BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF025F14

Length=701
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009587544.1|  PREDICTED: uncharacterized protein LOC104085254  95.5    7e-20   Nicotiana tomentosiformis
ref|XP_006360448.1|  PREDICTED: uncharacterized protein LOC102591618  90.1    6e-19   
ref|XP_006344145.1|  PREDICTED: uncharacterized protein LOC102580705  91.3    3e-18   Solanum tuberosum [potatoes]
ref|XP_006360447.1|  PREDICTED: uncharacterized protein LOC102591290  90.5    3e-18   Solanum tuberosum [potatoes]
ref|XP_009795808.1|  PREDICTED: uncharacterized protein LOC104242...  90.5    4e-18   Nicotiana sylvestris
ref|XP_009782262.1|  PREDICTED: uncharacterized protein LOC104231037  88.6    2e-17   Nicotiana sylvestris
ref|XP_009795807.1|  PREDICTED: uncharacterized protein LOC104242...  87.8    4e-17   Nicotiana sylvestris
emb|CBI26998.3|  unnamed protein product                              85.9    8e-17   Vitis vinifera
ref|XP_002279484.2|  PREDICTED: uncharacterized protein LOC100244117  86.7    9e-17   Vitis vinifera
ref|XP_011076562.1|  PREDICTED: uncharacterized protein LOC105160775  86.7    9e-17   Sesamum indicum [beniseed]
ref|XP_011070785.1|  PREDICTED: uncharacterized protein LOC105156369  86.7    1e-16   Sesamum indicum [beniseed]
gb|EYU29997.1|  hypothetical protein MIMGU_mgv1a010415mg              85.9    2e-16   Erythranthe guttata [common monkey flower]
ref|XP_009587546.1|  PREDICTED: uncharacterized protein LOC104085255  85.1    2e-16   Nicotiana tomentosiformis
emb|CAN72500.1|  hypothetical protein VITISV_027274                   85.5    3e-16   Vitis vinifera
ref|XP_004236994.1|  PREDICTED: uncharacterized protein LOC101257950  85.1    3e-16   Solanum lycopersicum
ref|XP_004239412.1|  PREDICTED: uncharacterized protein LOC101244288  84.7    4e-16   Solanum lycopersicum
ref|XP_004237003.1|  PREDICTED: uncharacterized protein LOC101260633  82.8    1e-15   Solanum lycopersicum
gb|EYU40770.1|  hypothetical protein MIMGU_mgv1a010835mg              81.3    7e-15   Erythranthe guttata [common monkey flower]
ref|XP_004166843.1|  PREDICTED: uncharacterized protein LOC101226094  80.1    1e-14   
ref|XP_008446612.1|  PREDICTED: uncharacterized protein LOC103489295  80.5    2e-14   Cucumis melo [Oriental melon]
ref|XP_004135397.1|  PREDICTED: uncharacterized protein LOC101211482  80.1    2e-14   
ref|XP_011003255.1|  PREDICTED: uncharacterized protein LOC105110053  78.2    6e-14   Populus euphratica
ref|XP_011022313.1|  PREDICTED: uncharacterized protein LOC105124132  78.2    6e-14   Populus euphratica
ref|XP_002312408.2|  hypothetical protein POPTR_0008s12160g           77.8    9e-14   Populus trichocarpa [western balsam poplar]
gb|KGN52094.1|  hypothetical protein Csa_5G609800                     79.7    9e-14   Cucumis sativus [cucumbers]
emb|CDP00644.1|  unnamed protein product                              78.2    1e-13   Coffea canephora [robusta coffee]
ref|XP_010921914.1|  PREDICTED: uncharacterized protein LOC105045357  77.0    1e-13   Elaeis guineensis
ref|XP_011007676.1|  PREDICTED: uncharacterized protein LOC105113268  77.0    2e-13   Populus euphratica
ref|XP_002314852.2|  hypothetical protein POPTR_0010s13260g           77.0    2e-13   Populus trichocarpa [western balsam poplar]
gb|KJB50186.1|  hypothetical protein B456_008G158100                  77.4    2e-13   Gossypium raimondii
ref|XP_010265083.1|  PREDICTED: uncharacterized protein LOC104602914  75.5    7e-13   Nelumbo nucifera [Indian lotus]
ref|XP_010907003.1|  PREDICTED: uncharacterized protein LOC105033781  75.1    8e-13   Elaeis guineensis
ref|XP_008799251.1|  PREDICTED: diacylglycerol kinase kappa-like      75.1    9e-13   Phoenix dactylifera
ref|XP_007153450.1|  hypothetical protein PHAVU_003G036300g           74.7    1e-12   Phaseolus vulgaris [French bean]
