+P PLRIAIAYLPLYRECVKA
Sbjct  523  LREHWSEAAFSDGLRQGQEHYCNLVRIIKWGESPVCLRDIPGPLRIAIAYLPLYRECVKA  582

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFL  263
            GGCLLSQRL+GQLVEAAKRL GV LE+ +QGRELL +LEH+LP FL
Sbjct  583  GGCLLSQRLKGQLVEAAKRLDGVVLEEVKQGRELLAVLEHHLPPFL  628



>emb|CDP19148.1| unnamed protein product [Coffea canephora]
Length=421

 Score =   274 bits (700),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAA ERS  SLDGV+FLL SDFLG+PAATYAVADSIARS DE+VAPELR+F
Sbjct  253  LAALSIEILKAAAERSGRSLDGVSFLLQSDFLGEPAATYAVADSIARSNDESVAPELRAF  312

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA ++G +QG+EHY+NLVRI+  GESPICLRDLP PLR+AIAYLPLYREC KA
Sbjct  313  LKEHWSEAAFLDGLKQGQEHYMNLVRIVKWGESPICLRDLPGPLRVAIAYLPLYRECRKA  372

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GGCLLSQR RGQLVEAA+RL GV LE+A QGR+LL +LEH+LP+FLLN
Sbjct  373  GGCLLSQRRRGQLVEAARRLGGVELEEASQGRQLLAVLEHHLPSFLLN  420



>ref|XP_006344946.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X2 
[Solanum tuberosum]
Length=628

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 151/170 (89%), Gaps = 1/170 (1%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERSSGSLDGVAFLL SDFLGDP ATYAVADSIA+S+D+AVAP LRSF
Sbjct  454  LAALSIEILKAAGERSSGSLDGVAFLLHSDFLGDPVATYAVADSIAKSDDDAVAPGLRSF  513

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  +G +QG+EHYLN VRI+N GESPICL+DLP PLR+AIAYLPLYRE VK 
Sbjct  514  LREHWSEAAFSDGLQQGKEHYLNFVRIVNCGESPICLKDLPGPLRVAIAYLPLYRESVKV  573

Query  400  GG-CLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            GG CLLSQRLRGQLVEAAKRL GV LE+A QG+EL+ +LEH+LP FLLNA
Sbjct  574  GGCCLLSQRLRGQLVEAAKRLGGVVLEEANQGKELVAVLEHHLPPFLLNA  623



>ref|XP_006344945.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X1 
[Solanum tuberosum]
Length=629

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 151/170 (89%), Gaps = 1/170 (1%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERSSGSLDGVAFLL SDFLGDP ATYAVADSIA+S+D+AVAP LRSF
Sbjct  455  LAALSIEILKAAGERSSGSLDGVAFLLHSDFLGDPVATYAVADSIAKSDDDAVAPGLRSF  514

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  +G +QG+EHYLN VRI+N GESPICL+DLP PLR+AIAYLPLYRE VK 
Sbjct  515  LREHWSEAAFSDGLQQGKEHYLNFVRIVNCGESPICLKDLPGPLRVAIAYLPLYRESVKV  574

Query  400  GG-CLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            GG CLLSQRLRGQLVEAAKRL GV LE+A QG+EL+ +LEH+LP FLLNA
Sbjct  575  GGCCLLSQRLRGQLVEAAKRLGGVVLEEANQGKELVAVLEHHLPPFLLNA  624



>ref|XP_009797824.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X2 [Nicotiana 
sylvestris]
Length=602

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDE-AVAPELRS  584
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDP ATYAVADSIA+S+D+ AV P L+S
Sbjct  427  LAALSIEILKAAGERSGGSLDGVAFLLHSDFLGDPVATYAVADSIAKSDDDDAVTPNLKS  486

Query  583  FLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVK  404
            FL EHWSEAA  +G RQG+EHYLNLVRI+   E PICL+DLP PLR+AIAYLPLYRE +K
Sbjct  487  FLQEHWSEAAFFDGLRQGQEHYLNLVRIVKWSECPICLKDLPGPLRVAIAYLPLYRESIK  546

Query  403  AGGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            AGGCLLSQRLRGQLVEAAKRL GV LE+A QG+ELL +LEH+LP FLLNA
Sbjct  547  AGGCLLSQRLRGQLVEAAKRLGGVILEEANQGKELLAVLEHHLPPFLLNA  596



>ref|XP_009797820.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009797821.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009797822.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
sylvestris]
Length=603

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDE-AVAPELRS  584
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDP ATYAVADSIA+S+D+ AV P L+S
Sbjct  428  LAALSIEILKAAGERSGGSLDGVAFLLHSDFLGDPVATYAVADSIAKSDDDDAVTPNLKS  487

Query  583  FLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVK  404
            FL EHWSEAA  +G RQG+EHYLNLVRI+   E PICL+DLP PLR+AIAYLPLYRE +K
Sbjct  488  FLQEHWSEAAFFDGLRQGQEHYLNLVRIVKWSECPICLKDLPGPLRVAIAYLPLYRESIK  547

Query  403  AGGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            AGGCLLSQRLRGQLVEAAKRL GV LE+A QG+ELL +LEH+LP FLLNA
Sbjct  548  AGGCLLSQRLRGQLVEAAKRLGGVILEEANQGKELLAVLEHHLPPFLLNA  597



>gb|AFK48259.1| unknown [Lotus japonicus]
Length=203

 Score =   258 bits (659),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A S+EILKAAGERS GSLDGVAFLL SDFLGDPAATYAVAD IA+SEDEAVAPEL++F
Sbjct  31   LGALSVEILKAAGERSGGSLDGVAFLLQSDFLGDPAATYAVADIIAKSEDEAVAPELKTF  90

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L +HWSE A +EG R G+EHY+NLVRI+  GESPICLRDLP+PL +AIAYLPLYRECVKA
Sbjct  91   LRDHWSEGAYMEGLRLGQEHYMNLVRIIKWGESPICLRDLPAPLTVAIAYLPLYRECVKA  150

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GGCL SQRLRGQLVEAA+RL     ++   GREL+  LE++LP FLL+
Sbjct  151  GGCLFSQRLRGQLVEAARRLGDRVFDEVTHGRELVVFLENHLPNFLLH  198



>gb|KDP29537.1| hypothetical protein JCGZ_19250 [Jatropha curcas]
Length=625

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDP ATYAVADSIARS+DEAVAPELR+F
Sbjct  453  LAALSIEILKAAGERSGGSLDGVAFLLRSDFLGDPVATYAVADSIARSDDEAVAPELRAF  512

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA ++G +QG+EHY+NL+ I+N G SP+C+RDLP PLR+AIAYLPLYRECV A
Sbjct  513  LREHWSEAAFLDGLKQGQEHYMNLMMILNWGSSPMCIRDLPGPLRVAIAYLPLYRECVAA  572

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            GGCL SQRLRGQLVEA +RL G +LE   QGRELL ILEH LP FL++A
Sbjct  573  GGCLFSQRLRGQLVEAVRRLGGGSLEGVSQGRELLAILEHYLPPFLVHA  621



>ref|XP_002533338.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29047.1| conserved hypothetical protein [Ricinus communis]
Length=626

 Score =   270 bits (689),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDPAATYAVADSIARS+DEAVAPELR+F
Sbjct  454  LAALSIEILKAAGERSGGSLDGVAFLLRSDFLGDPAATYAVADSIARSDDEAVAPELRAF  513

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA ++G +QG+ HY+NLVRI+  G SP+CLRDLP PLR+AIAYLPLYRECV A
Sbjct  514  LREHWSEAAFLDGLKQGQVHYMNLVRILKWGGSPMCLRDLPGPLRVAIAYLPLYRECVAA  573

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            GGCL SQRLRGQLVE  +RL G +LE   QGRELL ILEH+LP FL+++
Sbjct  574  GGCLFSQRLRGQLVEGVRRLGGGSLEGVSQGRELLAILEHHLPPFLVHS  622



>ref|XP_010313979.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010313980.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Solanum 
lycopersicum]
Length=632

 Score =   269 bits (687),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 149/170 (88%), Gaps = 1/170 (1%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERSSGSLDGVAFLL SDFL DP ATYAVADSIA+S+D+AV P LRSF
Sbjct  458  LAALSIEILKAAGERSSGSLDGVAFLLHSDFLSDPVATYAVADSIAKSDDDAVPPGLRSF  517

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  +G RQG++HYLN V+I+N GESPICL+DLP PLR+AIAYLPLYRE VKA
Sbjct  518  LREHWSEAAFSDGLRQGQQHYLNFVQIVNYGESPICLKDLPGPLRVAIAYLPLYRESVKA  577

Query  400  G-GCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            G  CLLSQRLRGQLVEAAKRL GV LE+A QG+EL+ +LEH+LP FLLNA
Sbjct  578  GRCCLLSQRLRGQLVEAAKRLGGVVLEEANQGKELVAVLEHHLPPFLLNA  627



>ref|XP_004251971.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X2 [Solanum 
lycopersicum]
Length=631

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 149/170 (88%), Gaps = 1/170 (1%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERSSGSLDGVAFLL SDFL DP ATYAVADSIA+S+D+AV P LRSF
Sbjct  457  LAALSIEILKAAGERSSGSLDGVAFLLHSDFLSDPVATYAVADSIAKSDDDAVPPGLRSF  516

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  +G RQG++HYLN V+I+N GESPICL+DLP PLR+AIAYLPLYRE VKA
Sbjct  517  LREHWSEAAFSDGLRQGQQHYLNFVQIVNYGESPICLKDLPGPLRVAIAYLPLYRESVKA  576

Query  400  G-GCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            G  CLLSQRLRGQLVEAAKRL GV LE+A QG+EL+ +LEH+LP FLLNA
Sbjct  577  GRCCLLSQRLRGQLVEAAKRLGGVVLEEANQGKELVAVLEHHLPPFLLNA  626



>emb|CDP19146.1| unnamed protein product [Coffea canephora]
Length=603

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA S EILKAA ERS GSLDGVAFLL SDFLGDP ATY VAD+IA S DE+VAPELR+F
Sbjct  431  LAALSTEILKAAAERSGGSLDGVAFLLRSDFLGDPTATYTVADTIANSNDESVAPELRAF  490

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA + G RQG EH++NLVRI+  GESPICLRDLP PLR+AIAYLPLYREC+KA
Sbjct  491  LQEHWSEAAFLGGLRQGREHHMNLVRIIKWGESPICLRDLPGPLRVAIAYLPLYRECLKA  550

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            GG LLSQRLRGQLVEA +RL GV LE+ARQGR+LL +LEH+LP FL+ A
Sbjct  551  GGSLLSQRLRGQLVEAVRRLGGVELEEARQGRQLLSVLEHHLPPFLVTA  599



>ref|XP_009618034.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X2 [Nicotiana 
tomentosiformis]
Length=600

 Score =   266 bits (681),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 147/171 (86%), Gaps = 2/171 (1%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDE--AVAPELR  587
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDP ATYAVADSIA+S+D+  AV P L+
Sbjct  427  LAALSIEILKAAGERSGGSLDGVAFLLRSDFLGDPVATYAVADSIAKSDDDDDAVTPNLK  486

Query  586  SFLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECV  407
            SFL EHWSEAA  +G RQG+EHYLNLVRI+  GESPICL+DLP PLR+AIAYLPLYRE V
Sbjct  487  SFLQEHWSEAAFFDGLRQGQEHYLNLVRIVKWGESPICLKDLPGPLRVAIAYLPLYRESV  546

Query  406  KAGGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            KAGG LL Q+LRGQLVEAAKRL GV LE+A QG+ELL +LEH+LP FLLN 
Sbjct  547  KAGGYLLPQKLRGQLVEAAKRLGGVILEEANQGKELLAVLEHHLPPFLLNG  597



>ref|XP_009618028.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618029.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618030.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618031.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618033.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
tomentosiformis]
Length=601

 Score =   266 bits (681),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 147/171 (86%), Gaps = 2/171 (1%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDE--AVAPELR  587
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDP ATYAVADSIA+S+D+  AV P L+
Sbjct  428  LAALSIEILKAAGERSGGSLDGVAFLLRSDFLGDPVATYAVADSIAKSDDDDDAVTPNLK  487

Query  586  SFLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECV  407
            SFL EHWSEAA  +G RQG+EHYLNLVRI+  GESPICL+DLP PLR+AIAYLPLYRE V
Sbjct  488  SFLQEHWSEAAFFDGLRQGQEHYLNLVRIVKWGESPICLKDLPGPLRVAIAYLPLYRESV  547

Query  406  KAGGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            KAGG LL Q+LRGQLVEAAKRL GV LE+A QG+ELL +LEH+LP FLLN 
Sbjct  548  KAGGYLLPQKLRGQLVEAAKRLGGVILEEANQGKELLAVLEHHLPPFLLNG  598



>emb|CAN70678.1| hypothetical protein VITISV_044152 [Vitis vinifera]
Length=581

 Score =   265 bits (677),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDPAATYAVADSIARS+DEAVAPELR+F
Sbjct  409  LAALSIEILKAAGERSGGSLDGVAFLLRSDFLGDPAATYAVADSIARSDDEAVAPELRAF  468

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L ++WSEAA ++G R+G+EHY+N++RI+  GESPICLRDLP PL +AIAYLPLYRECV+A
Sbjct  469  LRQNWSEAAFLDGLREGQEHYMNILRILKWGESPICLRDLPGPLLVAIAYLPLYRECVEA  528

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
             GCLLSQRLRGQLVEA +RL    LE+ +QGRELL IL+H+LP FLL+
Sbjct  529  SGCLLSQRLRGQLVEAVRRLGSGPLEEVKQGRELLAILKHHLPPFLLS  576



>ref|XP_010650761.1| PREDICTED: ankyrin repeat protein SKIP35-like [Vitis vinifera]
 ref|XP_010650762.1| PREDICTED: ankyrin repeat protein SKIP35-like [Vitis vinifera]
Length=626

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDPAATYAVADSIARS+DEAVAPELR+F
Sbjct  454  LAALSIEILKAAGERSGGSLDGVAFLLRSDFLGDPAATYAVADSIARSDDEAVAPELRAF  513

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L ++WSEAA ++G R+G+EHY+N++RI+  GESPICLRDLP PL +AIAYLPLYRECV+A
Sbjct  514  LRQNWSEAAFLDGLREGQEHYMNILRILKWGESPICLRDLPGPLLVAIAYLPLYRECVEA  573

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
             GCLLSQRLRGQLVEA +RL    LE+ +QGRELL IL+H+LP FLL+
Sbjct  574  SGCLLSQRLRGQLVEAVRRLGSGPLEEVKQGRELLAILKHHLPPFLLS  621



>ref|XP_002309709.2| hypothetical protein POPTR_0007s00280g [Populus trichocarpa]
 gb|EEE90159.2| hypothetical protein POPTR_0007s00280g [Populus trichocarpa]
Length=625

 Score =   265 bits (677),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDP ATYAVADSIARS+DE+VAPELR+F
Sbjct  453  LAALSIEILKAAGERSGGSLDGVAFLLCSDFLGDPTATYAVADSIARSDDESVAPELRAF  512

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA ++G +QG+EHY+NLVRI+N G SPI LRDLP PLR+A+AYLPL+RECV  
Sbjct  513  LREHWSEAAYLDGLKQGQEHYMNLVRILNWGGSPISLRDLPGPLRVAVAYLPLFRECVAT  572

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            GGCLLSQ+ RGQLVEA ++L G +LED  QG+ELL +LEH LP FL++ 
Sbjct  573  GGCLLSQKQRGQLVEAVRKLGGGSLEDVSQGKELLAVLEHYLPPFLVHT  621



>ref|XP_011005246.1| PREDICTED: ankyrin repeat protein SKIP35-like [Populus euphratica]
Length=625

 Score =   264 bits (675),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDP ATYAVADSIARS+DE+VAPELR+F
Sbjct  453  LAALSIEILKAAGERSGGSLDGVAFLLRSDFLGDPTATYAVADSIARSDDESVAPELRAF  512

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA ++G +QG+EHY+NLVRI+N G SPI LRDLP PLR+A+AYLPL+RECV  
Sbjct  513  LREHWSEAAYLDGLKQGQEHYMNLVRILNWGGSPISLRDLPGPLRVAVAYLPLFRECVAT  572

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            GGCLLSQ+ RGQLVEA ++L G +LED  QG+ELL +LEH LP FL++ 
Sbjct  573  GGCLLSQKQRGQLVEAVRKLGGGSLEDVSQGKELLAVLEHYLPPFLVHT  621



>ref|XP_008243090.1| PREDICTED: ankyrin repeat protein SKIP35-like [Prunus mume]
Length=626

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDPAATYAVADSIARS+DE VAPEL++F
Sbjct  454  LAALSIEILKAAGERSGGSLDGVAFLLHSDFLGDPAATYAVADSIARSDDEGVAPELKAF  513

