BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF025G20

Length=240
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009603996.1|  PREDICTED: CSC1-like protein At1g32090           76.3    8e-14   Nicotiana tomentosiformis
ref|XP_009784323.1|  PREDICTED: CSC1-like protein At1g32090           69.7    1e-11   Nicotiana sylvestris
ref|XP_006352918.1|  PREDICTED: uncharacterized protein RSN1-like     67.4    7e-11   Solanum tuberosum [potatoes]
ref|XP_004245915.1|  PREDICTED: CSC1-like protein At1g32090           66.2    2e-10   Solanum lycopersicum
emb|CDP11732.1|  unnamed protein product                              49.3    1e-04   Coffea canephora [robusta coffee]



>ref|XP_009603996.1| PREDICTED: CSC1-like protein At1g32090 [Nicotiana tomentosiformis]
Length=809

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 42/55 (76%), Gaps = 7/55 (13%)
 Frame = -3

Query  220  NHDEDEQSQ------KVQHYEAGPPGDIFHYEYQQSEYMYHYDVESSYHH-GYHY  77
            +H+EDE SQ       VQHYE G PGD+FHYEY+Q+ ++YHYDVES YHH GYHY
Sbjct  755  HHEEDEPSQVSQTSHNVQHYEVGQPGDLFHYEYEQTSHIYHYDVESQYHHNGYHY  809



>ref|XP_009784323.1| PREDICTED: CSC1-like protein At1g32090 [Nicotiana sylvestris]
Length=815

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 42/61 (69%), Gaps = 13/61 (21%)
 Frame = -3

Query  220  NHDEDEQSQ------KVQHYEAGPPGDIFHYEYQQSEYMYHYDV------ESSYHH-GYH  80
            +H+EDE SQ       VQHYE G PGD+FHYEY+QS ++YHYDV      ES YHH GYH
Sbjct  755  HHEEDEPSQVSQTSHNVQHYEVGQPGDLFHYEYEQSNHIYHYDVESHHQHESQYHHNGYH  814

Query  79   Y  77
            Y
Sbjct  815  Y  815



>ref|XP_006352918.1| PREDICTED: uncharacterized protein RSN1-like [Solanum tuberosum]
Length=815

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 7/50 (14%)
 Frame = -3

Query  205  EQSQKVQHYEAGPPGDIFHYEYQQSEYMYHYDVESSYHH-------GYHY  77
            + S  VQHYE G PGD+FHYEY+Q+ ++YHYD ES YHH       GYHY
Sbjct  766  QTSHNVQHYEVGQPGDLFHYEYEQTSHVYHYDFESQYHHDSQYQHNGYHY  815



>ref|XP_004245915.1| PREDICTED: CSC1-like protein At1g32090 [Solanum lycopersicum]
Length=815

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 7/50 (14%)
 Frame = -3

Query  205  EQSQKVQHYEAGPPGDIFHYEYQQSEYMYHYDVESSYHH-------GYHY  77
            + S  VQHYE G PGD+FHYEY+Q+ ++YHYD +S YHH       GYHY
Sbjct  766  QTSHNVQHYEVGQPGDLFHYEYEQTSHVYHYDYQSQYHHDSQYQHSGYHY  815



>emb|CDP11732.1| unnamed protein product [Coffea canephora]
Length=798

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = -3

Query  211  EDEQSQKVQHYEAGPPGDIFHYEYQQSEYMYHYDVESSYHHGYHY  77
            ED+ S  V H+E  PP +++HY+ + S  +Y YD E SYH+ YHY
Sbjct  755  EDKPSHSVHHHEYEPPSNVYHYKAEVSSNVYEYDTE-SYHNVYHY  798



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561347857865