gb|EPS70235.1|  hypothetical protein M569_04525                       70.9    2e-12   Genlisea aurea
ref|XP_010249704.1|  PREDICTED: uncharacterized protein LOC104592180  73.9    2e-12   Nelumbo nucifera [Indian lotus]
ref|XP_006605904.1|  PREDICTED: uncharacterized protein LOC100782256  73.6    4e-12   Glycine max [soybeans]
ref|XP_004497073.1|  PREDICTED: uncharacterized protein LOC101492865  70.5    5e-12   Cicer arietinum [garbanzo]
ref|XP_003535721.2|  PREDICTED: uncharacterized protein LOC100779683  72.4    5e-12   Glycine max [soybeans]
ref|XP_003525235.1|  PREDICTED: uncharacterized protein LOC100801179  70.5    6e-12   Glycine max [soybeans]
gb|ACU20234.1|  unknown                                               70.5    6e-12   Glycine max [soybeans]
ref|XP_010921901.1|  PREDICTED: uncharacterized protein LOC105045350  72.0    7e-12   Elaeis guineensis
ref|XP_003592634.1|  hypothetical protein MTR_1g110370                71.6    8e-12   Medicago truncatula
ref|XP_010907004.1|  PREDICTED: uncharacterized protein LOC105033783  71.6    9e-12   Elaeis guineensis
ref|XP_007044281.1|  Uncharacterized protein TCM_009632               72.8    9e-12   
ref|XP_009390935.1|  PREDICTED: uncharacterized protein LOC103977210  71.6    1e-11   
ref|XP_008803535.1|  PREDICTED: uncharacterized protein LOC103717072  71.6    1e-11   Phoenix dactylifera
gb|KDP20140.1|  hypothetical protein JCGZ_05909                       71.2    1e-11   Jatropha curcas
ref|XP_010264343.1|  PREDICTED: uncharacterized protein LOC104602373  72.0    1e-11   Nelumbo nucifera [Indian lotus]
ref|XP_006448443.1|  hypothetical protein CICLE_v10016320mg           71.6    1e-11   Citrus clementina [clementine]
ref|XP_002526996.1|  conserved hypothetical protein                   71.6    1e-11   Ricinus communis
ref|XP_008797797.1|  PREDICTED: uncharacterized protein LOC103712882  70.9    2e-11   Phoenix dactylifera
ref|XP_010549544.1|  PREDICTED: uncharacterized protein LOC104820683  70.9    2e-11   Tarenaya hassleriana [spider flower]
ref|XP_009409918.1|  PREDICTED: uncharacterized protein LOC103992060  70.9    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010477941.1|  PREDICTED: uncharacterized protein LOC104756966  70.5    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010254097.1|  PREDICTED: uncharacterized protein LOC104595181  70.5    3e-11   Nelumbo nucifera [Indian lotus]
gb|KJB61217.1|  hypothetical protein B456_009G347700                  71.2    3e-11   Gossypium raimondii
gb|KJB61218.1|  hypothetical protein B456_009G347700                  71.2    3e-11   Gossypium raimondii
gb|KJB61220.1|  hypothetical protein B456_009G347700                  71.2    3e-11   Gossypium raimondii
ref|XP_010916412.1|  PREDICTED: uncharacterized protein LOC105041237  70.1    3e-11   Elaeis guineensis
ref|XP_002317907.1|  hypothetical protein POPTR_0012s05150g           69.7    4e-11   Populus trichocarpa [western balsam poplar]
gb|EEE64607.1|  hypothetical protein OsJ_19459                        69.7    4e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008243261.1|  PREDICTED: uncharacterized protein LOC103341506  70.5    5e-11   Prunus mume [ume]
ref|XP_006415864.1|  hypothetical protein EUTSA_v10008407mg           70.1    5e-11   
ref|XP_008799250.1|  PREDICTED: uncharacterized protein LOC103713962  69.7    5e-11   Phoenix dactylifera
ref|XP_004971632.1|  PREDICTED: uncharacterized protein LOC101773547  69.3    6e-11   
ref|XP_009103062.1|  PREDICTED: uncharacterized protein LOC103829148  69.7    6e-11   Brassica rapa
ref|XP_002441479.1|  hypothetical protein SORBIDRAFT_09g027650        69.7    6e-11   Sorghum bicolor [broomcorn]
ref|XP_007160389.1|  hypothetical protein PHAVU_002G317700g           68.2    6e-11   Phaseolus vulgaris [French bean]
gb|KDP29438.1|  hypothetical protein JCGZ_18359                       70.1    6e-11   Jatropha curcas