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSE A + G RQG+EHYL+LVRI+  G SPICLRDLP+PLR+ IAYLPLYRECVKA
Sbjct  514  LREHWSEEAFLRGIRQGQEHYLSLVRILKWGGSPICLRDLPAPLRVTIAYLPLYRECVKA  573

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            GGCLLSQ+LRGQ+VEA  RL G  LE   Q  ELL +LEH+LP FLL++
Sbjct  574  GGCLLSQKLRGQVVEAVSRLGGGVLEGVSQCGELLAVLEHHLPPFLLHS  622



>ref|XP_006441987.1| hypothetical protein CICLE_v10019310mg [Citrus clementina]
 ref|XP_006441988.1| hypothetical protein CICLE_v10019310mg [Citrus clementina]
 gb|ESR55227.1| hypothetical protein CICLE_v10019310mg [Citrus clementina]
 gb|ESR55228.1| hypothetical protein CICLE_v10019310mg [Citrus clementina]
Length=626

 Score =   261 bits (668),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDPAATYAVADSIARS+DE VAP+L+ F
Sbjct  454  LAALSIEILKAAGERSGGSLDGVAFLLHSDFLGDPAATYAVADSIARSDDEGVAPDLKVF  513

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA ++G +QG+ HY+NL+RI+  GESPICLRDLP PLR+AI YLPLYRECVKA
Sbjct  514  LREHWSEAAFLDGLKQGDVHYMNLLRILKWGESPICLRDLPGPLRVAITYLPLYRECVKA  573

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GG LLSQRLRGQLVEA +RL G  L++   GR+LL ILEH+LP FL+ 
Sbjct  574  GGHLLSQRLRGQLVEAVRRLGGGVLQEVSHGRQLLAILEHHLPPFLVQ  621



>ref|XP_006478490.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like [Citrus sinensis]
Length=626

 Score =   261 bits (668),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDPAATYAVADSIARS+DE VAP+L+ F
Sbjct  454  LAALSIEILKAAGERSGGSLDGVAFLLHSDFLGDPAATYAVADSIARSDDEGVAPDLKVF  513

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA ++G +QG+ HY+NL+RI+  GESPICLRDLP PLR+AI YLPLYRECVKA
Sbjct  514  LREHWSEAAFLDGLKQGDVHYMNLLRILKWGESPICLRDLPGPLRVAITYLPLYRECVKA  573

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GG LLSQRLRGQLVEA +RL G  LE+   G++LL ILEH+LP FL+ 
Sbjct  574  GGHLLSQRLRGQLVEAVRRLGGGVLEEVSHGKQLLAILEHHLPPFLVQ  621



>gb|KHN22618.1| F-box/ankyrin repeat protein SKIP35 [Glycine soja]
Length=605

 Score =   260 bits (665),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA S+EILKAAGERS GSLDGVAFLL SDFLGDPAATYAVAD IA+SEDEAVAPEL++F
Sbjct  433  LAALSVEILKAAGERSGGSLDGVAFLLQSDFLGDPAATYAVADIIAKSEDEAVAPELKTF  492

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSE A  EG R G+EHY+NLVRI+  GESPICLRDLP+PL +AIAYLPLYRECVK 
Sbjct  493  LKEHWSEGAYKEGLRLGQEHYMNLVRIIKWGESPICLRDLPAPLTVAIAYLPLYRECVKT  552

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GGCL SQRLRGQLVEAA+R+    L++   GREL+ +LE +LP FLL+
Sbjct  553  GGCLFSQRLRGQLVEAARRVGNRVLDEVTHGRELVVVLEQHLPHFLLH  600



>ref|XP_006584140.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X1 
[Glycine max]
 ref|XP_006584141.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X2 
[Glycine max]
Length=605

 Score =   260 bits (665),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA S+EILKAAGERS GSLDGVAFLL SDFLGDPAATYAVAD IA+SEDEAVAPEL++F
Sbjct  433  LAALSVEILKAAGERSGGSLDGVAFLLQSDFLGDPAATYAVADIIAKSEDEAVAPELKTF  492

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSE A  EG R G+EHY+NLVRI+  GESPICLRDLP+PL +AIAYLPLYRECVK 
Sbjct  493  LKEHWSEGAYKEGLRLGQEHYMNLVRIIKWGESPICLRDLPAPLTVAIAYLPLYRECVKT  552

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GGCL SQRLRGQLVEAA+R+    L++   GREL+ +LE +LP FLL+
Sbjct  553  GGCLFSQRLRGQLVEAARRVGNRVLDEVTHGRELVVVLEQHLPHFLLH  600



>ref|XP_007026463.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao]
 gb|EOY06965.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao]
Length=620

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A SIEILKAAGERS GSLDGVAFLL SDFLGD AATYAVADSIARS+DEAVAPEL++F
Sbjct  448  LTALSIEILKAAGERSGGSLDGVAFLLHSDFLGDAAATYAVADSIARSDDEAVAPELKAF  507

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA ++G +QG+E Y+NL+RI+  GESPICLRDLP+PLR+AI YLPLYREC++ 
Sbjct  508  LQEHWSEAAFLDGLKQGQEQYMNLMRILKRGESPICLRDLPAPLRVAITYLPLYRECIEV  567

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            GG LLSQRLRGQLVEA + L G  LE+  QGRELL ILEH+LP FL+ A
Sbjct  568  GGRLLSQRLRGQLVEAVQMLGGGALEEVSQGRELLAILEHHLPPFLVRA  616



>ref|XP_011074019.1| PREDICTED: ankyrin repeat protein SKIP35-like [Sesamum indicum]
 ref|XP_011074020.1| PREDICTED: ankyrin repeat protein SKIP35-like [Sesamum indicum]
 ref|XP_011074021.1| PREDICTED: ankyrin repeat protein SKIP35-like [Sesamum indicum]
Length=640

 Score =   259 bits (663),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSL+GVAFLL SDFLGDPAATYAVADSIARS+DEAVAPEL+SF
Sbjct  470  LAALSIEILKAAGERSGGSLNGVAFLLHSDFLGDPAATYAVADSIARSDDEAVAPELKSF  529

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA ++G R+GE H+ NLVRI+  G SPICLRDLP+PLR+A+AYLPLYRECVKA
Sbjct  530  LREHWSEAAFLDGLREGEAHFSNLVRILKWGNSPICLRDLPAPLRVAVAYLPLYRECVKA  589

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLL  260
            GG LLSQR RGQLVEAA+RL G  L++  Q RELL +LEH+LP F +
Sbjct  590  GGRLLSQRHRGQLVEAARRLGGQVLDEPGQKRELLAVLEHHLPPFFI  636



>ref|XP_007203611.1| hypothetical protein PRUPE_ppa002867mg [Prunus persica]
 gb|EMJ04810.1| hypothetical protein PRUPE_ppa002867mg [Prunus persica]
Length=626

 Score =   259 bits (663),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDPAATYAVADSIARS+DEAVAPEL++F
Sbjct  454  LAALSIEILKAAGERSGGSLDGVAFLLHSDFLGDPAATYAVADSIARSDDEAVAPELKAF  513

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSE A + G R G+EHYL+LVRI+  G SPICLRDLP+PLR+ IAYLPLYRECVKA
Sbjct  514  LREHWSEEAFLRGIRLGQEHYLSLVRILKWGGSPICLRDLPAPLRVTIAYLPLYRECVKA  573

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            GGCLLSQ+LRG++VEA  RL G  LE   Q  ELL +LEH+LP FLL++
Sbjct  574  GGCLLSQKLRGKVVEAVSRLGGGVLEGVSQCGELLAVLEHHLPPFLLHS  622



>ref|XP_010251448.1| PREDICTED: ankyrin repeat protein SKIP35-like [Nelumbo nucifera]
 ref|XP_010251449.1| PREDICTED: ankyrin repeat protein SKIP35-like [Nelumbo nucifera]
Length=625

 Score =   259 bits (662),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLL S+FLGDPAATYAVADSIARSEDEAVAP+L++F
Sbjct  453  LAALSIEILKAAGERSGGSLDGVAFLLHSNFLGDPAATYAVADSIARSEDEAVAPDLKAF  512

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA ++G R  ++HY+N+ RI+  G SP+CLRDLP PL++AI YLPLYREC   
Sbjct  513  LQEHWSEAAFLDGLRHEQDHYVNVTRILKWGGSPLCLRDLPGPLKVAITYLPLYRECFAM  572

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            GGCL SQRLRGQLVEAA+RLSG  +++A QGRELL +LEH+LP FLL +
Sbjct  573  GGCLFSQRLRGQLVEAARRLSGRPVDEASQGRELLAVLEHHLPPFLLGS  621



>emb|CBI24769.3| unnamed protein product [Vitis vinifera]
Length=969

 Score =   265 bits (676),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDPAATYAVADSIARS+DEAVAPELR+F
Sbjct  797  LAALSIEILKAAGERSGGSLDGVAFLLRSDFLGDPAATYAVADSIARSDDEAVAPELRAF  856

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L ++WSEAA ++G R+G+EHY+N++RI+  GESPICLRDLP PL +AIAYLPLYRECV+A
Sbjct  857  LRQNWSEAAFLDGLREGQEHYMNILRILKWGESPICLRDLPGPLLVAIAYLPLYRECVEA  916

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
             GCLLSQRLRGQLVEA +RL    LE+ +QGRELL IL+H+LP FLL+ 
Sbjct  917  SGCLLSQRLRGQLVEAVRRLGSGPLEEVKQGRELLAILKHHLPPFLLSV  965



>gb|KJB11213.1| hypothetical protein B456_001G247600 [Gossypium raimondii]
 gb|KJB11214.1| hypothetical protein B456_001G247600 [Gossypium raimondii]
Length=620

 Score =   258 bits (660),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A SIEILKAAGERS GSLDGVAFLL SDFLGD AATYAVADSIA+S+DEAVAPELR+F
Sbjct  448  LTALSIEILKAAGERSGGSLDGVAFLLHSDFLGDAAATYAVADSIAKSDDEAVAPELRAF  507

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            + EHWSEAA ++G +QG+EHY+ L+RI+  GESPICLRDLP+PLR+ IAY+PLYRECV+ 
Sbjct  508  VQEHWSEAAFLDGLKQGQEHYMKLMRILKRGESPICLRDLPAPLRVGIAYMPLYRECVEV  567

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            GG LLSQRLRGQLVEA + L G +LE+  QGRELL  LEH+LP FL+ A
Sbjct  568  GGRLLSQRLRGQLVEAVRMLGGGSLEEVSQGRELLATLEHHLPPFLVRA  616



>gb|AJF94393.1| F-box/ankyrin repeat protein SKIP35 [Gossypium hirsutum]
Length=620

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A SIEILKAAGERS GSLDGVAFLL SDFLGD AATYAVADSIA+S+DEAVAPELR+F
Sbjct  448  LTAHSIEILKAAGERSGGSLDGVAFLLHSDFLGDAAATYAVADSIAKSDDEAVAPELRAF  507

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            + EHWSEAA ++G +QG+EHY+ L+RI+  GESPICLRDLP+PLR+ IAY+PLYRECV+ 
Sbjct  508  VQEHWSEAAFLDGLKQGQEHYMKLMRILKRGESPICLRDLPAPLRVGIAYIPLYRECVEV  567

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            GG LLSQRLRGQLVEA + L G +LE+  QGRELL  LEH+LP FL+ A
Sbjct  568  GGRLLSQRLRGQLVEAVRMLGGGSLEEVSQGRELLATLEHHLPPFLVRA  616



>ref|XP_010277855.1| PREDICTED: ankyrin repeat protein SKIP35 [Nelumbo nucifera]
 ref|XP_010277856.1| PREDICTED: ankyrin repeat protein SKIP35 [Nelumbo nucifera]
Length=626

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDPAATYAVAD+IARSEDEAVAP+L++F
Sbjct  454  LAALSIEILKAAGERSGGSLDGVAFLLRSDFLGDPAATYAVADNIARSEDEAVAPDLKAF  513

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA ++G R  ++HY+N++RI+N G SP+CLRDLP PL++AI YLPLYREC+KA
Sbjct  514  LREHWSEAAFLDGLRCEQDHYVNVMRILNWGGSPMCLRDLPGPLKVAITYLPLYRECLKA  573

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            GG L SQRLRGQL+EAA+RL G  +++A QGRELL +LEH+LP FLL A
Sbjct  574  GGRLFSQRLRGQLLEAARRLGGGPVDEASQGRELLAVLEHHLPPFLLAA  622



>ref|XP_004288739.1| PREDICTED: ankyrin repeat protein SKIP35-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011466463.1| PREDICTED: ankyrin repeat protein SKIP35-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011466484.1| PREDICTED: ankyrin repeat protein SKIP35-like [Fragaria vesca 
subsp. vesca]
Length=612

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LA  SIEILKAAGERS GSLDGVAFLL SDFLGDPAATYAVAD+IARS++E VA ELR+F
Sbjct  440  LATLSIEILKAAGERSGGSLDGVAFLLRSDFLGDPAATYAVADNIARSDEEGVAHELRAF  499

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSE A ++G+RQ +EHY+NLVRI+  G+SPICLRDLP+PLR  IAYLPLYRECVKA
Sbjct  500  LREHWSEEAFLDGRRQEQEHYMNLVRILKWGDSPICLRDLPAPLRTTIAYLPLYRECVKA  559

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GGCLLSQRLRGQL+EA + L G  LE   Q +ELL  LEH+LP+F L 
Sbjct  560  GGCLLSQRLRGQLIEAVRTLGGGILEGVSQCKELLAFLEHHLPSFFLQ  607



>gb|KHN27707.1| F-box/ankyrin repeat protein SKIP35 [Glycine soja]
Length=605

 Score =   256 bits (654),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA S+EILKAAGERS GSLDGVAFLL SDFLGDPAATYAVAD IA+SEDEAVAPEL++F
Sbjct  433  LAALSVEILKAAGERSGGSLDGVAFLLQSDFLGDPAATYAVADIIAKSEDEAVAPELKTF  492

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSE A  EG R G+EHY+NLVRI+  GESPICLRDLP+PL +AIAYLPLYRECVK 
Sbjct  493  LKEHWSEGAYKEGLRLGQEHYMNLVRIIRWGESPICLRDLPAPLTVAIAYLPLYRECVKT  552

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GG L SQRLRGQLVEAA+RL    L++   GREL+ +LE +LP FLL+
Sbjct  553  GGFLFSQRLRGQLVEAARRLGNRVLDEVIHGRELVVVLEQHLPHFLLH  600



>ref|XP_006600252.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X1 
[Glycine max]
 ref|XP_006600253.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X2 
[Glycine max]
 ref|XP_006600254.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X3 
[Glycine max]
 ref|XP_006600255.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X4 
[Glycine max]
Length=605

 Score =   256 bits (654),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA S+EILKAAGERS GSLDGVAFLL SDFLGDPAATYAVAD IA+SEDEAVAPEL++F
Sbjct  433  LAALSVEILKAAGERSGGSLDGVAFLLQSDFLGDPAATYAVADIIAKSEDEAVAPELKTF  492

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSE A  EG R G+EHY+NLVRI+  GESPICLRDLP+PL +AIAYLPLYRECVK 
Sbjct  493  LKEHWSEGAYKEGLRLGQEHYMNLVRIIRWGESPICLRDLPAPLTVAIAYLPLYRECVKT  552

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GG L SQRLRGQLVEAA+RL    L++   GREL+ +LE +LP FLL+
Sbjct  553  GGFLFSQRLRGQLVEAARRLGNRVLDEVIHGRELVVVLEQHLPHFLLH  600



>gb|KEH32772.1| F-box/ankyrin repeat SKIP35-like protein [Medicago truncatula]
Length=600

 Score =   256 bits (653),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA S+EILKAAGERS GSL+GV+FLL SDFLGDPAATYAVAD IA+ EDEAVAPEL++F
Sbjct  428  LAALSVEILKAAGERSGGSLEGVSFLLQSDFLGDPAATYAVADIIAKLEDEAVAPELKAF  487

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSE A IEG + G+EHY+NLVRI+  GESPICLRDLPSPL +AIAYLPLYRECVKA
Sbjct  488  LKEHWSEGAYIEGLKLGQEHYMNLVRIIERGESPICLRDLPSPLTVAIAYLPLYRECVKA  547

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLL  260
            GGCL SQRLRGQLVEAA+RL     ++    R+LL ILE +LP FLL
Sbjct  548  GGCLFSQRLRGQLVEAARRLGDRVFDEVTNARDLLVILERHLPQFLL  594



>ref|XP_007153901.1| hypothetical protein PHAVU_003G074400g [Phaseolus vulgaris]
 gb|ESW25895.1| hypothetical protein PHAVU_003G074400g [Phaseolus vulgaris]
Length=610

 Score =   256 bits (653),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA S+EILKAAGERS GSLDGVAFLL SDFLGDPAATYAVAD IA+SEDEAVAPEL++F
Sbjct  438  LAALSVEILKAAGERSGGSLDGVAFLLQSDFLGDPAATYAVADIIAKSEDEAVAPELKTF  497