ref|NP_001043921.1|  Os01g0689000                                     69.3    7e-11   
gb|EAY98934.1|  hypothetical protein OsI_20889                        69.3    7e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_008803533.1|  PREDICTED: uncharacterized protein LOC103717071  69.7    7e-11   Phoenix dactylifera
gb|KHN05554.1|  hypothetical protein glysoja_035754                   65.9    7e-11   Glycine soja [wild soybean]
gb|KHG24859.1|  hypothetical protein F383_07684                       70.1    7e-11   Gossypium arboreum [tree cotton]
ref|XP_008673758.1|  PREDICTED: uncharacterized protein LOC103649836  68.6    8e-11   Zea mays [maize]
ref|XP_010460392.1|  PREDICTED: uncharacterized protein LOC104741277  69.3    9e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010926019.1|  PREDICTED: uncharacterized protein LOC105048419  68.9    9e-11   Elaeis guineensis
ref|NP_001241159.1|  uncharacterized protein LOC100805289             68.2    1e-10   Glycine max [soybeans]
ref|NP_001174514.1|  Os05g0551350                                     68.9    1e-10   
ref|XP_010499118.1|  PREDICTED: uncharacterized protein LOC104776709  68.9    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_004515140.1|  PREDICTED: uncharacterized protein LOC101491652  68.9    1e-10   Cicer arietinum [garbanzo]
ref|XP_010688487.1|  PREDICTED: uncharacterized protein LOC104902410  68.2    1e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002890693.1|  hypothetical protein ARALYDRAFT_313393           70.9    1e-10   
ref|XP_009390227.1|  PREDICTED: uncharacterized protein LOC103976664  68.6    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010258813.1|  PREDICTED: uncharacterized protein LOC104598448  68.9    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_006304090.1|  hypothetical protein CARUB_v10009968mg           68.9    1e-10   Capsella rubella
ref|XP_002533698.1|  conserved hypothetical protein                   67.8    1e-10   Ricinus communis
emb|CDY03857.1|  BnaC07g10820D                                        68.6    2e-10   
emb|CDY24408.1|  BnaCnng04750D                                        68.2    2e-10   Brassica napus [oilseed rape]
ref|XP_008675169.1|  PREDICTED: serine/arginine repetitive matrix...  67.8    2e-10   Zea mays [maize]
ref|XP_009404510.1|  PREDICTED: uncharacterized protein LOC103987813  67.4    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008812763.1|  PREDICTED: uncharacterized protein LOC103723584  67.8    3e-10   Phoenix dactylifera
ref|XP_008445636.1|  PREDICTED: uncharacterized protein LOC103488593  67.8    3e-10   Cucumis melo [Oriental melon]
ref|XP_004969600.1|  PREDICTED: formin-like protein 5-like            67.0    4e-10   Setaria italica
ref|XP_009109878.1|  PREDICTED: uncharacterized protein LOC103835453  67.0    4e-10   Brassica rapa
ref|XP_010099253.1|  hypothetical protein L484_015442                 67.8    4e-10   
ref|XP_004138348.1|  PREDICTED: uncharacterized protein LOC101205564  67.4    5e-10   Cucumis sativus [cucumbers]
ref|XP_004512910.1|  PREDICTED: uncharacterized protein LOC101496171  66.2    5e-10   Cicer arietinum [garbanzo]
emb|CDY36111.1|  BnaA08g19370D                                        67.0    5e-10   Brassica napus [oilseed rape]
ref|XP_004248522.1|  PREDICTED: serine/arginine repetitive matrix...  68.2    5e-10   Solanum lycopersicum
ref|XP_010926018.1|  PREDICTED: uncharacterized protein LOC105048418  66.6    6e-10   Elaeis guineensis
ref|XP_011045843.1|  PREDICTED: uncharacterized protein LOC105140636  66.2    6e-10   Populus euphratica
ref|XP_008655607.1|  PREDICTED: uncharacterized protein LOC103634794  65.9    6e-10   Zea mays [maize]
ref|XP_007142930.1|  hypothetical protein PHAVU_007G029200g           66.6    7e-10   Phaseolus vulgaris [French bean]