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSE A  EG R G+EH++NL+RI+  GESPICLRDLP+PL +AIAYLPLYRECVKA
Sbjct  498  LKEHWSEGAYKEGLRLGQEHHMNLMRIIKWGESPICLRDLPAPLTVAIAYLPLYRECVKA  557

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GGCL SQRLRGQLVEAA+RL    L++   G EL+ +LE +LP FLL+
Sbjct  558  GGCLYSQRLRGQLVEAARRLGNRVLDEVSHGGELVVVLEQHLPHFLLH  605



>ref|XP_008394247.1| PREDICTED: ankyrin repeat protein SKIP35 [Malus domestica]
Length=620

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDP ATYAVA+SIA S+DE VAPEL++F
Sbjct  454  LAALSIEILKAAGERSGGSLDGVAFLLHSDFLGDPVATYAVANSIALSDDEGVAPELKAF  513

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L  HWS+ A ++G RQG++HY+N++RI+  GESPICLRDLP+PL IAI YLPLYRECV+A
Sbjct  514  LRVHWSQEAFLDGIRQGQDHYINILRILKWGESPICLRDLPTPLGIAIGYLPLYRECVRA  573

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFL  263
            GGCLLSQRLRGQLVEA  RL G  LE A Q +ELL +LEH+LP F 
Sbjct  574  GGCLLSQRLRGQLVEAVSRLGGGVLEGAGQCKELLAVLEHHLPPFF  619



>ref|XP_010930324.1| PREDICTED: ankyrin repeat protein SKIP35 [Elaeis guineensis]
 ref|XP_010930325.1| PREDICTED: ankyrin repeat protein SKIP35 [Elaeis guineensis]
Length=637

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 145/182 (80%), Gaps = 6/182 (3%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERSSGSLDGVAFLL S+FL DPAATYAVADSI+RS+DEAVAPEL++F
Sbjct  460  LAALSIEILKAAGERSSGSLDGVAFLLRSNFLSDPAATYAVADSISRSDDEAVAPELKAF  519

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  EG   G+EHY+N VRI+  G SPICLRDLP PL  AIAYLPLYRECVK+
Sbjct  520  LREHWSEAAFTEGMSSGQEHYVNFVRILRRGCSPICLRDLPPPLGTAIAYLPLYRECVKS  579

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA*IKLITPHTHT  221
            GG LL QRLRGQLVEAA RL    ++   QG+ELL +LEH+LP FL+       +P T +
Sbjct  580  GGQLLPQRLRGQLVEAASRLGNKPVDRVSQGKELLAVLEHHLPRFLIQ------SPSTLS  633

Query  220  MH  215
            MH
Sbjct  634  MH  635



>ref|XP_010672531.1| PREDICTED: ankyrin repeat protein SKIP35-like [Beta vulgaris 
subsp. vulgaris]
Length=622

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A SIEILKAAGERS GSL+GVAFLL SDFLGDP  TYAVADSIARS+D +VA ELR+F
Sbjct  450  LTALSIEILKAAGERSGGSLEGVAFLLRSDFLGDPVGTYAVADSIARSDDNSVASELRAF  509

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSE A  EG  QG+EH++N+ RI+N GESP+CLRDLPSPLR+AIAYLP+YREC+KA
Sbjct  510  LQEHWSEDAFTEGLLQGQEHFVNMFRILNRGESPLCLRDLPSPLRVAIAYLPVYRECMKA  569

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFL  263
            GGCLLSQ+LRGQLVEA +RL G  L D+ Q RELL +LEH+L  FL
Sbjct  570  GGCLLSQKLRGQLVEAVRRLGGGVLGDSSQCRELLAVLEHHLRPFL  615



>ref|XP_010067585.1| PREDICTED: ankyrin repeat protein SKIP35-like [Eucalyptus grandis]
 gb|KCW88000.1| hypothetical protein EUGRSUZ_A00409 [Eucalyptus grandis]
Length=627

 Score =   251 bits (641),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A S+EILKAAGERS GSLDGVAFLL SDFLGDP ATYAVADSIARSEDE++ P LR+F
Sbjct  455  LTALSVEILKAAGERSGGSLDGVAFLLRSDFLGDPVATYAVADSIARSEDESIDPVLRAF  514

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  +G RQG+ HY+N +RI+  GESP+CL D+P PLR AIAYLPLYREC  A
Sbjct  515  LQEHWSEAAFFDGLRQGQMHYMNFMRILKRGESPLCLMDIPGPLRAAIAYLPLYRECTDA  574

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLL  260
            GGCLLSQRLRGQLVEA +RL    LE  R  RELL ILEH+LP FLL
Sbjct  575  GGCLLSQRLRGQLVEAVRRLENAALEPVRPCRELLSILEHHLPRFLL  621



>gb|KHG16914.1| F-box/ankyrin repeat SKIP35 -like protein [Gossypium arboreum]
Length=620

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A SIEILKAAGERS GSLDGVAFLL SDFLGD AATYAVADSIA+S+DEAVAPELR+F
Sbjct  448  LTALSIEILKAAGERSGGSLDGVAFLLHSDFLGDAAATYAVADSIAKSDDEAVAPELRAF  507

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            + EHWSEAA ++G +QG++HY+ L+RI+  GESPICLRDLP+PLR+ IAY+PLYRECV+ 
Sbjct  508  VQEHWSEAAFLDGLKQGQQHYMKLMRILKRGESPICLRDLPAPLRVGIAYMPLYRECVEV  567

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLL  260
            GG LLSQRLRGQLVEA + L G +LE+  Q  ELL  LEH+LP FL+
Sbjct  568  GGRLLSQRLRGQLVEAVRMLGGGSLEEVSQAGELLATLEHHLPPFLV  614



>ref|XP_008801302.1| PREDICTED: ankyrin repeat protein SKIP35 [Phoenix dactylifera]
Length=637

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERSSGSLDGVAFLL SDFL DPAATY+VADSI+RS DEAVAPEL++F
Sbjct  460  LAALSIEILKAAGERSSGSLDGVAFLLRSDFLSDPAATYSVADSISRSNDEAVAPELKAF  519

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  EG   G+EHY+N +RI+  G SPICLRDLPSPL  AIAYLPLYRECV+A
Sbjct  520  LREHWSEAAFSEGMSSGQEHYVNFMRILRRGCSPICLRDLPSPLATAIAYLPLYRECVQA  579

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA*IKLITP  233
            GG LL QRLRGQLVEAA RL    ++   QG+ELL +LEH+LP FL+ +   L  P
Sbjct  580  GGQLLPQRLRGQLVEAASRLGNRPVDRGSQGKELLAVLEHHLPRFLIQSPSTLSMP  635



>ref|XP_008445478.1| PREDICTED: ankyrin repeat protein SKIP35-like [Cucumis melo]
 ref|XP_008445479.1| PREDICTED: ankyrin repeat protein SKIP35-like [Cucumis melo]
Length=623

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERSSGSLDGV FLL S+FLGD +ATYAVADSI++S DE+VAPELR+F
Sbjct  451  LAALSIEILKAAGERSSGSLDGVEFLLHSNFLGDLSATYAVADSISKSSDESVAPELRAF  510

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA ++G +QG+E+YLN VRI+  G SPI LRD+P+PLR+AIAYLPLYREC+K 
Sbjct  511  LREHWSEAAYVDGLKQGQENYLNFVRILRWGGSPISLRDIPAPLRVAIAYLPLYRECIKV  570

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
             G L SQ+LRGQLVEAA+RL G  LE+   GRELL +LEH+LP FLL+
Sbjct  571  NGYLFSQKLRGQLVEAARRLGGGVLEEVSNGRELLAVLEHHLPPFLLH  618



>ref|XP_010087440.1| hypothetical protein L484_019643 [Morus notabilis]
 gb|EXB29121.1| hypothetical protein L484_019643 [Morus notabilis]
Length=611

 Score =   249 bits (635),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L   SIEIL+AAGERS+GSLDGVAFLL SDFLGDPAATYAVAD I+RSED AVAPEL+SF
Sbjct  439  LQTLSIEILRAAGERSAGSLDGVAFLLRSDFLGDPAATYAVADIISRSEDGAVAPELKSF  498

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA ++G RQG+EHY+N++RI+  G SPI LRDLP+PLR+ IAYLPLYRECV+A
Sbjct  499  LQEHWSEAAFLDGLRQGQEHYMNIMRILKWGGSPISLRDLPAPLRVTIAYLPLYRECVEA  558

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GG LLSQRLRG+LVEA  RL G  L++  Q  ELL +LEH+LP FLL+
Sbjct  559  GGPLLSQRLRGKLVEAVTRLDGAVLKEVGQSSELLAVLEHHLPPFLLH  606



>ref|XP_004144185.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like [Cucumis 
sativus]
 ref|XP_004158248.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like [Cucumis 
sativus]
 gb|KGN47633.1| hypothetical protein Csa_6G366310 [Cucumis sativus]
Length=623

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERSSGSLDGV FLL S+FLGD +ATYAVADSI++S DE+VAPELR+F
Sbjct  451  LAALSIEILKAAGERSSGSLDGVEFLLHSNFLGDVSATYAVADSISKSSDESVAPELRAF  510

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA ++G +QG+E+YLN VRI+  G  PI LRD+P+PLR+AIAYLPLYREC+K 
Sbjct  511  LREHWSEAAYVDGLKQGQENYLNFVRILRWGGFPISLRDIPAPLRVAIAYLPLYRECIKV  570

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
             G L SQ+LRGQLVEAA+RL G  LE+   GRELL +LEH+LP FLL+
Sbjct  571  NGYLFSQKLRGQLVEAARRLGGGVLEEVSNGRELLAVLEHHLPPFLLH  618



>gb|EYU22360.1| hypothetical protein MIMGU_mgv1a017835mg [Erythranthe guttata]
Length=645

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERSSGSLDGV+FLL SDFL DPAATYAVADSIA S+DEA+AP+LR+F
Sbjct  474  LAALSIEILKAAGERSSGSLDGVSFLLRSDFLADPAATYAVADSIATSDDEAIAPQLRAF  533

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSE A +EG R+GE H+ N+V IM  GESPICL DLP PLR+A+AYLPLYRECVKA
Sbjct  534  LREHWSEEAFLEGVREGEVHFRNIVEIMKWGESPICLGDLPGPLRVAVAYLPLYRECVKA  593

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GG LLSQR RGQL+EA++RL G  L+   Q  EL+ +LEHNLP F L+
Sbjct  594  GGRLLSQRHRGQLLEASRRLGGGVLDGPGQKGELMAVLEHNLPPFFLD  641



>ref|XP_004499381.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like [Cicer arietinum]
Length=611

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA S+EILKAAGERS GSLDGVAFLL SDFLGDPAATYAVAD IA+ EDEAVAPEL++F
Sbjct  438  LAALSVEILKAAGERSGGSLDGVAFLLESDFLGDPAATYAVADIIAKLEDEAVAPELKAF  497

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSE A IEG R G+EHY NLVRI+  G+SPICLRDLP+PL +AIAYLPLYRECVKA
Sbjct  498  LKEHWSEGAYIEGLRLGQEHYTNLVRIIKGGDSPICLRDLPAPLTVAIAYLPLYRECVKA  557

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLL  260
            GG L SQRLRGQ+VEAA+RL     ++   G +LL ILE +LP FLL
Sbjct  558  GGRLFSQRLRGQMVEAARRLGERVFDEVTYGGDLLVILERHLPHFLL  604



>ref|XP_011085079.1| PREDICTED: ankyrin repeat protein SKIP35-like [Sesamum indicum]
 ref|XP_011085080.1| PREDICTED: ankyrin repeat protein SKIP35-like [Sesamum indicum]
Length=645

 Score =   246 bits (629),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERSS SL+GV+ LL SDFL DPAATY+VADSIARS DEAVAPEL++F
Sbjct  473  LAALSIEILKAAGERSSRSLEGVSLLLRSDFLRDPAATYSVADSIARSNDEAVAPELKAF  532

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA ++G RQGE H+ NLV+I+   +SPICL+DLP PLR+AIAYLPLYREC++A
Sbjct  533  LQEHWSEAAFLDGLRQGEAHFSNLVQILRYSQSPICLQDLPGPLRVAIAYLPLYRECIEA  592

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFL  263
            GG LLSQR RGQLVEAA+RL GV L+   Q RELL +LEH+LP FL
Sbjct  593  GGSLLSQRHRGQLVEAARRLGGVVLDKPNQRRELLAVLEHHLPPFL  638



>ref|XP_008389252.1| PREDICTED: ankyrin repeat protein SKIP35 [Malus domestica]
Length=467

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDPAATYAVA+SIA S+DE VAPEL++F
Sbjct  301  LAALSIEILKAAGERSGGSLDGVAFLLHSDFLGDPAATYAVANSIALSDDEGVAPELKAF  360

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L  HWSE A ++G RQG+EHY+N+VRI+  GESPICLRDLP+PL IAI YLPLYRECV+A
Sbjct  361  LWGHWSEEAFLDGIRQGQEHYMNIVRILKWGESPICLRDLPTPLGIAIGYLPLYRECVRA  420

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFL  263
            GGCLLSQRLRGQLVEA +RL G  LE A Q +ELL +LEH+LP F 
Sbjct  421  GGCLLSQRLRGQLVEAVRRLGGGVLEGASQCKELLALLEHHLPPFF  466



>ref|XP_008354473.1| PREDICTED: ankyrin repeat protein SKIP35-like [Malus domestica]
Length=467

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDPAATYAVA+SIA S+DE VAPEL++F
Sbjct  301  LAALSIEILKAAGERSGGSLDGVAFLLHSDFLGDPAATYAVANSIALSDDEGVAPELKAF  360

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L  HWSE A ++G RQG+EHY+N+VRI+  GESPICLRDLP+PL IAI YLPLYRECV+A
Sbjct  361  LWGHWSEEAFLDGIRQGQEHYMNIVRILKWGESPICLRDLPTPLGIAIGYLPLYRECVRA  420

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFL  263
            GGCLLSQRLRGQLVEA +RL G  LE A Q +ELL +LEH+LP F 
Sbjct  421  GGCLLSQRLRGQLVEAVRRLGGGVLEGASQCKELLALLEHHLPPFF  466



>ref|XP_011004557.1| PREDICTED: ankyrin repeat protein SKIP35 [Populus euphratica]
Length=625

 Score =   243 bits (619),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDP ATYAVADSIARS+DE+VAPEL++F
Sbjct  453  LAALSIEILKAAGERSGGSLDGVAFLLHSDFLGDPTATYAVADSIARSDDESVAPELKAF  512

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L E+WSEAA ++G +QG+EHY+NLV I+N G SPI LR LP PLR+A+AYLPLYREC   
Sbjct  513  LRENWSEAAFLDGLKQGQEHYMNLVMILNWGRSPISLRHLPGPLRVAVAYLPLYRECAAT  572

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GG L SQR RG LVEA +RL G + ED  QG+ELL +LE  LP FL++
Sbjct  573  GGRLFSQRQRGLLVEAVRRLGGGSSEDVSQGKELLAVLERYLPQFLVH  620



>ref|XP_010912734.1| PREDICTED: ankyrin repeat protein SKIP35-like [Elaeis guineensis]
Length=635

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERSSGSLDGVAFLL SDFL DPAATYAVADSIARS+DEAVAPEL++F
Sbjct  460  LAALSIEILKAAGERSSGSLDGVAFLLRSDFLSDPAATYAVADSIARSDDEAVAPELKAF  519

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L E+WSEAA  EG   G+EHY+N +RI+  G SPICLRDLP PL IA+AYLPLYREC KA
Sbjct  520  LKENWSEAAFSEGISSGQEHYVNFMRILRRGCSPICLRDLPLPLVIAVAYLPLYRECAKA  579

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            GG LL QRLRGQLVEAA RL    ++    G+ELL +LEH+LP FL+ +
Sbjct  580  GGWLLPQRLRGQLVEAASRLGNGPVDRCCPGKELLAVLEHHLPPFLIQS  628



>gb|EYU36630.1| hypothetical protein MIMGU_mgv1a002704mg [Erythranthe guttata]
Length=645

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERSSGSLDGV+FLL SDFL DPAATYAVADSIA S+DEA+AP+LR+F
Sbjct  474  LAALSIEILKAAGERSSGSLDGVSFLLRSDFLADPAATYAVADSIATSDDEAIAPQLRAF  533

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSE A +EG R+GE H+ N+V IM  GESPICL DLP PLR+A+AYLPLYRECVKA
Sbjct  534  LREHWSEEAFLEGVREGEVHFRNIVEIMKWGESPICLGDLPGPLRVAVAYLPLYRECVKA  593

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GG LLSQR RGQL+EA++RL G  L+   Q  EL+ +LEHNLP F L+
Sbjct  594  GGRLLSQRHRGQLLEASRRLGGGDLDGPGQKGELMAVLEHNLPPFFLD  641