ref|XP_006345268.1|  PREDICTED: microtubule-associated protein fu...  67.8    7e-10   Solanum tuberosum [potatoes]
ref|XP_010551248.1|  PREDICTED: uncharacterized protein LOC104821917  67.4    8e-10   Tarenaya hassleriana [spider flower]
ref|XP_007154144.1|  hypothetical protein PHAVU_003G094100g           65.5    8e-10   Phaseolus vulgaris [French bean]
emb|CDM83881.1|  unnamed protein product                              65.9    9e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009415790.1|  PREDICTED: uncharacterized protein LOC103996587  65.9    9e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002456171.1|  hypothetical protein SORBIDRAFT_03g031600        66.2    9e-10   Sorghum bicolor [broomcorn]
emb|CDY58598.1|  BnaA07g36930D                                        66.6    1e-09   Brassica napus [oilseed rape]
ref|XP_008389276.1|  PREDICTED: uncharacterized protein LOC103451638  66.6    1e-09   
ref|XP_010549117.1|  PREDICTED: uncharacterized protein LOC104820388  65.9    1e-09   Tarenaya hassleriana [spider flower]
dbj|BAK05502.1|  predicted protein                                    65.5    1e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009403973.1|  PREDICTED: uncharacterized protein LOC103987404  65.9    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI15476.3|  unnamed protein product                              63.5    1e-09   Vitis vinifera
ref|XP_010532317.1|  PREDICTED: uncharacterized protein LOC104808336  66.6    1e-09   Tarenaya hassleriana [spider flower]
gb|KCW86313.1|  hypothetical protein EUGRSUZ_B03003                   66.2    2e-09   Eucalyptus grandis [rose gum]
ref|XP_003567946.1|  PREDICTED: formin-like protein 14 isoform X2     64.7    2e-09   Brachypodium distachyon [annual false brome]
dbj|BAK06052.1|  predicted protein                                    64.7    2e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008654594.1|  PREDICTED: uncharacterized protein LOC100273...  65.1    2e-09   Zea mays [maize]
ref|XP_010066709.1|  PREDICTED: uncharacterized protein LOC104453783  65.9    2e-09   Eucalyptus grandis [rose gum]
ref|XP_003618367.1|  hypothetical protein MTR_6g008660                65.1    2e-09   
ref|XP_002278683.1|  PREDICTED: uncharacterized protein LOC100259406  63.9    3e-09   Vitis vinifera
ref|XP_009389592.1|  PREDICTED: uncharacterized protein LOC103976124  64.3    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009591074.1|  PREDICTED: uncharacterized protein LOC104088143  65.5    3e-09   Nicotiana tomentosiformis
ref|XP_009390225.1|  PREDICTED: uncharacterized protein LOC103976663  64.3    4e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390934.1|  PREDICTED: uncharacterized protein LOC103977209  64.7    4e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010534217.1|  PREDICTED: uncharacterized protein LOC104809833  64.3    4e-09   Tarenaya hassleriana [spider flower]
ref|XP_009383650.1|  PREDICTED: uncharacterized protein LOC103971372  63.2    4e-09   
gb|KJB22887.1|  hypothetical protein B456_004G071800                  64.7    5e-09   Gossypium raimondii
ref|XP_008339652.1|  PREDICTED: uncharacterized protein LOC103402678  64.7    5e-09   Malus domestica [apple tree]
ref|XP_009380290.1|  PREDICTED: uncharacterized protein LOC103968712  64.3    6e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388794.1|  PREDICTED: uncharacterized protein LOC103975535  63.2    6e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009356989.1|  PREDICTED: uncharacterized protein LOC103947762  64.7    6e-09   Pyrus x bretschneideri [bai li]
ref|NP_564231.1|  uncharacterized protein                             63.9    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010096359.1|  hypothetical protein L484_021107                 63.9    7e-09   Morus notabilis
ref|XP_002461468.1|  hypothetical protein SORBIDRAFT_02g003140        63.5    8e-09   
ref|XP_003620440.1|  hypothetical protein MTR_6g083920                63.2    8e-09   Medicago truncatula
ref|XP_009798000.1|  PREDICTED: ankyrin-2                             64.3    9e-09   Nicotiana sylvestris
ref|XP_008656010.1|  PREDICTED: atherin-like                          63.5    9e-09   Zea mays [maize]
ref|XP_004961314.1|  PREDICTED: protein enabled homolog               63.5    9e-09   Setaria italica
gb|KJB22886.1|  hypothetical protein B456_004G071800                  64.3    1e-08   Gossypium raimondii
ref|XP_009107337.1|  PREDICTED: uncharacterized protein LOC103832982  62.0    1e-08   Brassica rapa
ref|XP_011017319.1|  PREDICTED: uncharacterized protein LOC105120...  63.5    1e-08   Populus euphratica
ref|XP_006386535.1|  hypothetical protein POPTR_0002s13700g           63.5    1e-08   
ref|XP_002302487.1|  hypothetical protein POPTR_0002s13700g           63.5    1e-08   
ref|XP_011017318.1|  PREDICTED: uncharacterized protein LOC105120...  63.5    1e-08   Populus euphratica
ref|XP_006375105.1|  hypothetical protein POPTR_0014s04430g           63.5    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_011031753.1|  PREDICTED: probable serine/threonine-protein...  63.5    1e-08   Populus euphratica
ref|XP_009392921.1|  PREDICTED: uncharacterized protein LOC103978...  62.0    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY40606.1|  BnaC06g02220D                                        61.2    2e-08   Brassica napus [oilseed rape]
emb|CDY16463.1|  BnaA08g03040D                                        61.2    2e-08   Brassica napus [oilseed rape]
ref|NP_188458.1|  uncharacterized protein                             61.6    2e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CDX77286.1|  BnaC08g03310D                                        60.8    3e-08   
ref|XP_009147945.1|  PREDICTED: uncharacterized protein LOC103871446  60.8    3e-08   Brassica rapa
ref|XP_008812761.1|  PREDICTED: uncharacterized protein LOC103723583  62.0    3e-08   Phoenix dactylifera
emb|CDX93694.1|  BnaA06g03540D                                        60.8    3e-08   
gb|KFK39170.1|  hypothetical protein AALP_AA3G209200                  61.2    3e-08   Arabis alpina [alpine rockcress]
ref|XP_003635203.1|  PREDICTED: uncharacterized protein LOC100853295  61.6    3e-08   Vitis vinifera
ref|XP_008797798.1|  PREDICTED: uncharacterized protein LOC103712883  62.0    4e-08   Phoenix dactylifera
gb|AFK44975.1|  unknown                                               61.2    4e-08   Lotus japonicus
pir||F86383  hypothetical protein F4F7.22 - Arabidopsis thaliana      63.2    4e-08
ref|XP_004490132.1|  PREDICTED: uncharacterized protein LOC101493143  61.2    4e-08   Cicer arietinum [garbanzo]
gb|AAG28819.2|AC079374_22  unknown protein                            62.8    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008238431.1|  PREDICTED: uncharacterized protein LOC103337059  60.5    8e-08   Prunus mume [ume]
emb|CBI22411.3|  unnamed protein product                              58.5    8e-08   Vitis vinifera
ref|XP_007209536.1|  hypothetical protein PRUPE_ppa010718mg           60.5    8e-08   
ref|XP_010544582.1|  PREDICTED: uncharacterized protein LOC104817196  61.2    1e-07   Tarenaya hassleriana [spider flower]
emb|CDY24456.1|  BnaC05g34980D                                        59.7    1e-07   Brassica napus [oilseed rape]
ref|XP_003616744.1|  hypothetical protein MTR_5g083820                60.1    1e-07   
ref|XP_006406620.1|  hypothetical protein EUTSA_v10021480mg           60.1    1e-07   Eutrema salsugineum [saltwater cress]
gb|AES99702.2|  DUF1639 family protein                                60.1    1e-07   Medicago truncatula
ref|XP_007052276.1|  Uncharacterized protein TCM_005685               60.8    1e-07   