>ref|XP_006372306.1| hypothetical protein POPTR_0017s00410g [Populus trichocarpa]
 ref|XP_006372307.1| hypothetical protein POPTR_0017s00410g [Populus trichocarpa]
 gb|ERP50103.1| hypothetical protein POPTR_0017s00410g [Populus trichocarpa]
 gb|ERP50104.1| hypothetical protein POPTR_0017s00410g [Populus trichocarpa]
Length=625

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDP ATYAVADSIARS+DE+VAPEL++F
Sbjct  453  LAALSIEILKAAGERSGGSLDGVAFLLHSDFLGDPTATYAVADSIARSDDESVAPELKAF  512

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L E+WSEAA ++G +QG+EHY+NLV I+N G SPI LR LP PLR+A+AYLPLYREC   
Sbjct  513  LRENWSEAAFLDGLKQGQEHYMNLVMILNWGRSPISLRHLPGPLRVAVAYLPLYRECAAT  572

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
             G L SQ+ RG LVEA ++L G + ED  QG+ELL +LEH LP FL++
Sbjct  573  AGRLFSQKQRGLLVEAVRKLGGGSSEDVSQGKELLAVLEHYLPQFLVH  620



>gb|KDO49748.1| hypothetical protein CISIN_1g006847mg [Citrus sinensis]
Length=629

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDPAATYAVADSIARS+DE VAP+L+ F
Sbjct  454  LAALSIEILKAAGERSGGSLDGVAFLLHSDFLGDPAATYAVADSIARSDDEGVAPDLKVF  513

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA ++G +QG+ HY+NL+RI+  GESPICLRDLP PLR+AI YLPLYRECVKA
Sbjct  514  LREHWSEAAFLDGLKQGDVHYMNLLRILKWGESPICLRDLPGPLRVAITYLPLYRECVKA  573

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGR  305
            GG LLSQRLRGQLVEA +RL G  LE+   G 
Sbjct  574  GGHLLSQRLRGQLVEAVRRLGGGVLEEVSHGN  605



>ref|XP_009390785.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009390786.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
Length=627

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERSSGSLDGV FLL SDFLGDPAATYAVADS+ARS DE+VA +LR+F
Sbjct  450  LAALSIEILKAAGERSSGSLDGVVFLLRSDFLGDPAATYAVADSMARSSDESVASDLRAF  509

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  EG R G++H++N++RI   G SPI L+DLP PL  AIAYLPLYREC++A
Sbjct  510  LKEHWSEAAFAEGLRFGQDHFVNIMRIFRRGSSPIHLKDLPQPLVTAIAYLPLYRECLEA  569

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            GG LL Q+LRGQLVEAA R+SG  +    Q REL+ ILEH+LPTF L A
Sbjct  570  GGQLLPQKLRGQLVEAAHRVSGRPVSKNSQTRELMAILEHHLPTFFLQA  618



>ref|XP_009379908.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009379909.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
Length=627

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIE+LKAAGERSSGSLDGVAFLL ++FLGDPAATYAVADSIARS DEAVAP LR+F
Sbjct  451  LAALSIEVLKAAGERSSGSLDGVAFLLRNNFLGDPAATYAVADSIARSSDEAVAPNLRAF  510

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  EG   G+ HY+N +RI+  G SPICL+DLP PL  AIAYLPLYREC + 
Sbjct  511  LKEHWSEAAYAEGLSYGQNHYVNFMRILRRGGSPICLKDLPPPLVTAIAYLPLYRECQEK  570

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GG LL Q+LRGQLVEAA R+ G  +E   Q RELL ILE +LPTF L 
Sbjct  571  GGQLLPQKLRGQLVEAASRVGGRPVEKNSQARELLAILEQHLPTFFLQ  618



>ref|XP_009366266.1| PREDICTED: ankyrin repeat protein SKIP35-like [Pyrus x bretschneideri]
 ref|XP_009366267.1| PREDICTED: ankyrin repeat protein SKIP35-like [Pyrus x bretschneideri]
 ref|XP_009366268.1| PREDICTED: ankyrin repeat protein SKIP35-like [Pyrus x bretschneideri]
Length=619

 Score =   238 bits (606),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLL S+F+GDPAATYAVA+SIA S+DE +APELR+F
Sbjct  453  LAALSIEILKAAGERSGGSLDGVAFLLHSNFMGDPAATYAVANSIALSDDEGIAPELRAF  512

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L  HWSE A ++G +QG+EHY+N+VRI+  GESPICLRDLP+PL IAI YLPLYRECV+A
Sbjct  513  LRGHWSEEAFLDGIKQGQEHYMNIVRILKWGESPICLRDLPTPLGIAIGYLPLYRECVRA  572

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFL  263
            GGCLLSQRLRGQLVEA +RL G  LE A Q +ELL +LEH+LP F 
Sbjct  573  GGCLLSQRLRGQLVEAVRRLGGGVLEGASQCKELLALLEHHLPPFF  618



>ref|XP_008781953.1| PREDICTED: ankyrin repeat protein SKIP35-like [Phoenix dactylifera]
Length=635

 Score =   238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERSSGSLDGVAFLL S+FL DPAATYAVADSIARS+DEAVAPEL++F
Sbjct  460  LAALSIEILKAAGERSSGSLDGVAFLLRSNFLSDPAATYAVADSIARSDDEAVAPELKAF  519

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  EG   G+EHY+N + I+  G SPI LRDLP PL IAIAYLPLYR+CVKA
Sbjct  520  LKEHWSEAAFSEGMSSGQEHYVNFMWILRRGCSPIRLRDLPLPLVIAIAYLPLYRDCVKA  579

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            GG LL QRLRGQLVEAA RL    +    QG+ELL +LEH+LP FL+ +
Sbjct  580  GGRLLPQRLRGQLVEAASRLGNRPVHIGCQGKELLAVLEHHLPPFLIQS  628



>ref|XP_009404918.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
Length=620

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDPAATYAVADSIARS DEAVAPELR+F
Sbjct  448  LAALSIEILKAAGERSRGSLDGVAFLLCSDFLGDPAATYAVADSIARSNDEAVAPELRAF  507

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L E WSEAA  EG   G++H++N +RI+  G SPICL DLP PL   IAY+PLYREC++A
Sbjct  508  LLEQWSEAAFAEGLSSGQDHFVNFMRILRRGCSPICLMDLPPPLAATIAYMPLYRECMEA  567

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GG LLSQ+LRGQLVEAA+R+ G  ++D  Q  ELL ILE NLP F L 
Sbjct  568  GGQLLSQKLRGQLVEAARRIGGRWVDDDSQANELLEILERNLPRFFLQ  615



>ref|XP_006397583.1| hypothetical protein EUTSA_v10001361mg [Eutrema salsugineum]
 gb|ESQ39036.1| hypothetical protein EUTSA_v10001361mg [Eutrema salsugineum]
Length=618

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 142/171 (83%), Gaps = 2/171 (1%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A SIEILKAAGERS GSL GV FLL SDFLGDPAATY+VAD+IA+SEDE+V  EL+SF
Sbjct  445  LTALSIEILKAAGERSGGSLYGVEFLLKSDFLGDPAATYSVADTIAKSEDESVPSELKSF  504

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  +G R+  E+++N +R++ +GES ICL+DLP+PLR+AIAY+PLYRECVKA
Sbjct  505  LQEHWSEAAFNQGLRESRENFMNFMRVLKIGESAICLKDLPAPLRVAIAYMPLYRECVKA  564

Query  400  GGCLLSQRLRGQLVEAAKRLSG--VTLEDARQGRELLGILEHNLPTFLLNA  254
            GG LLSQ+LRGQL+EAAK+L G  V  E+  +G +L+ +LEH+LP F++ A
Sbjct  565  GGRLLSQKLRGQLMEAAKQLQGFDVDTEEVYKGHQLMAVLEHHLPLFMVKA  615



>ref|XP_007026464.1| Ankyrin repeat family protein isoform 2 [Theobroma cacao]
 gb|EOY06966.1| Ankyrin repeat family protein isoform 2 [Theobroma cacao]
Length=597

 Score =   231 bits (590),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A SIEILKAAGERS GSLDGVAFLL SDFLGD AATYAVADSIARS+DEAVAPEL++F
Sbjct  448  LTALSIEILKAAGERSGGSLDGVAFLLHSDFLGDAAATYAVADSIARSDDEAVAPELKAF  507

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA ++G +QG+E Y+NL+RI+  GESPICLRDLP+PLR+AI YLPLYREC++ 
Sbjct  508  LQEHWSEAAFLDGLKQGQEQYMNLMRILKRGESPICLRDLPAPLRVAITYLPLYRECIEV  567

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLED  320
            GG LLSQRLRGQLVEA + L G  LE+
Sbjct  568  GGRLLSQRLRGQLVEAVQMLGGGALEE  594



>ref|XP_010524207.1| PREDICTED: ankyrin repeat protein SKIP35 [Tarenaya hassleriana]
Length=616

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 136/170 (80%), Gaps = 1/170 (1%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSL+GV FLL SDFLGDP ATY+VADSIARS+DE+V PEL+SF
Sbjct  445  LAALSIEILKAAGERSCGSLNGVEFLLKSDFLGDPTATYSVADSIARSDDESVPPELKSF  504

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  +G R+G+EH++NL+RI   GESPICL DLP+PLR+ I Y+ +YREC + 
Sbjct  505  LQEHWSEAAFDKGIREGQEHFVNLMRITERGESPICLSDLPAPLRVGIGYMSVYRECAET  564

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLE-DARQGRELLGILEHNLPTFLLNA  254
             G LLSQRLRGQLVEA ++L G  +E +A Q   LL ILE +LP FL+ A
Sbjct  565  RGVLLSQRLRGQLVEAVRQLQGFVVETEAGQCGHLLAILERHLPPFLVKA  614



>gb|AAX96769.1| expressed protein [Oryza sativa Japonica Group]
Length=589

 Score =   227 bits (578),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LA  S+EILKAAGERS+GSL GV FLL S+FL DPAATYAVAD+IA+S DEAV  +LRSF
Sbjct  421  LAPLSVEILKAAGERSTGSLHGVDFLLRSNFLNDPAATYAVADNIAKSADEAVDAKLRSF  480

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            + EHWSEAA  EG    +EH++N +RIM  GESPICLRDLP  L IA+AYLPLYRECV++
Sbjct  481  MLEHWSEAAFSEGFASAQEHFVNFMRIMEKGESPICLRDLPLELVIAMAYLPLYRECVES  540

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GG LL Q+LRGQLVEAA RL G  L+ A QG ELL ILEH+LP F++ 
Sbjct  541  GGRLLPQKLRGQLVEAAGRLEGRQLDRASQGTELLAILEHHLPCFMIQ  588



>ref|NP_001067610.1| Os11g0246900 [Oryza sativa Japonica Group]
 dbj|BAF27973.1| Os11g0246900, partial [Oryza sativa Japonica Group]
Length=576

 Score =   226 bits (576),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LA  S+EILKAAGERS+GSL GV FLL S+FL DPAATYAVAD+IA+S DEAV  +LRSF
Sbjct  408  LAPLSVEILKAAGERSTGSLHGVDFLLRSNFLNDPAATYAVADNIAKSADEAVDAKLRSF  467

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            + EHWSEAA  EG    +EH++N +RIM  GESPICLRDLP  L IA+AYLPLYRECV++
Sbjct  468  MLEHWSEAAFSEGFASAQEHFVNFMRIMEKGESPICLRDLPLELVIAMAYLPLYRECVES  527

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GG LL Q+LRGQLVEAA RL G  L+ A QG ELL ILEH+LP F++ 
Sbjct  528  GGRLLPQKLRGQLVEAAGRLEGRQLDRASQGTELLAILEHHLPCFMIQ  575



>gb|ABA92347.2| expressed protein [Oryza sativa Japonica Group]
Length=609

 Score =   227 bits (578),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LA  S+EILKAAGERS+GSL GV FLL S+FL DPAATYAVAD+IA+S DEAV  +LRSF
Sbjct  441  LAPLSVEILKAAGERSTGSLHGVDFLLRSNFLNDPAATYAVADNIAKSADEAVDAKLRSF  500

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            + EHWSEAA  EG    +EH++N +RIM  GESPICLRDLP  L IA+AYLPLYRECV++
Sbjct  501  MLEHWSEAAFSEGFASAQEHFVNFMRIMEKGESPICLRDLPLELVIAMAYLPLYRECVES  560

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GG LL Q+LRGQLVEAA RL G  L+ A QG ELL ILEH+LP F++ 
Sbjct  561  GGRLLPQKLRGQLVEAAGRLEGRQLDRASQGTELLAILEHHLPCFMIQ  608



>gb|EEC67953.1| hypothetical protein OsI_35687 [Oryza sativa Indica Group]
Length=609

 Score =   226 bits (577),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LA  S+EILKAAGERS+GSL GV FLL S+FL DPAATYAVAD+IA+S DEAV  +LRSF
Sbjct  441  LAPLSVEILKAAGERSTGSLHGVDFLLRSNFLNDPAATYAVADNIAKSADEAVDAKLRSF  500

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            + EHWSEAA  EG    +EH++N +RIM  GESPICLRDLP  L IA+AYLPLYRECV++
Sbjct  501  MLEHWSEAAFSEGFASAQEHFVNFMRIMEKGESPICLRDLPLELVIAMAYLPLYRECVES  560

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GG LL Q+LRGQLVEAA RL G  L+ A QG ELL ILEH+LP F++ 
Sbjct  561  GGRLLPQKLRGQLVEAAGRLEGRQLDRASQGTELLAILEHHLPCFMIQ  608



>gb|EEE51919.1| hypothetical protein OsJ_33524 [Oryza sativa Japonica Group]
Length=609

 Score =   226 bits (577),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LA  S+EILKAAGERS+GSL GV FLL S+FL DPAATYAVAD+IA+S DEAV  +LRSF
Sbjct  441  LAPLSVEILKAAGERSTGSLHGVDFLLRSNFLNDPAATYAVADNIAKSADEAVDAKLRSF  500

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            + EHWSEAA  EG    +EH++N +RIM  GESPICLRDLP  L IA+AYLPLYRECV++
Sbjct  501  MLEHWSEAAFSEGFASAQEHFVNFMRIMEKGESPICLRDLPLELVIAMAYLPLYRECVES  560

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GG LL Q+LRGQLVEAA RL G  L+ A QG ELL ILEH+LP F++ 
Sbjct  561  GGRLLPQKLRGQLVEAAGRLEGRQLDRASQGTELLAILEHHLPCFMIQ  608



>ref|XP_002881948.1| hypothetical protein ARALYDRAFT_483529 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58207.1| hypothetical protein ARALYDRAFT_483529 [Arabidopsis lyrata subsp. 
lyrata]
Length=547

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 138/172 (80%), Gaps = 3/172 (2%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A SIEILKAAGERS GSL GV FLL SDFLGDP ATY+VAD+IA+SEDE++  +L+SF
Sbjct  373  LTALSIEILKAAGERSGGSLHGVEFLLKSDFLGDPVATYSVADTIAKSEDESIPSDLKSF  432

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  +G R+  E+++N +R++ LGES I + DLP+PLR+AIAY+PLYRECV A
Sbjct  433  LQEHWSEAAFNQGLRESRENFMNFMRVLKLGESAISIMDLPAPLRVAIAYMPLYRECVNA  492

Query  400  GGCLLSQRLRGQLVEAAKRLSG--VTLEDARQG-RELLGILEHNLPTFLLNA  254
            GG LLSQ+LRGQLVEA K+L G  V  E+ ++G  +L+ +LEH+LP FL+ A
Sbjct  493  GGWLLSQKLRGQLVEAVKQLQGFDVETEEVKKGHHQLMAVLEHHLPLFLVKA  544



>ref|XP_010508343.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X2 [Camelina 
sativa]
Length=526

 Score =   223 bits (567),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 139/172 (81%), Gaps = 3/172 (2%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A SIEILKAAGERS GSL GV FLL SDFL DP ATY+VAD+IA+SEDE+V   L+SF
Sbjct  352  LTALSIEILKAAGERSGGSLYGVEFLLKSDFLRDPVATYSVADTIAKSEDESVPSHLKSF  411

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L +HWSEAA  +G R+ +E+++N +R++ LGES I L+DLP+PLR+AIAY+PLYRECVKA
Sbjct  412  LQKHWSEAAFNQGLRESQENFMNFMRVLKLGESAISLKDLPAPLRVAIAYMPLYRECVKA  471

Query  400  GGCLLSQRLRGQLVEAAKRLSG--VTLEDARQG-RELLGILEHNLPTFLLNA  254
            GG LLSQ LRGQLVEAAK+L G  V  E+ ++G  +L+ +LEH+LP FL+ A
Sbjct  472  GGRLLSQNLRGQLVEAAKQLQGFDVASEEVKKGHHQLMAVLEHHLPLFLVKA  523