emb|CBI16671.3|  unnamed protein product                              58.2    1e-07   Vitis vinifera
ref|XP_002511612.1|  conserved hypothetical protein                   60.8    1e-07   
ref|XP_009380737.1|  PREDICTED: uncharacterized protein LOC103969023  59.3    1e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010232954.1|  PREDICTED: homeobox even-skipped homolog pro...  59.7    1e-07   Brachypodium distachyon [annual false brome]
gb|EPS72660.1|  hypothetical protein M569_02097                       57.0    2e-07   Genlisea aurea
emb|CAN68111.1|  hypothetical protein VITISV_000765                   60.8    2e-07   Vitis vinifera
ref|XP_010461705.1|  PREDICTED: uncharacterized protein LOC104742402  58.9    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_003614600.1|  hypothetical protein MTR_5g056040                60.1    2e-07   Medicago truncatula
ref|XP_007155691.1|  hypothetical protein PHAVU_003G223000g           60.1    2e-07   Phaseolus vulgaris [French bean]
ref|XP_010479306.1|  PREDICTED: uncharacterized protein LOC104758179  58.5    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_009409929.1|  PREDICTED: uncharacterized protein LOC103992071  58.9    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009145905.1|  PREDICTED: uncharacterized protein LOC103869577  58.5    3e-07   Brassica rapa
gb|KFK26684.1|  hypothetical protein AALP_AA8G279800                  57.8    3e-07   Arabis alpina [alpine rockcress]
emb|CDX92227.1|  BnaA05g21800D                                        58.2    5e-07   
ref|XP_010465919.1|  PREDICTED: uncharacterized protein LOC104746198  58.2    5e-07   Camelina sativa [gold-of-pleasure]
emb|CDX84983.1|  BnaC05g20720D                                        58.5    5e-07   
ref|XP_004508940.1|  PREDICTED: uncharacterized protein LOC101492028  58.2    6e-07   Cicer arietinum [garbanzo]
gb|KDO85566.1|  hypothetical protein CISIN_1g022095mg                 58.9    6e-07   Citrus sinensis [apfelsine]
ref|XP_006445387.1|  hypothetical protein CICLE_v10021338mg           58.9    6e-07   
emb|CDY51938.1|  BnaAnng11150D                                        57.0    7e-07   Brassica napus [oilseed rape]
ref|XP_006445388.1|  hypothetical protein CICLE_v10021338mg           58.9    7e-07   Citrus clementina [clementine]
ref|XP_002466732.1|  hypothetical protein SORBIDRAFT_01g013085        56.6    7e-07   
gb|KDO85567.1|  hypothetical protein CISIN_1g022095mg                 58.9    7e-07   Citrus sinensis [apfelsine]
ref|XP_003614596.1|  hypothetical protein MTR_5g055990                58.9    7e-07   
ref|XP_006391149.1|  hypothetical protein EUTSA_v10018875mg           58.9    7e-07   
emb|CDY42113.1|  BnaA09g28470D                                        57.8    8e-07   Brassica napus [oilseed rape]
ref|XP_009115304.1|  PREDICTED: uncharacterized protein LOC103840559  58.2    1e-06   Brassica rapa
ref|XP_010500418.1|  PREDICTED: uncharacterized protein LOC104777796  56.6    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009135574.1|  PREDICTED: uncharacterized protein LOC103859748  56.2    1e-06   Brassica rapa
gb|KJB40993.1|  hypothetical protein B456_007G086800                  57.8    1e-06   Gossypium raimondii
ref|XP_004510121.1|  PREDICTED: histone-lysine N-methyltransferas...  57.0    1e-06   
ref|XP_008437045.1|  PREDICTED: uncharacterized protein LOC103482589  57.4    1e-06   Cucumis melo [Oriental melon]
ref|XP_004152391.1|  PREDICTED: uncharacterized protein LOC101222282  57.4    1e-06   Cucumis sativus [cucumbers]
gb|KJB40995.1|  hypothetical protein B456_007G086800                  57.8    1e-06   Gossypium raimondii
ref|XP_003608674.1|  hypothetical protein MTR_4g100570                57.0    2e-06   Medicago truncatula
ref|XP_003614606.1|  hypothetical protein MTR_5g056110                57.0    2e-06   Medicago truncatula