>ref|NP_566008.1| Ankyrin repeat family protein [Arabidopsis thaliana]
 ref|NP_001031537.1| Ankyrin repeat family protein [Arabidopsis thaliana]
 gb|AAC23416.1| expressed protein [Arabidopsis thaliana]
 gb|AAM98104.1| At2g44090/F6E13.22 [Arabidopsis thaliana]
 dbj|BAH20169.1| AT2G44090 [Arabidopsis thaliana]
 gb|AEC10372.1| Ankyrin repeat family protein [Arabidopsis thaliana]
 gb|AEC10373.1| Ankyrin repeat family protein [Arabidopsis thaliana]
Length=582

 Score =   223 bits (569),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 139/172 (81%), Gaps = 3/172 (2%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A SIEILKAAGERS GSL GV FLL SDFLGDPAATY+VAD+IA+SEDE+V  +L+SF
Sbjct  408  LTALSIEILKAAGERSGGSLHGVEFLLKSDFLGDPAATYSVADTIAKSEDESVPSDLKSF  467

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L E WSEAA  +G ++  E+Y+N +R++ LGES I L+DLP+PLR+AIAY+PLYRECV A
Sbjct  468  LQEQWSEAAFNQGLKESRENYMNFMRVLKLGESAISLKDLPAPLRVAIAYMPLYRECVDA  527

Query  400  GGCLLSQRLRGQLVEAAKRLSG--VTLEDARQG-RELLGILEHNLPTFLLNA  254
            GG LLSQ+LRGQLVEAA +L G  V  E+ ++G  +L+ ILEH+LP FL+ A
Sbjct  528  GGRLLSQKLRGQLVEAATQLEGFDVDTEEVKKGHHQLMTILEHHLPLFLVKA  579



>gb|AAK82517.1| At2g44090/F6E13.22 [Arabidopsis thaliana]
Length=582

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 139/172 (81%), Gaps = 3/172 (2%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A SIEILKAAGERS GSL GV FLL SDFLGDPAATY+VAD+IA+SEDE+V  +L+SF
Sbjct  408  LTALSIEILKAAGERSGGSLHGVEFLLKSDFLGDPAATYSVADTIAKSEDESVPSDLKSF  467

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L E WSEAA  +G ++  E+Y+N +R++ LGES I L+DLP+PLR+AIAY+PLYRECV A
Sbjct  468  LQEQWSEAAFNQGLKESRENYMNFMRVLKLGESAISLKDLPAPLRVAIAYMPLYRECVDA  527

Query  400  GGCLLSQRLRGQLVEAAKRLSG--VTLEDARQG-RELLGILEHNLPTFLLNA  254
            GG LLSQ+LRGQLVEAA +L G  V  E+ ++G  +L+ IL+H+LP FL+ A
Sbjct  528  GGRLLSQKLRGQLVEAATQLEGFDVDTEEVKKGHHQLMTILDHDLPLFLVKA  579



>ref|XP_010508342.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Camelina 
sativa]
Length=578

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 139/172 (81%), Gaps = 3/172 (2%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A SIEILKAAGERS GSL GV FLL SDFL DP ATY+VAD+IA+SEDE+V   L+SF
Sbjct  404  LTALSIEILKAAGERSGGSLYGVEFLLKSDFLRDPVATYSVADTIAKSEDESVPSHLKSF  463

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L +HWSEAA  +G R+ +E+++N +R++ LGES I L+DLP+PLR+AIAY+PLYRECVKA
Sbjct  464  LQKHWSEAAFNQGLRESQENFMNFMRVLKLGESAISLKDLPAPLRVAIAYMPLYRECVKA  523

Query  400  GGCLLSQRLRGQLVEAAKRLSG--VTLEDARQG-RELLGILEHNLPTFLLNA  254
            GG LLSQ LRGQLVEAAK+L G  V  E+ ++G  +L+ +LEH+LP FL+ A
Sbjct  524  GGRLLSQNLRGQLVEAAKQLQGFDVASEEVKKGHHQLMAVLEHHLPLFLVKA  575



>ref|XP_006662854.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like [Oryza brachyantha]
Length=619

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LA  S+EILKAAGERS+GSL GV FLL S+FL DPAATYAVAD+IA+S DEAV  +LR+F
Sbjct  451  LAPLSVEILKAAGERSTGSLHGVDFLLRSNFLNDPAATYAVADNIAKSADEAVDAKLRTF  510

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            + EHWSEAA  EG    +EH++N +RIM  GESPICLRDLP  L IA+AYLPLYREC+++
Sbjct  511  MLEHWSEAAFSEGFASAQEHFVNFMRIMEKGESPICLRDLPLELVIAMAYLPLYRECMES  570

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
            GG LL Q+LRGQLVEAA RL G  L+ A QG ELL IL+H+LP F++ 
Sbjct  571  GGRLLPQKLRGQLVEAAGRLEGRQLDRASQGTELLAILKHHLPCFMIQ  618



>emb|CDX79783.1| BnaA05g03730D [Brassica napus]
Length=607

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 140/174 (80%), Gaps = 5/174 (3%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A SIEILKAAGERS GSL GV FLL SDFLGDP ATY+VAD+IA+SEDE+V  EL++F
Sbjct  431  LTALSIEILKAAGERSDGSLYGVEFLLKSDFLGDPVATYSVADTIAKSEDESVPSELKTF  490

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  +G R+  ++++N +R++ +GES I L+DLP PLR+A+AY+PLYRECVKA
Sbjct  491  LQEHWSEAALSQGVRESRDNFMNFMRVLKIGESAIRLKDLPGPLRVAVAYMPLYRECVKA  550

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTL--EDARQG---RELLGILEHNLPTFLLNA  254
            GG LLSQRLRGQL+EA K+L G+ +  E+A +G    +L+ +LEH+LP FL+ A
Sbjct  551  GGRLLSQRLRGQLMEAVKQLQGIVVDTEEACKGGHHHQLMAVLEHHLPLFLVKA  604



>ref|XP_009404281.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009404282.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
Length=628

 Score =   222 bits (565),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 131/169 (78%), Gaps = 0/169 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAA ERSSGSL GV FLL ++FLGDP ATYAVADSIA S DEAVAP+LR+F
Sbjct  452  LAALSIEILKAAAERSSGSLAGVEFLLRNNFLGDPVATYAVADSIAESSDEAVAPDLRAF  511

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  EG   G+ H++N +RI+  G SPICLRDLP  L  AIAYL LYREC KA
Sbjct  512  LKEHWSEAAFAEGLNYGQNHFVNFMRILRRGGSPICLRDLPPSLVTAIAYLSLYRECRKA  571

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            GG LL Q+LRGQLVEAA +++G  ++   Q  +L+ +LEH+LPTF L +
Sbjct  572  GGLLLPQKLRGQLVEAASKVAGRPVDKNSQAGDLMAVLEHHLPTFFLQS  620



>ref|XP_010517993.1| PREDICTED: ankyrin repeat protein SKIP35-like [Camelina sativa]
 ref|XP_010517994.1| PREDICTED: ankyrin repeat protein SKIP35-like [Camelina sativa]
Length=591

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 142/180 (79%), Gaps = 8/180 (4%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A S+EILKAAGERS GSL GV FLL SDFL DP ATY+VAD+IA+SEDE+V   L+SF
Sbjct  417  LTALSVEILKAAGERSGGSLYGVEFLLKSDFLRDPVATYSVADTIAKSEDESVPSHLKSF  476

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  +G R+ + +++N +R++ LGES I L+DLP+PLR+AIAY+PLYRECV+A
Sbjct  477  LQEHWSEAAFNQGLRESQGNFMNFMRVLKLGESAISLKDLPAPLRVAIAYMPLYRECVEA  536

Query  400  GGCLLSQRLRGQLVEAAKRLSG--VTLEDARQG-RELLGILEHNLPTFLLNA*IKLITPH  230
            GG LLSQ+LRGQLVEAAK+L G  V  E+ ++G R L+ +LEH+LP FL+ A     +PH
Sbjct  537  GGRLLSQKLRGQLVEAAKQLQGLDVASEEVKKGYRHLVAVLEHHLPLFLVKA-----SPH  591



>ref|XP_009142990.1| PREDICTED: ankyrin repeat protein SKIP35 [Brassica rapa]
Length=607

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 139/174 (80%), Gaps = 5/174 (3%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A SIEILKAAGERS GSL GV FLL SDFLGDP ATY+VAD+IA+SEDE+V  EL++F
Sbjct  431  LTALSIEILKAAGERSDGSLYGVEFLLKSDFLGDPVATYSVADTIAKSEDESVPSELKTF  490

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L E WSEAA  +G R+  E+++N +R++ +GES I L+DLP PLR+A+AY+PLYRECVKA
Sbjct  491  LQEQWSEAALSQGVRESRENFMNFMRVLKIGESAIRLKDLPGPLRVAVAYMPLYRECVKA  550

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTL--EDARQG---RELLGILEHNLPTFLLNA  254
            GG LLSQRLRGQL+EA K+L G+ +  E+A +G    +L+ +LEH+LP FL+ A
Sbjct  551  GGRLLSQRLRGQLMEAVKQLQGIVVDTEEACKGGHHHQLMAVLEHHLPLFLVKA  604



>ref|XP_010237787.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X2 [Brachypodium 
distachyon]
Length=606

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 130/168 (77%), Gaps = 0/168 (0%)
 Frame = -1

Query  757  AAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSFL  578
            A  SIEILKAAGERS+GSL GV FLL S+FL DPAATYAVADSIARS DEAV  +LRSF+
Sbjct  439  APLSIEILKAAGERSTGSLQGVDFLLRSNFLNDPAATYAVADSIARSADEAVDAKLRSFM  498

Query  577  HEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAG  398
             E WSEAA  EG    +EH++N+ RIM  GESP+ LR LP  L IA+AYLPLYREC+++G
Sbjct  499  LEQWSEAAFSEGFASAQEHFVNITRIMQRGESPVLLRKLPIQLVIAMAYLPLYRECLESG  558

Query  397  GCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            G LL QRLRGQLVEAA RL G  L+   QGRELL ILEH+LP FL+  
Sbjct  559  GRLLPQRLRGQLVEAAGRLEGRQLDRGSQGRELLAILEHHLPRFLVQT  606



>ref|XP_003577645.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Brachypodium 
distachyon]
Length=621

 Score =   219 bits (559),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 130/168 (77%), Gaps = 0/168 (0%)
 Frame = -1

Query  757  AAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSFL  578
            A  SIEILKAAGERS+GSL GV FLL S+FL DPAATYAVADSIARS DEAV  +LRSF+
Sbjct  454  APLSIEILKAAGERSTGSLQGVDFLLRSNFLNDPAATYAVADSIARSADEAVDAKLRSFM  513

Query  577  HEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAG  398
             E WSEAA  EG    +EH++N+ RIM  GESP+ LR LP  L IA+AYLPLYREC+++G
Sbjct  514  LEQWSEAAFSEGFASAQEHFVNITRIMQRGESPVLLRKLPIQLVIAMAYLPLYRECLESG  573

Query  397  GCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            G LL QRLRGQLVEAA RL G  L+   QGRELL ILEH+LP FL+  
Sbjct  574  GRLLPQRLRGQLVEAAGRLEGRQLDRGSQGRELLAILEHHLPRFLVQT  621



>ref|XP_009387780.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009387781.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
Length=605

 Score =   219 bits (558),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILK   ERS GSLDGVAFLL +DFLGDP ATYAVADSIA S DE VAPELR+F
Sbjct  437  LAAVSIEILKTVSERSRGSLDGVAFLLCNDFLGDPTATYAVADSIASSNDEVVAPELRAF  496

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSE A  EG   G++HY+N +RI+  G SPICL DLP PL  AI Y PLYREC +A
Sbjct  497  LKEHWSEDAFAEGLSSGQDHYVNFMRILQRGGSPICLMDLPPPLVTAIVYKPLYRECTEA  556

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLL  260
            GG LL Q+LRG+LVEAA RL G  +++    +ELL ILEH+LP   L
Sbjct  557  GGKLLPQKLRGKLVEAASRLGGRQVDNDSPAKELLAILEHHLPRHFL  603



>ref|XP_004978971.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X2 
[Setaria italica]
Length=638

 Score =   219 bits (559),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LA  SIEI+KAAGER++GSL GV FLL SDFL DPAATYAVADSIA+S DEAV  +LRSF
Sbjct  470  LAPLSIEIIKAAGERTTGSLHGVDFLLRSDFLNDPAATYAVADSIAKSADEAVDAKLRSF  529

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            ++EHWSEAA   G    ++ ++N +RIM  GESPICLRDLP  L IA+AYLPLY+EC+ +
Sbjct  530  MNEHWSEAAFSAGFESAQQQFVNFMRIMERGESPICLRDLPIELVIAMAYLPLYKECINS  589

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFL  263
             G LL QRLRGQLVEAA RL G  ++   Q RELL ILEH++P F+
Sbjct  590  SGRLLPQRLRGQLVEAASRLEGRQMDSGSQSRELLAILEHHIPQFM  635



>ref|XP_004978972.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X3 
[Setaria italica]
Length=637

 Score =   219 bits (559),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LA  SIEI+KAAGER++GSL GV FLL SDFL DPAATYAVADSIA+S DEAV  +LRSF
Sbjct  469  LAPLSIEIIKAAGERTTGSLHGVDFLLRSDFLNDPAATYAVADSIAKSADEAVDAKLRSF  528

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            ++EHWSEAA   G    ++ ++N +RIM  GESPICLRDLP  L IA+AYLPLY+EC+ +
Sbjct  529  MNEHWSEAAFSAGFESAQQQFVNFMRIMERGESPICLRDLPIELVIAMAYLPLYKECINS  588

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFL  263
             G LL QRLRGQLVEAA RL G  ++   Q RELL ILEH++P F+
Sbjct  589  SGRLLPQRLRGQLVEAASRLEGRQMDSGSQSRELLAILEHHIPQFM  634



>gb|EPS60182.1| hypothetical protein M569_14622 [Genlisea aurea]
Length=606

 Score =   219 bits (557),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 131/168 (78%), Gaps = 2/168 (1%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARS--EDEAVAPELR  587
            LAA S+EILKAAGERSSGSLDGVAFLL SDFLGDPAATYAVA+SIA +  EDE VAPELR
Sbjct  432  LAALSVEILKAAGERSSGSLDGVAFLLRSDFLGDPAATYAVAESIAAASGEDETVAPELR  491

Query  586  SFLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECV  407
             FL EHWSEAA  +G R+GE HY N+   +  GESP+ LRDLP+ LR+AIAYLPLYRECV
Sbjct  492  RFLREHWSEAAFSDGAREGEAHYANVAAAVMFGESPMRLRDLPAQLRVAIAYLPLYRECV  551

Query  406  KAGGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFL  263
            +AGG LLSQR RGQ+  AA+RL G   E   +  ELL +LE NLP F 
Sbjct  552  EAGGRLLSQRQRGQVAVAARRLGGEVGEGPGKRMELLEVLERNLPPFF  599



>ref|XP_004978970.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X1 
[Setaria italica]
Length=672

 Score =   219 bits (559),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LA  SIEI+KAAGER++GSL GV FLL SDFL DPAATYAVADSIA+S DEAV  +LRSF
Sbjct  504  LAPLSIEIIKAAGERTTGSLHGVDFLLRSDFLNDPAATYAVADSIAKSADEAVDAKLRSF  563

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            ++EHWSEAA   G    ++ ++N +RIM  GESPICLRDLP  L IA+AYLPLY+EC+ +
Sbjct  564  MNEHWSEAAFSAGFESAQQQFVNFMRIMERGESPICLRDLPIELVIAMAYLPLYKECINS  623

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFL  263
             G LL QRLRGQLVEAA RL G  ++   Q RELL ILEH++P F+
Sbjct  624  SGRLLPQRLRGQLVEAASRLEGRQMDSGSQSRELLAILEHHIPQFM  669



>gb|KFK37227.1| hypothetical protein AALP_AA4G230300 [Arabis alpina]
Length=588

 Score =   218 bits (555),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 134/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A SIEILKAAGERS GS DGV FLL SDFL DP ATY+ A++IA+SEDE+V  EL+S+
Sbjct  415  LTALSIEILKAAGERSGGSFDGVEFLLKSDFLDDPVATYSAAETIAKSEDESVPSELKSY  474

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  +G  +  E+++N +R++ LGES I L+DLP+PLR+AIAY+PLYRECVKA
Sbjct  475  LQEHWSEAAFNQGLNESRENFMNFMRVLKLGESAIRLKDLPAPLRVAIAYMPLYRECVKA  534

Query  400  GGCLLSQRLRGQLVEAAKRLSG--VTLEDARQGRELLGILEHNLPTFLLNA  254
            GG LLSQ+LRGQLVEA K+L G  V  ++   G +L+  LEH+LP FL+ A
Sbjct  535  GGRLLSQKLRGQLVEAIKQLQGFEVDTKEVNNGHQLMADLEHHLPLFLVKA  585



>emb|CDY23417.1| BnaC04g49450D [Brassica napus]
Length=535

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 135/171 (79%), Gaps = 3/171 (2%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA + EILKAAGERS GS  GV FLL SDFL DP ATY+ AD++A+SEDE+V  ELRSF
Sbjct  361  LAALNAEILKAAGERSGGSFKGVEFLLKSDFLEDPVATYSAADTVAKSEDESVPLELRSF  420

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  +G ++  ++++N +R++ +GES ICL+DLP+PLR+AIAY+PLYR CVKA
Sbjct  421  LQEHWSEAAFKQGVKESRDNFMNFMRVLKIGESAICLKDLPAPLRVAIAYMPLYRGCVKA  480

Query  400  GGCLLSQRLRGQLVEAAKRLSG--VTLEDARQG-RELLGILEHNLPTFLLN  257
            GG LLSQ+LRGQLVEA K+L G  V  E+  +G  +L+ +LEH+LP FL+ 
Sbjct  481  GGRLLSQKLRGQLVEAVKQLQGFDVDTEEVYKGHHQLMAVLEHHLPIFLVK  531



>emb|CDY17887.1| BnaC04g03320D [Brassica napus]
Length=599

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 135/174 (78%), Gaps = 5/174 (3%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A SIEILKAAGERS GSL GV FLL SDFLGDP ATY+VAD+IA SEDE+V  EL++F
Sbjct  423  LTALSIEILKAAGERSDGSLYGVEFLLKSDFLGDPVATYSVADTIANSEDESVPSELKTF  482

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWSEAA  +G R+  + ++N +R++  GES I L+DLP PLR+A+AY+PLYRECVKA
Sbjct  483  LQEHWSEAALSQGVRESRDDFMNFMRVLKNGESAIRLKDLPGPLRVAVAYMPLYRECVKA  542

Query  400  GGCLLSQRLRGQLVEAAKRLS--GVTLEDARQG---RELLGILEHNLPTFLLNA  254
            GG LLSQRLRGQL+EA K+L   GV  E+  +G    +L+ +LEH+LP FL+ A
Sbjct  543  GGRLLSQRLRGQLMEAVKQLQGIGVDTEEVWKGGHHHQLMAVLEHHLPLFLVKA  596



>dbj|BAJ86308.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07142.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=621

 Score =   216 bits (551),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 129/169 (76%), Gaps = 0/169 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LA  SIEI+KAAGERS+GSL GV FLL SDFL DPAATYAVADSIAR  DEAV  +LRSF
Sbjct  453  LAPLSIEIVKAAGERSTGSLQGVDFLLRSDFLNDPAATYAVADSIARCADEAVDAKLRSF  512

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            + E WSE A +EG    +EH++N+ RIM  GESP+ LR+LP  L IA+AYLPLYREC ++
Sbjct  513  MLEQWSEEAFLEGFASSQEHFVNITRIMQRGESPVALRELPLQLVIAMAYLPLYRECNES  572

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            GG LL QRLRGQLVEAA RL G  L+   Q RELL ILEH+LP FL+  
Sbjct  573  GGRLLPQRLRGQLVEAAGRLEGRQLDRGTQQRELLAILEHHLPRFLVQT  621



>gb|EYU29406.1| hypothetical protein MIMGU_mgv1a003332mg [Erythranthe guttata]
Length=592

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARS--EDEAVAPELR  587
            + A + EILKAAGERS GSLDGVAFLL +DFL DP ATYAVAD IARS  E+ A  PELR
Sbjct  417  ITALAPEILKAAGERSGGSLDGVAFLLRADFLADPVATYAVADVIARSSGEEGAATPELR  476

Query  586  SFLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECV  407
            +FL EHWSE A ++G R GE H+LN+VRI+  G    CLRDLP PL++A+AYLPLYRECV
Sbjct  477  AFLREHWSEEAYLDGLRLGELHFLNVVRILKRGGLESCLRDLPGPLQVAVAYLPLYRECV  536

Query  406  KAGGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLN  257
              GG LLSQR RG LVEA++RL GV L++  Q RELL +LE +LP FLL+
Sbjct  537  GPGGKLLSQRHRGLLVEASRRLGGVVLDEPGQRRELLAVLEQHLPPFLLD  586



>ref|NP_001169323.1| uncharacterized protein LOC100383189 [Zea mays]
 gb|ACN33414.1| unknown [Zea mays]
 gb|AFW60563.1| hypothetical protein ZEAMMB73_944374 [Zea mays]
Length=621

 Score =   211 bits (537),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 127/169 (75%), Gaps = 0/169 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LA  SIEI+KAAGER++GSL GV FLL SDFL DPAATYAVADSIAR  DEAV  +LRSF
Sbjct  453  LAPLSIEIIKAAGERTTGSLQGVDFLLRSDFLNDPAATYAVADSIARCTDEAVDAKLRSF  512

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            ++EHWSEAA   G    ++H++N +RIM  GESPI L DLP  L IA+AYLPLY+EC+ +
Sbjct  513  MNEHWSEAAFCAGFESAQQHFVNFMRIMERGESPIRLGDLPLELVIAMAYLPLYKECMNS  572

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
             G LL QRLRGQLVEAA RL    +E   Q RELL ILEH++P F++  
Sbjct  573  NGRLLPQRLRGQLVEAASRLEDRQVERDSQSRELLAILEHHIPRFMIQT  621



>ref|XP_010469258.1| PREDICTED: ankyrin repeat protein SKIP35 [Camelina sativa]
Length=612

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 129/169 (76%), Gaps = 3/169 (2%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIAR-SEDEAVAPELRS  584
            L A SIEILKAAGERS GSL GV FLL SDFLGD AATY+VADSIAR SEDE+V  +L+S
Sbjct  443  LTALSIEILKAAGERSGGSLQGVEFLLKSDFLGDSAATYSVADSIARASEDESVPSDLKS  502

Query  583  FLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVK  404
            FL EHWSE A  +G R+  E+++N +R++  GES I LRDLP+PLR+AIAY+PLYRECVK
Sbjct  503  FLKEHWSETAFEKGVRESHENFMNFMRVLKKGESAISLRDLPAPLRVAIAYMPLYRECVK  562

Query  403  AGGCLLSQRLRGQLVEAAKRLSG--VTLEDARQGRELLGILEHNLPTFL  263
            A G LLSQRLRGQLVEA ++L G  V + D  +   L+ +LEH+L    
Sbjct  563  ADGGLLSQRLRGQLVEAVRQLQGCAVAVVDVSETHHLMSVLEHHLTAIF  611



>ref|XP_010512283.1| PREDICTED: ankyrin repeat protein SKIP35-like [Camelina sativa]
Length=606

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 129/169 (76%), Gaps = 3/169 (2%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIAR-SEDEAVAPELRS  584
            L A SIEILKAAGERS GSL GV FLL SDFLGD AATY+VADSIAR SEDE+V  +L+S
Sbjct  437  LTALSIEILKAAGERSGGSLQGVEFLLKSDFLGDSAATYSVADSIARASEDESVPSDLKS  496

Query  583  FLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVK  404
            FL EHWSE A  +G R+  E+++N +R++  GES I LRDLP+PLR+AIAY+PLYRECVK
Sbjct  497  FLKEHWSETAFEKGMRESHENFMNFMRVLKKGESAISLRDLPAPLRVAIAYMPLYRECVK  556

Query  403  AGGCLLSQRLRGQLVEAAKRLSG--VTLEDARQGRELLGILEHNLPTFL  263
            A G LLSQR+RGQLVEA ++L G  V + D  +   L+ +LEH+L    
Sbjct  557  ADGGLLSQRIRGQLVEAVRQLQGCAVAVMDVSETHHLMSVLEHHLTAIF  605



>ref|XP_002450553.1| hypothetical protein SORBIDRAFT_05g006915 [Sorghum bicolor]
 gb|EES09541.1| hypothetical protein SORBIDRAFT_05g006915 [Sorghum bicolor]
Length=624

 Score =   208 bits (530),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LA  SIEI+KAAGERS+GSL GV FLL SDFL DPAATYAVADSIAR  DEAV  +LRSF
Sbjct  456  LAPLSIEIIKAAGERSTGSLHGVDFLLRSDFLNDPAATYAVADSIARCTDEAVDAKLRSF  515

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            ++EHWSEAA   G    ++H++N +RIM  GESPI L DLP  L IA+AYLPLY+EC+ +
Sbjct  516  MNEHWSEAAFSAGFESAQQHFVNFMRIMERGESPIRLGDLPLELVIAMAYLPLYKECMNS  575

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFL  263
             G LL QRLRGQLVEAA RL    +E   Q RELL ILEH++P F+
Sbjct  576  IGRLLPQRLRGQLVEAASRLEDRQVERDSQSRELLAILEHHIPRFM  621



>ref|XP_002878304.1| hypothetical protein ARALYDRAFT_486455 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54563.1| hypothetical protein ARALYDRAFT_486455 [Arabidopsis lyrata subsp. 
lyrata]
Length=611

 Score =   207 bits (528),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 129/169 (76%), Gaps = 3/169 (2%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARS-EDEAVAPELRS  584
            L A SIEILKAAGERS GSL GV FLL SDFLGD  ATY+VADSIARS EDE+V  +L+S
Sbjct  442  LTALSIEILKAAGERSGGSLQGVEFLLKSDFLGDSTATYSVADSIARSSEDESVPSDLKS  501

Query  583  FLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVK  404
            FL EHWSE+A  +G R+  E+++N +R++  GES I LRDLP+PLR+AIAY+PLYREC+K
Sbjct  502  FLQEHWSESAFEKGMRESHENFMNFMRVLKKGESAISLRDLPAPLRVAIAYMPLYRECMK  561

Query  403  AGGCLLSQRLRGQLVEAAKRLSG--VTLEDARQGRELLGILEHNLPTFL  263
              G LLSQRLRGQLVEA ++L G  V + +  Q R L+ +LEH+L    
Sbjct  562  GDGRLLSQRLRGQLVEAVRQLQGCAVAVVEVSQTRNLMAVLEHHLTAIF  610



>ref|NP_191550.1| Ankyrin repeat family protein [Arabidopsis thaliana]
 sp|Q9M1Y3.1|SKI35_ARATH RecName: Full=Ankyrin repeat protein SKIP35; AltName: Full=SKP1-interacting 
partner 35 [Arabidopsis thaliana]
 emb|CAB75810.1| putative protein [Arabidopsis thaliana]
 gb|AAM20716.1| putative protein [Arabidopsis thaliana]
 gb|AAP37740.1| At3g59910 [Arabidopsis thaliana]
 gb|AEE79984.1| Ankyrin repeat family protein [Arabidopsis thaliana]
Length=611

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 129/169 (76%), Gaps = 3/169 (2%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARS-EDEAVAPELRS  584
            L A SIEILKAAGERS GSL GV FLL SDFLGD  ATY+VADSIARS EDE+V  +L+S
Sbjct  442  LTALSIEILKAAGERSGGSLQGVEFLLKSDFLGDSTATYSVADSIARSSEDESVPSDLKS  501

Query  583  FLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVK  404
            FL EHWSE+A  +G R+  + ++N +R++  GES I LRDLP+PLR+AIAY+PLYREC+K
Sbjct  502  FLQEHWSESAFEKGMRESHDDFMNFMRVLKKGESAISLRDLPAPLRVAIAYMPLYRECMK  561

Query  403  AGGCLLSQRLRGQLVEAAKRLSG--VTLEDARQGRELLGILEHNLPTFL  263
            A G LLSQRLRGQLVEA ++L G  V + +  Q R L+ +LEH+L    
Sbjct  562  ADGRLLSQRLRGQLVEAVRQLQGCAVAVVEVSQTRNLMAVLEHHLTAIF  610



>ref|XP_010413621.1| PREDICTED: ankyrin repeat protein SKIP35-like [Camelina sativa]
Length=600

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 129/169 (76%), Gaps = 3/169 (2%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIAR-SEDEAVAPELRS  584
            L A SIEILKAAGERS GSL GV FLL SDFLGD AATY+VADSIAR SEDE+V  +L+S
Sbjct  431  LTALSIEILKAAGERSGGSLQGVEFLLKSDFLGDSAATYSVADSIARASEDESVPSDLKS  490

Query  583  FLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVK  404
            FL EHWSE A  +G R+  E+++N +R++  GES I LRDLP+PLR+AIAY+PLYRECVK
Sbjct  491  FLKEHWSETAFEKGMRESHENFMNFMRVLKKGESAISLRDLPAPLRVAIAYMPLYRECVK  550

Query  403  AGGCLLSQRLRGQLVEAAKRLSG--VTLEDARQGRELLGILEHNLPTFL  263
            A G LLSQRLRGQLVEA ++L G  V + +  +   L+ +LEH+L    
Sbjct  551  ADGGLLSQRLRGQLVEAVRQLQGCAVAVVEVSETHHLMSVLEHHLTAIF  599



>ref|XP_006402640.1| hypothetical protein EUTSA_v10005846mg [Eutrema salsugineum]
 gb|ESQ44093.1| hypothetical protein EUTSA_v10005846mg [Eutrema salsugineum]
Length=606

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 128/169 (76%), Gaps = 3/169 (2%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARS-EDEAVAPELRS  584
            L A SIEIL+AAGERS GSL GV FLL SDFLGD  ATY+VAD IARS EDE+V   L+S
Sbjct  437  LTALSIEILRAAGERSGGSLQGVEFLLKSDFLGDSVATYSVADGIARSSEDESVPWNLKS  496

Query  583  FLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVK  404
            FL EHWSE+A  EG+R+  E+++N +R++  GES I LRDLP+PLR+AIAY+PLYRECV 
Sbjct  497  FLQEHWSESAFEEGRRESHENFMNFMRVLKKGESEISLRDLPAPLRVAIAYMPLYRECVN  556

Query  403  AGGCLLSQRLRGQLVEAAKRLSG--VTLEDARQGRELLGILEHNLPTFL  263
             GG LLSQRLRGQLVEA ++L G  V + +  + R L+ +LEH+L    
Sbjct  557  TGGRLLSQRLRGQLVEAVRQLQGCVVAVVEVSETRNLMAVLEHHLTAIF  605



>gb|EMS56943.1| hypothetical protein TRIUR3_08812 [Triticum urartu]
Length=648

 Score =   206 bits (525),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = -1

Query  757  AAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSFL  578
            A  SIEI+KAAGERS+GSL GV FLL SDFL DPAATYAVADSIAR  DEAV  +LR F+
Sbjct  481  APLSIEIVKAAGERSTGSLQGVDFLLRSDFLNDPAATYAVADSIARCADEAVDAKLRLFM  540

Query  577  HEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAG  398
             E WSE A  +G    +EH++N+ RIM  GESP+ LR LP  L IA+AYLPLYRECV +G
Sbjct  541  LEQWSEEAFNKGFVSSQEHFVNITRIMQRGESPVVLRQLPLQLVIAMAYLPLYRECVGSG  600

Query  397  GCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            G LL QRLRGQLVEAA RL G  L+   Q  ELL ILEH+LP FL+  
Sbjct  601  GRLLPQRLRGQLVEAAGRLEGRQLDRGMQQSELLAILEHHLPRFLIQT  648



>ref|XP_009116666.1| PREDICTED: ankyrin repeat protein SKIP35 [Brassica rapa]
Length=604

 Score =   205 bits (521),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 128/165 (78%), Gaps = 3/165 (2%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARS-EDEAVAPELRS  584
            L A SIEILKAAGERS GSL GV FLL SDFLGDP ATY+VADSIA+S EDE V  +L+S
Sbjct  435  LTALSIEILKAAGERSGGSLQGVEFLLKSDFLGDPTATYSVADSIAKSSEDETVPSDLKS  494

Query  583  FLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVK  404
            FL EHWSE+A  +G R+  E+++N +R++  GE  I LRDLP+PLR+AIAY+PLYRECV 
Sbjct  495  FLREHWSESAFEKGMRESHENFINFMRVLKRGECAISLRDLPAPLRVAIAYMPLYRECVN  554

Query  403  AGGCLLSQRLRGQLVEAAKRLSG--VTLEDARQGRELLGILEHNL  275
            AGG LLSQRLRGQLVEA ++L G  V + +  +   L+ +LEH+L
Sbjct  555  AGGRLLSQRLRGQLVEAVRQLQGCDVPVVEVSETPHLMAVLEHHL  599



>emb|CDX71861.1| BnaC08g30130D [Brassica napus]
Length=604

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 128/165 (78%), Gaps = 3/165 (2%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARS-EDEAVAPELRS  584
            L A SIEILKAAGERS GSL GV FLL SDFLGDP ATY+VADSIARS +DE+V  +L+S
Sbjct  435  LTALSIEILKAAGERSGGSLQGVEFLLKSDFLGDPTATYSVADSIARSSDDESVPSDLKS  494

Query  583  FLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVK  404
            FL EHWSE+A  +G R+  E ++N +R++  GE  I LRDLP+PLR+AIAY+PLYRECV 
Sbjct  495  FLREHWSESAFEKGMRESHEDFMNFMRVLKRGECAISLRDLPAPLRVAIAYMPLYRECVN  554