ref|XP_003525577.1|  PREDICTED: histone-lysine N-methyltransferas...  57.0    2e-06   Glycine max [soybeans]
emb|CDX75964.1|  BnaC03g40470D                                        57.8    2e-06   
gb|KHG28078.1|  hypothetical protein F383_15853                       57.4    2e-06   Gossypium arboreum [tree cotton]
ref|XP_010487745.1|  PREDICTED: uncharacterized protein LOC104765689  56.6    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010916411.1|  PREDICTED: uncharacterized protein LOC105041...  57.0    3e-06   
gb|KJB51827.1|  hypothetical protein B456_008G233300                  55.8    3e-06   Gossypium raimondii
ref|XP_010506750.1|  PREDICTED: uncharacterized protein LOC104783308  56.2    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010916410.1|  PREDICTED: uncharacterized protein LOC105041...  56.6    3e-06   Elaeis guineensis
ref|XP_004969599.1|  PREDICTED: dual specificity protein phosphat...  55.8    3e-06   Setaria italica
ref|XP_002888655.1|  hypothetical protein ARALYDRAFT_894597           56.2    4e-06   Arabidopsis lyrata subsp. lyrata
gb|KDP39908.1|  hypothetical protein JCGZ_03439                       56.6    4e-06   Jatropha curcas
ref|XP_006305620.1|  hypothetical protein CARUB_v10010307mg           55.5    4e-06   
ref|XP_006402583.1|  hypothetical protein EUTSA_v10006081mg           56.2    4e-06   
ref|NP_175309.1|  uncharacterized protein                             54.7    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006402584.1|  hypothetical protein EUTSA_v10006081mg           56.6    5e-06   Eutrema salsugineum [saltwater cress]
gb|KHG00791.1|  Treacle                                               55.1    5e-06   Gossypium arboreum [tree cotton]
gb|KJB25523.1|  hypothetical protein B456_004G196000                  55.5    5e-06   Gossypium raimondii
gb|KHF98922.1|  hypothetical protein F383_19218                       55.5    7e-06   Gossypium arboreum [tree cotton]
ref|XP_006440252.1|  hypothetical protein CICLE_v10022000mg           54.7    8e-06   Citrus clementina [clementine]
ref|XP_004969598.1|  PREDICTED: dual specificity protein phosphat...  55.1    9e-06   
ref|XP_010651199.1|  PREDICTED: uncharacterized protein LOC104879578  54.3    1e-05   Vitis vinifera
gb|EYU31915.1|  hypothetical protein MIMGU_mgv1a015714mg              53.1    1e-05   Erythranthe guttata [common monkey flower]
ref|XP_006302663.1|  hypothetical protein CARUB_v10020767mg           55.1    1e-05   
ref|XP_011093280.1|  PREDICTED: uncharacterized protein LOC105173283  55.5    1e-05   Sesamum indicum [beniseed]
ref|XP_003549926.1|  PREDICTED: uncharacterized protein LOC100812...  54.7    1e-05   Glycine max [soybeans]
ref|XP_006477140.1|  PREDICTED: uncharacterized protein LOC102618...  54.3    1e-05   Citrus sinensis [apfelsine]
ref|XP_003569589.1|  PREDICTED: formin-like protein 15                54.3    1e-05   Brachypodium distachyon [annual false brome]
gb|KDO61351.1|  hypothetical protein CISIN_1g027940mg                 53.9    2e-05   Citrus sinensis [apfelsine]
ref|XP_009112799.1|  PREDICTED: uncharacterized protein LOC103838123  53.1    2e-05   Brassica rapa
ref|XP_009105379.1|  PREDICTED: uncharacterized protein LOC103831248  53.1    2e-05   Brassica rapa
ref|XP_009345057.1|  PREDICTED: uncharacterized protein LOC103936895  54.3    2e-05   Pyrus x bretschneideri [bai li]
ref|XP_010677085.1|  PREDICTED: uncharacterized protein LOC104892783  53.9    2e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008374055.1|  PREDICTED: uncharacterized protein LOC103437364  54.3    2e-05   
ref|XP_007203454.1|  hypothetical protein PRUPE_ppa022138mg           54.3    2e-05   
emb|CDY18514.1|  BnaA01g26810D                                        53.1    2e-05   Brassica napus [oilseed rape]