Query  403  AGGCLLSQRLRGQLVEAAKRLSG--VTLEDARQGRELLGILEHNL  275
            AGG LLSQRLRGQLVEA ++L G  V + +  +   L+ +LEH+L
Sbjct  555  AGGRLLSQRLRGQLVEAVRQLQGCDVPVVEVGETPRLMAVLEHHL  599



>ref|XP_006290752.1| hypothetical protein CARUB_v10016852mg [Capsella rubella]
 ref|XP_006290753.1| hypothetical protein CARUB_v10016852mg [Capsella rubella]
 gb|EOA23650.1| hypothetical protein CARUB_v10016852mg [Capsella rubella]
 gb|EOA23651.1| hypothetical protein CARUB_v10016852mg [Capsella rubella]
Length=615

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 128/169 (76%), Gaps = 3/169 (2%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIAR-SEDEAVAPELRS  584
            L A SIEILKAAGERS GSL GV FLL SDFLGD  ATY+VADSIAR SEDE+V  +L+S
Sbjct  446  LTALSIEILKAAGERSGGSLQGVEFLLKSDFLGDSTATYSVADSIARASEDESVPSDLKS  505

Query  583  FLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVK  404
            FL EHWSE+A  +G R+  E ++N +R++  GES I +RDLP+PLR+AIAY+PLYRECVK
Sbjct  506  FLQEHWSESAFEKGMRESHEDFMNFMRVLKRGESEISIRDLPAPLRVAIAYMPLYRECVK  565

Query  403  AGGCLLSQRLRGQLVEAAKRLS--GVTLEDARQGRELLGILEHNLPTFL  263
            A G LLSQRLRGQLVEA ++L   GV + +  +   L+ +LEH+L    
Sbjct  566  ADGRLLSQRLRGQLVEAVRQLQGCGVAVVEVSETHHLMSVLEHHLTAIF  614



>gb|EMT24392.1| hypothetical protein F775_29756 [Aegilops tauschii]
Length=648

 Score =   203 bits (516),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = -1

Query  757  AAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSFL  578
            A  SIEI+KAAGERS+GSL GV FLL SDFL DPAATYAVADSIAR  DEAV  +LR F+
Sbjct  481  APLSIEIVKAAGERSTGSLQGVDFLLRSDFLNDPAATYAVADSIARCADEAVDAKLRLFM  540

Query  577  HEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAG  398
             E WSE A  +G    +EH++N+ RIM  GESP+ LR LP  L IA+AYLPL RECV +G
Sbjct  541  LEQWSEEAFNKGFVSSQEHFVNITRIMQRGESPVVLRQLPLQLVIAMAYLPLSRECVGSG  600

Query  397  GCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            G LL QRLRGQLVEAA RL G  L+   Q  ELL ILEH+LP FL+  
Sbjct  601  GRLLPQRLRGQLVEAAGRLEGRQLDRGTQQSELLAILEHHLPRFLVQT  648



>emb|CDY05963.1| BnaA09g38170D [Brassica napus]
Length=604

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 128/169 (76%), Gaps = 3/169 (2%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARS-EDEAVAPELRS  584
            L A SIEILKAAGERS GSL GV FLL SDFLGDP ATY+VADSIA+S EDE+V  +L+S
Sbjct  435  LTALSIEILKAAGERSGGSLQGVEFLLKSDFLGDPTATYSVADSIAKSSEDESVPSDLKS  494

Query  583  FLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVK  404
            FL E WSE+A  +G R+  E+++N +R++  GE  I LRDLP+PLR+AIAY+PLYRECV 
Sbjct  495  FLRERWSESAFEKGMRESHENFINFMRVLKRGECAISLRDLPAPLRVAIAYMPLYRECVN  554

Query  403  AGGCLLSQRLRGQLVEAAKRLSG--VTLEDARQGRELLGILEHNLPTFL  263
            AGG LLSQRLRGQLVEA ++L G  V + +  +   L+ +LEH+L    
Sbjct  555  AGGRLLSQRLRGQLVEAVRQLQGCDVPVVEVSETPRLMAVLEHHLTAIF  603



>ref|XP_008370850.1| PREDICTED: ankyrin repeat protein SKIP35-like [Malus domestica]
Length=535

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 121/169 (72%), Gaps = 5/169 (3%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSG--SLDGVAFLLSSDFLGDPAATYAVADSIARS-EDEAVAPEL  590
            LA  S  ILKA G R  G  SL GVAFLL SDFLGDPA TY VAD+ A S +D+   PEL
Sbjct  366  LAQRSFNILKAVG-RVGGVNSLKGVAFLLGSDFLGDPATTYTVADTFAGSGDDDDANPEL  424

Query  589  RSFLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYREC  410
            R+FL EHWSE A  +G RQG+EHY+N+VR++  GESPICL  LP  LR+AIAYLPLYREC
Sbjct  425  RAFLQEHWSERAFSDGIRQGQEHYMNIVRVLKWGESPICLAVLPPELRVAIAYLPLYREC  484

Query  409  VKAGGC-LLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTF  266
            V A G  L+SQRLRGQLVEA  RL G  L+   Q RELL +LE  LP F
Sbjct  485  VNAAGSRLVSQRLRGQLVEAVTRLGGGVLDGVNQCRELLAVLERRLPQF  533



>emb|CDY30455.1| BnaA04g25560D [Brassica napus]
Length=672

 Score =   201 bits (512),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 125/161 (78%), Gaps = 3/161 (2%)
 Frame = -1

Query  730  AAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAA  551
            AAGERS GS +GV FLL SDFL DP ATY+ AD+IA SEDE+V  EL++FL EHWSEAA 
Sbjct  508  AAGERSGGSFNGVEFLLKSDFLEDPLATYSAADTIANSEDESVPLELKTFLQEHWSEAAF  567

Query  550  IEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLR  371
             +G ++  +++LN +R++ +GES I L+DLP+PLR+A+AY+PLYRECVKAGG LLSQ+LR
Sbjct  568  KQGVKESRDNFLNFMRVLKIGESGIRLKDLPAPLRVAVAYMPLYRECVKAGGRLLSQKLR  627

Query  370  GQLVEAAKRLSGVTLED---ARQGRELLGILEHNLPTFLLN  257
            GQLVEA K+L G  +E     +   +L+ +LEH+LP FL+ 
Sbjct  628  GQLVEAVKQLQGFDVETEGVYKSHHQLMAVLEHHLPIFLVK  668



>ref|XP_008788289.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X4 [Phoenix 
dactylifera]
Length=390

 Score =   192 bits (488),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 118/161 (73%), Gaps = 0/161 (0%)
 Frame = -1

Query  748  SIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSFLHEH  569
            S EILK+ GE    S +GV FLLSSDFL DP ATYA A+ +A S +EA+ PEL+ FL EH
Sbjct  230  SFEILKSVGEERPDSFEGVNFLLSSDFLRDPIATYAFANRLATSNEEAITPELKVFLLEH  289

Query  568  WSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCL  389
            WS  A +EG R GE HY+NL+RI+  G+S ICLR+LP PL I IAYLPLYREC+ + G L
Sbjct  290  WSAEAFVEGMRAGEVHYVNLMRILRRGKSEICLRELPPPLVIVIAYLPLYRECLASSGSL  349

Query  388  LSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTF  266
            L QRLRG+L+ AA+RLS   +++  + RELL IL+ ++P F
Sbjct  350  LPQRLRGELMVAARRLSNWAVDEMSEKRELLEILQQHMPCF  390



>ref|XP_008788288.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X3 [Phoenix 
dactylifera]
Length=484

 Score =   192 bits (489),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 118/161 (73%), Gaps = 0/161 (0%)
 Frame = -1

Query  748  SIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSFLHEH  569
            S EILK+ GE    S +GV FLLSSDFL DP ATYA A+ +A S +EA+ PEL+ FL EH
Sbjct  324  SFEILKSVGEERPDSFEGVNFLLSSDFLRDPIATYAFANRLATSNEEAITPELKVFLLEH  383

Query  568  WSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCL  389
            WS  A +EG R GE HY+NL+RI+  G+S ICLR+LP PL I IAYLPLYREC+ + G L
Sbjct  384  WSAEAFVEGMRAGEVHYVNLMRILRRGKSEICLRELPPPLVIVIAYLPLYRECLASSGSL  443

Query  388  LSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTF  266
            L QRLRG+L+ AA+RLS   +++  + RELL IL+ ++P F
Sbjct  444  LPQRLRGELMVAARRLSNWAVDEMSEKRELLEILQQHMPCF  484



>ref|XP_008788287.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X2 [Phoenix 
dactylifera]
Length=563

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 118/161 (73%), Gaps = 0/161 (0%)
 Frame = -1

Query  748  SIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSFLHEH  569
            S EILK+ GE    S +GV FLLSSDFL DP ATYA A+ +A S +EA+ PEL+ FL EH
Sbjct  403  SFEILKSVGEERPDSFEGVNFLLSSDFLRDPIATYAFANRLATSNEEAITPELKVFLLEH  462

Query  568  WSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCL  389
            WS  A +EG R GE HY+NL+RI+  G+S ICLR+LP PL I IAYLPLYREC+ + G L
Sbjct  463  WSAEAFVEGMRAGEVHYVNLMRILRRGKSEICLRELPPPLVIVIAYLPLYRECLASSGSL  522

Query  388  LSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTF  266
            L QRLRG+L+ AA+RLS   +++  + RELL IL+ ++P F
Sbjct  523  LPQRLRGELMVAARRLSNWAVDEMSEKRELLEILQQHMPCF  563



>ref|XP_008788283.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008788285.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008788286.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Phoenix 
dactylifera]
Length=569

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 118/161 (73%), Gaps = 0/161 (0%)
 Frame = -1

Query  748  SIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSFLHEH  569
            S EILK+ GE    S +GV FLLSSDFL DP ATYA A+ +A S +EA+ PEL+ FL EH
Sbjct  409  SFEILKSVGEERPDSFEGVNFLLSSDFLRDPIATYAFANRLATSNEEAITPELKVFLLEH  468

Query  568  WSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCL  389
            WS  A +EG R GE HY+NL+RI+  G+S ICLR+LP PL I IAYLPLYREC+ + G L
Sbjct  469  WSAEAFVEGMRAGEVHYVNLMRILRRGKSEICLRELPPPLVIVIAYLPLYRECLASSGSL  528

Query  388  LSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTF  266
            L QRLRG+L+ AA+RLS   +++  + RELL IL+ ++P F
Sbjct  529  LPQRLRGELMVAARRLSNWAVDEMSEKRELLEILQQHMPCF  569



>ref|XP_002985572.1| hypothetical protein SELMODRAFT_122416 [Selaginella moellendorffii]
 gb|EFJ13446.1| hypothetical protein SELMODRAFT_122416 [Selaginella moellendorffii]
Length=570

 Score =   191 bits (485),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 125/173 (72%), Gaps = 6/173 (3%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L   S+EI+KAAGERSSGSL G+AFLL SDFL +P ATY +AD+I+RSEDEA+ PELRSF
Sbjct  393  LQTLSVEIIKAAGERSSGSLGGIAFLLQSDFLSNPEATYRLADTISRSEDEAITPELRSF  452

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L E WSEAA   G+R GE H+LN++R++  G S + L +LP  L++ IAY+PLY+ECV A
Sbjct  453  LQEQWSEAAFARGRRLGEAHHLNVMRVLKKGNSALHLDELPLQLQVIIAYIPLYKECVAA  512

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTL---ED---ARQGRELLGILEHNLPTFLL  260
             G +LSQ LRGQL +AA RLS  TL   ED       + LL I++   PTFLL
Sbjct  513  KGVILSQLLRGQLFDAALRLSAGTLPGTEDMLLKSNKQTLLSIVQSRFPTFLL  565



>ref|XP_002987003.1| hypothetical protein SELMODRAFT_125287 [Selaginella moellendorffii]
 gb|EFJ11846.1| hypothetical protein SELMODRAFT_125287 [Selaginella moellendorffii]
Length=555

 Score =   190 bits (483),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 125/173 (72%), Gaps = 6/173 (3%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L   S+EI+KAAGERSSGSL G+AFLL SDFL +P ATY +AD+I+RSEDEA+ PELRSF
Sbjct  378  LQTLSVEIIKAAGERSSGSLGGIAFLLQSDFLSNPEATYRLADTISRSEDEAITPELRSF  437

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L E WSEAA   G+R GE H+LN++R++  G S + L +LP  L++ IAY+PLY+ECV A
Sbjct  438  LQEQWSEAAFARGRRLGEVHHLNVMRVLKKGNSALHLDELPLQLQVIIAYIPLYKECVAA  497

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTL---ED---ARQGRELLGILEHNLPTFLL  260
             G +LSQ LRGQL +AA RLS  TL   ED       + LL I++   PTFLL
Sbjct  498  KGVILSQLLRGQLFDAALRLSAGTLPGTEDMLLKSNKQTLLSIVQSRFPTFLL  550



>ref|XP_006848543.1| hypothetical protein AMTR_s00169p00037240 [Amborella trichopoda]
 gb|ERN10124.1| hypothetical protein AMTR_s00169p00037240 [Amborella trichopoda]
Length=701

 Score =   190 bits (483),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 123/173 (71%), Gaps = 6/173 (3%)
 Frame = -1

Query  754  AXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARS-EDEAVAPELRSFL  578
            A S EI+KAAGERS GS +GVAFLL SDFLG   ATY  A+ +AR+ E+E V PELR F 
Sbjct  526  ALSTEIIKAAGERSGGSFEGVAFLLRSDFLGGAEATYGAAERVARAKEEEGVTPELRDFF  585

Query  577  HEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAG  398
             E WSE A + G+R GEEHY+NL R++  G S + + DLP+PL++AIAYLPLY+ECV+AG
Sbjct  586  REGWSEGAFLRGRRCGEEHYVNLERVLKRGASALRVWDLPTPLQVAIAYLPLYKECVEAG  645

Query  397  GCLLSQRLRGQLVEAAKRLSGVTLEDARQ--GR---ELLGILEHNLPTFLLNA  254
            G LLSQ LRGQLVEA  RL G       Q  GR   ELL ILE +LP+FL+  
Sbjct  646  GQLLSQWLRGQLVEAVWRLEGAAFGSVDQLCGRSKDELLTILESHLPSFLITG  698



>ref|XP_001775776.1| predicted protein [Physcomitrella patens]
 gb|EDQ59459.1| predicted protein [Physcomitrella patens]
Length=553

 Score =   182 bits (463),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 123/175 (70%), Gaps = 6/175 (3%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L   S EILKAAGERS GSL G+AFLL +DFL +  ATY++ADSIA+SEDEA+  ELR+F
Sbjct  377  LQTLSAEILKAAGERSGGSLKGIAFLLQADFLNNSEATYSIADSIAKSEDEAITVELRTF  436

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L E WSE A ++G+  G+ H+LN++R +  G SP+ L++LP  L++ +AYLPLY+ECV A
Sbjct  437  LLEEWSEEAFLKGRLLGQAHHLNVMRALKRGSSPLHLQELPLQLQVTVAYLPLYKECVAA  496

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQ------GRELLGILEHNLPTFLLNA  254
             G +LSQ LRGQLVEAA RL+   L    +        ELL ILE  LP FLL +
Sbjct  497  SGVVLSQWLRGQLVEAALRLNQGNLRSTEEVFLKLSKHELLSILESRLPGFLLTS  551



>ref|XP_001771374.1| predicted protein [Physcomitrella patens]
 gb|EDQ63764.1| predicted protein [Physcomitrella patens]
Length=535

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 122/173 (71%), Gaps = 6/173 (3%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L   S EILKAAGERS GSL G+AFLL +DFL +P ATY +ADSIA+SEDEA+  ELR+F
Sbjct  358  LQTLSAEILKAAGERSGGSLKGIAFLLQADFLNNPEATYTIADSIAKSEDEAITTELRAF  417

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L + WSE A  +G+  GE H+LN++R +  G SP+ L++LP  L++ +AYLPLY+ECV A
Sbjct  418  LLDEWSEEAFFKGRLLGEAHHLNVMRALKRGSSPLHLQELPLQLQVTVAYLPLYKECVAA  477

Query  400  GGCLLSQRLRGQLVEAAKRLS--GVTLEDAR----QGRELLGILEHNLPTFLL  260
             G +LSQ LRGQLVEAA RL+  G+   +         ELL +LE  LP FLL
Sbjct  478  SGVILSQLLRGQLVEAAVRLNQGGLFFTEEMLLKFSKHELLSVLESRLPGFLL  530



>ref|XP_001760791.1| predicted protein [Physcomitrella patens]
 gb|EDQ74530.1| predicted protein [Physcomitrella patens]
Length=545

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 122/173 (71%), Gaps = 6/173 (3%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L   S EILKAAGERS GSL G+AFLL +DFL +P ATY +AD+IA+SEDEA+  ELR+F
Sbjct  371  LQTLSAEILKAAGERSGGSLKGIAFLLQADFLNNPEATYRIADNIAKSEDEAITSELRTF  430

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L E WSE A + G+  G+ H+LN++R +  G SP+ L++LP  L+  +AYLPLY+EC+ +
Sbjct  431  LLEEWSEEAFLSGRLLGQAHHLNVMRALKRGSSPLHLQELPLQLQATVAYLPLYKECIAS  490

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQ------GRELLGILEHNLPTFLL  260
             G +LSQ LRGQLVEAA RL+ V L  + +        ELL IL+  LP F+L
Sbjct  491  SGVVLSQWLRGQLVEAALRLNQVGLRSSEEVLVKCSKHELLSILKSRLPGFML  543



>dbj|BAD15575.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD16555.1| unknown protein [Oryza sativa Japonica Group]
Length=237

 Score =   170 bits (431),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 113/169 (67%), Gaps = 1/169 (1%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A S +ILKAA  + SGS +GV+FLL S+FL D AATYAVADSIA +    +  +L  F
Sbjct  70   LEALSPQILKAARGQGSGSFEGVSFLLRSNFLNDAAATYAVADSIATTSTMDIPQDLVDF  129

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L E WS+AA  EG   GE+H++N+ R++  G SPI L DLP P+ +AIAYLPLYR C  A
Sbjct  130  LKEQWSQAAFAEGVEAGEDHFVNITRVLRRGASPIRLHDLPEPMALAIAYLPLYRACASA  189

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
             G LL QRLRG+LVEA  RL GV +      R+ L +LEH  P+F+  A
Sbjct  190  RGQLLPQRLRGELVEAVGRL-GVPVNMENNRRDFLAVLEHYFPSFITGA  237



>ref|XP_001755132.1| predicted protein [Physcomitrella patens]
 gb|EDQ80076.1| predicted protein [Physcomitrella patens]
Length=520

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 123/173 (71%), Gaps = 6/173 (3%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L   S EILKAAGERS GSL+G+AFLL +DFL +P ATY  ADSI++SEDEA+  ELR+F
Sbjct  343  LHTLSAEILKAAGERSGGSLEGIAFLLQADFLNNPTATYRTADSISKSEDEAITLELRTF  402

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L E WSE A ++G+  G+ H+LN++R +  G SP+ L++LP  L++ +AYLPLY+EC+ +
Sbjct  403  LQEEWSEDAFLKGRLLGQAHHLNVMRALKRGSSPLHLQELPLQLQVTVAYLPLYKECMAS  462

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQ------GRELLGILEHNLPTFLL  260
             G +LSQ LRGQLVEAA RL+   L  + +        ELL ILE  LP F+L
Sbjct  463  SGVVLSQWLRGQLVEAALRLNEGDLCSSEELFMKCSKHELLLILESRLPGFVL  515



>ref|NP_001047152.1| Os02g0562400 [Oryza sativa Japonica Group]
 dbj|BAF09066.1| Os02g0562400, partial [Oryza sativa Japonica Group]
Length=480

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 113/169 (67%), Gaps = 1/169 (1%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A S +ILKAA  + SGS +GV+FLL S+FL D AATYAVADSIA +    +  +L  F
Sbjct  313  LEALSPQILKAARGQGSGSFEGVSFLLRSNFLNDAAATYAVADSIATTSTMDIPQDLVDF  372

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L E WS+AA  EG   GE+H++N+ R++  G SPI L DLP P+ +AIAYLPLYR C  A
Sbjct  373  LKEQWSQAAFAEGVEAGEDHFVNITRVLRRGASPIRLHDLPEPMALAIAYLPLYRACASA  432

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
             G LL QRLRG+LVEA  RL GV +      R+ L +LEH  P+F+  A
Sbjct  433  RGQLLPQRLRGELVEAVGRL-GVPVNMENNRRDFLAVLEHYFPSFITGA  480



>ref|XP_006647390.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like [Oryza brachyantha]
Length=546

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 114/169 (67%), Gaps = 3/169 (2%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A S +ILKAA  +  GS +GVAFLL S+FL D A+TYA ADSIA + D  V  +L +F
Sbjct  379  LEALSTQILKAARGQGRGSFEGVAFLLRSNFLNDAASTYAAADSIATTSDMDVPQDLVAF  438

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L E WS+AA  EG   GE+H++N+ R++  G SPI L DLP P+ +AI YLPLYR C  A
Sbjct  439  LKEQWSQAAFAEGVEAGEDHFVNITRVLRRGASPILLHDLPEPITLAITYLPLYRACAAA  498

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTL--EDARQGRELLGILEHNLPTFLL  260
             G LL QRLRG+LVEA  RL G+         G++LL +LEH LP+F++
Sbjct  499  SGQLLPQRLRGELVEAVGRL-GIPFPANMENNGKDLLAVLEHYLPSFVI  546



>gb|EAZ23465.1| hypothetical protein OsJ_07159 [Oryza sativa Japonica Group]
Length=595

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 113/169 (67%), Gaps = 1/169 (1%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A S +ILKAA  + SGS +GV+FLL S+FL D AATYAVADSIA +    +  +L  F
Sbjct  428  LEALSPQILKAARGQGSGSFEGVSFLLRSNFLNDAAATYAVADSIATTSTMDIPQDLVDF  487

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L E WS+AA  EG   GE+H++N+ R++  G SPI L DLP P+ +AIAYLPLYR C  A
Sbjct  488  LKEQWSQAAFAEGVEAGEDHFVNITRVLRRGASPIRLHDLPEPMALAIAYLPLYRACASA  547

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
             G LL QRLRG+LVEA  RL GV +      R+ L +LEH  P+F+  A
Sbjct  548  RGQLLPQRLRGELVEAVGRL-GVPVNMENNRRDFLAVLEHYFPSFITGA  595



>ref|XP_006858696.1| hypothetical protein AMTR_s00066p00097810 [Amborella trichopoda]
 gb|ERN20163.1| hypothetical protein AMTR_s00066p00097810 [Amborella trichopoda]
Length=617

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 114/167 (68%), Gaps = 3/167 (2%)
 Frame = -1

Query  754  AXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSFLH  575
            A S EILKAAG   + SL+G+ FLL S+FLG P ATY  +D +A+ EDE V  +L+ FL 
Sbjct  453  ALSTEILKAAG---AASLEGITFLLQSNFLGSPEATYTASDIVAKCEDEGVKSKLKEFLI  509

Query  574  EHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGG  395
            E+WSE A ++G+ +  +HY+N++R+++ G S + + DLP  LR+ IAYLPLYRECV  GG
Sbjct  510  ENWSEEAFMKGREESRDHYVNVMRVVSRGGSELSIGDLPVELRVGIAYLPLYRECVACGG  569

Query  394  CLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
             LLSQRLRGQ+VEA  RL    +       ELL + E +LP FL+ A
Sbjct  570  KLLSQRLRGQVVEAVWRLGAGDVASMSSQDELLTVFERHLPPFLIRA  616



>ref|XP_004952744.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X1 
[Setaria italica]
 ref|XP_004952745.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X2 
[Setaria italica]
 ref|XP_004952746.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X3 
[Setaria italica]
 ref|XP_004952747.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X4 
[Setaria italica]
Length=582

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 118/170 (69%), Gaps = 2/170 (1%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A S +ILKAA  + S SLDGVAFLL S+FL D AATY  AD IAR       P+L +F
Sbjct  414  LEALSTQILKAARGQGSRSLDGVAFLLRSNFLKDAAATYEAADLIARGATNGEPPDLVAF  473

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECV-K  404
            L EHWS+AA  EG   GE H++N++R++  G SPICL +LPS + + IAYLPLY+ CV +
Sbjct  474  LKEHWSQAAFAEGVSAGEAHFVNVMRVLRRGASPICLDNLPSQMVLGIAYLPLYQACVSE  533

Query  403  AGGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            +GG LL QRLRG++VEA  RL G  +    QG++L+  LE ++P+FL+ +
Sbjct  534  SGGQLLPQRLRGEMVEAMSRL-GEPIGAESQGKDLVMALERHMPSFLVGS  582



>ref|XP_002962852.1| hypothetical protein SELMODRAFT_62282, partial [Selaginella moellendorffii]
 gb|EFJ36315.1| hypothetical protein SELMODRAFT_62282, partial [Selaginella moellendorffii]
Length=499

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARS-EDEAVAPELRS  584
            L   S EILKAAGERS+GSL G+AFLL +DFLG+P  TY VAD+IA + E+E V  ELR 
Sbjct  358  LDTLSGEILKAAGERSAGSLKGIAFLLHADFLGNPDETYRVADAIATAAEEEGVTLELRD  417

Query  583  FLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVK  404
            FL E WS AA   G++ G  H++N +R +  G SP+ L+DLP  L+  +AYLPLY+ECV 
Sbjct  418  FLAEEWSLAAFAAGRQIGARHHVNFMRALKRGSSPLSLQDLPLQLQATVAYLPLYKECVS  477

Query  403  AGGCLLSQRLRGQLVEAAKRL  341
            + G LLSQRLRGQLVEA  RL
Sbjct  478  SAGVLLSQRLRGQLVEAVSRL  498



>gb|ACN33692.1| unknown [Zea mays]
 gb|AFW71860.1| hypothetical protein ZEAMMB73_373645 [Zea mays]
 gb|AFW71861.1| hypothetical protein ZEAMMB73_373645 [Zea mays]
 gb|AFW71862.1| hypothetical protein ZEAMMB73_373645 [Zea mays]
 gb|AFW71863.1| hypothetical protein ZEAMMB73_373645 [Zea mays]
 gb|AFW71864.1| hypothetical protein ZEAMMB73_373645 [Zea mays]
Length=589

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 112/169 (66%), Gaps = 1/169 (1%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A S +ILKAA  + S  LDGV FLL S+FL D AATY  AD IA        P+L +F
Sbjct  422  LEALSTQILKAARGQGSRPLDGVTFLLRSNFLRDAAATYEAADIIATGGTNGELPDLVAF  481

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKA  401
            L EHWS+ A  EG   GE H++N++R++  G SPICL DLP  + + I YLPLYREC+ A
Sbjct  482  LKEHWSQDAFAEGVSAGEMHFVNVMRVLRRGASPICLEDLPPEMVLGITYLPLYRECLSA  541

Query  400  GGCLLSQRLRGQLVEAAKRLSGVTLEDARQGRELLGILEHNLPTFLLNA  254
            GG LL QRLRG+L+EA  RL G  +    QG++L+  LE ++P+FL+ +
Sbjct  542  GGQLLPQRLRGELLEAVHRL-GEPVGPESQGKDLVLALERHMPSFLVGS  589



>ref|XP_002989433.1| hypothetical protein SELMODRAFT_42326, partial [Selaginella moellendorffii]
 gb|EFJ09524.1| hypothetical protein SELMODRAFT_42326, partial [Selaginella moellendorffii]
Length=499

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 101/141 (72%), Gaps = 1/141 (1%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARS-EDEAVAPELRS  584
            L   S EILKAAGERS+GSL G+AFLL +DFLG+P  TY VAD+IA + E+E V  ELR 
Sbjct  358  LDTLSGEILKAAGERSAGSLKGIAFLLHADFLGNPDETYRVADAIATAAEEEGVTLELRD  417

Query  583  FLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVK  404
            FL E WS AA   G++ G  H++N +R +  G SP+ L+DLP  L+  +AYLPLY+ECV 
Sbjct  418  FLAEEWSLAAFAAGRQIGARHHVNFMRALKRGSSPLSLQDLPLQLQATVAYLPLYKECVS  477

Query  403  AGGCLLSQRLRGQLVEAAKRL  341
              G LLSQRLRGQLVEA  RL
Sbjct  478  CAGVLLSQRLRGQLVEAVSRL  498



>ref|XP_008344056.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat protein SKIP35-like 
[Malus domestica]
Length=534

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 58/69 (84%), Gaps = 3/69 (4%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            LAA SIEILKAAGERS GSLDGVAFLL SDFLGDPAATYAVA+SIA S+DE VAPEL++F
Sbjct  454  LAALSIEILKAAGERSGGSLDGVAFLLHSDFLGDPAATYAVANSIALSDDEGVAPELKAF  513

Query  580  LHEHWSEAA  554
            L   W   A
Sbjct  514  L---WGTGA  519



>gb|EAY86310.1| hypothetical protein OsI_07683 [Oryza sativa Indica Group]
Length=522

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -1

Query  760  LAAXSIEILKAAGERSSGSLDGVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSF  581
            L A S +ILKAA  + SGS +GV+FLL S+FL D AATYAVADSIA +    +  +L  F
Sbjct  428  LEALSPQILKAARGQGSGSFEGVSFLLRSNFLNDAAATYAVADSIATTSTMDIPQDLVDF  487

Query  580  LHEHWSEAAAIEGKRQGEEHYLNLVRI  500
            L E WS+ A  EG   GE+H++ + R+
Sbjct  488  LKEQWSQTAFAEGVEAGEDHFVRITRV  514



>ref|XP_001765794.1| predicted protein [Physcomitrella patens]
 gb|EDQ69385.1| predicted protein [Physcomitrella patens]
Length=786

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 66/119 (55%), Gaps = 2/119 (2%)
 Frame = -1

Query  697  GVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHY  518
            GV   L S+FL D    Y + +++  +E     P ++  L   WS  A   G + GE H+
Sbjct  508  GVLCALHSNFLRD--KDYTLTEAVMLAELPETDPSVKMALKTEWSPKAFEAGVQAGENHF  565

Query  517  LNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRL  341
            L+ + +     SP+ + +LP  L+ AI YLPLY++C    G LLSQR RG+L+ A +R+
Sbjct  566  LSFMLVKKHARSPLRVGELPLDLQAAIGYLPLYKDCWNTPGSLLSQRQRGELIAALRRI  624



>ref|XP_001757638.1| predicted protein [Physcomitrella patens]
 gb|EDQ77695.1| predicted protein [Physcomitrella patens]
Length=559

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 78/144 (54%), Gaps = 9/144 (6%)
 Frame = -1

Query  757  AAXSIEILKAAGERSSG---SLDGVAFLLSSDFLGDPAATYAVADSIAR--SEDEAVAPE  593
             A  I+ ++AA   + G      GV   L S+FL +   T A A  +A     D +V   
Sbjct  375  TANLIQAVRAAASNTRGPPRGPQGVLCALHSNFLCNETETLAEAAKLAELPETDVSVKMA  434

Query  592  LRSFLHEHWSEAAAIEGKRQGEEHYLNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRE  413
            LRS     WS+ A  EG + G+ H+LN + +     SP+ + +LP  +++AI Y PLYR+
Sbjct  435  LRS----EWSQQAFNEGIQAGQRHFLNWMLVRKHALSPLRVGELPLEIQVAIGYFPLYRD  490

Query  412  CVKAGGCLLSQRLRGQLVEAAKRL  341
            C+   G L+SQR RG++V A ++L
Sbjct  491  CLNTPGSLISQRQRGEVVVALQQL  514



>ref|XP_001759714.1| predicted protein [Physcomitrella patens]
 gb|EDQ75626.1| predicted protein [Physcomitrella patens]
Length=676

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 79/148 (53%), Gaps = 15/148 (10%)
 Frame = -1

Query  697  GVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHY  518
            GV   L ++FL DPA T   A+ +  SE       ++  L E WS  A  EG + G+ HY
Sbjct  514  GVLLALHANFLDDPATTLREAEIL--SELPKTDHLVKRRLIEEWSPQAFNEGVKAGDAHY  571

Query  517  LNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRL-  341
            +  + +    +S    ++LP  L++AIAYLPLYR C +A G LLSQR RG+L  A   L 
Sbjct  572  MTWMLLRRRSDSG--FKELPVELQVAIAYLPLYRACSQAPGTLLSQRQRGELTTAVLHLY  629

Query  340  --SGVTLEDARQGRELLGILEHNLPTFL  263
              SG  L DA+       +LE + PT L
Sbjct  630  RGSG-KLADAK-------VLEADKPTLL  649



>ref|XP_001770027.1| predicted protein [Physcomitrella patens]
 gb|EDQ65203.1| predicted protein [Physcomitrella patens]
Length=630

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 70/119 (59%), Gaps = 2/119 (2%)
 Frame = -1

Query  697  GVAFLLSSDFLGDPAATYAVADSIARSEDEAVAPELRSFLHEHWSEAAAIEGKRQGEEHY  518
            GV   L S+FL +   T   A ++A+  +    P +++ L   WS+ A   GK+ GE H+
Sbjct  351  GVLCALHSNFLMNKDFTMNEAVTLAKLPE--TDPSVKTALRTEWSQEAFEAGKQAGERHF  408

Query  517  LNLVRIMNLGESPICLRDLPSPLRIAIAYLPLYRECVKAGGCLLSQRLRGQLVEAAKRL  341
             +++ +    +SP+ + +LP  L++AI YLPLY++C    G LLS R RG+L+ A ++L
Sbjct  409  FSVMLVRKHAKSPLRVGELPLDLQVAIGYLPLYKDCSNTPGSLLSLRQRGELLAALRQL  467



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470