emb|CDP20668.1|  unnamed protein product                              53.9    3e-05   Coffea canephora [robusta coffee]
ref|XP_003592633.1|  hypothetical protein MTR_1g110360                53.5    3e-05   
ref|XP_007039763.1|  Uncharacterized protein isoform 1                53.1    3e-05   
ref|XP_009413668.1|  PREDICTED: uncharacterized protein LOC103994930  53.5    3e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007039766.1|  Uncharacterized protein isoform 4                53.1    3e-05   
ref|XP_009413672.1|  PREDICTED: uncharacterized protein LOC103994935  53.5    3e-05   
ref|XP_002531462.1|  conserved hypothetical protein                   53.5    4e-05   Ricinus communis
ref|XP_002891452.1|  hypothetical protein ARALYDRAFT_474015           52.0    5e-05   Arabidopsis lyrata subsp. lyrata
gb|EEC71301.1|  hypothetical protein OsI_03325                        52.4    5e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_010469190.1|  PREDICTED: uncharacterized protein LOC104749295  53.1    6e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010469188.1|  PREDICTED: uncharacterized protein LOC104749294  53.1    6e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010413562.1|  PREDICTED: uncharacterized protein LOC104699865  53.1    6e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010512363.1|  PREDICTED: uncharacterized protein LOC104788314  53.1    6e-05   Camelina sativa [gold-of-pleasure]
ref|NP_001043919.1|  Os01g0688600                                     52.0    6e-05   
ref|XP_006646220.1|  PREDICTED: heat shock cognate 70 kDa protein...  53.5    7e-05   
ref|XP_010104863.1|  hypothetical protein L484_024064                 52.8    7e-05   
emb|CDY01909.1|  BnaC06g29490D                                        52.0    7e-05   
ref|XP_008232421.1|  PREDICTED: uncharacterized protein LOC103331568  52.8    8e-05   Prunus mume [ume]
ref|XP_006293212.1|  hypothetical protein CARUB_v10019533mg           52.8    8e-05   Capsella rubella
gb|KCW71943.1|  hypothetical protein EUGRSUZ_E00401                   52.0    1e-04   Eucalyptus grandis [rose gum]
ref|XP_010055470.1|  PREDICTED: uncharacterized protein LOC104443663  52.0    1e-04   Eucalyptus grandis [rose gum]
gb|KCW77816.1|  hypothetical protein EUGRSUZ_D02104                   50.8    1e-04   Eucalyptus grandis [rose gum]
ref|XP_009116723.1|  PREDICTED: uncharacterized protein LOC103841891  52.0    1e-04   Brassica rapa
ref|XP_011089828.1|  PREDICTED: uncharacterized protein LOC105170663  52.0    1e-04   Sesamum indicum [beniseed]
ref|XP_008355574.1|  PREDICTED: uncharacterized protein LOC103419...  51.6    2e-04   Malus domestica [apple tree]
ref|XP_009350885.1|  PREDICTED: uncharacterized protein LOC103942...  51.2    2e-04   Pyrus x bretschneideri [bai li]
ref|XP_004299406.1|  PREDICTED: uncharacterized protein LOC101293977  51.2    2e-04   Fragaria vesca subsp. vesca
emb|CAB81827.1|  putative protein                                     51.6    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567099.2|  uncharacterized protein                             51.2    2e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CDY41166.1|  BnaA09g38490D                                        51.6    3e-04   Brassica napus [oilseed rape]
emb|CDX71813.1|  BnaC08g30610D                                        51.2    3e-04   
ref|XP_003567006.2|  PREDICTED: ras/Rap GTPase-activating protein...  50.1    3e-04   Brachypodium distachyon [annual false brome]
gb|KEH39943.1|  DUF1639 family protein                                50.8    3e-04   Medicago truncatula
ref|XP_010415454.1|  PREDICTED: uncharacterized protein LOC104701...  50.4    4e-04   
ref|NP_564928.1|  uncharacterized protein                             50.4    4e-04   
ref|XP_004498919.1|  PREDICTED: uncharacterized membrane protein ...  50.8    4e-04   
ref|XP_009350887.1|  PREDICTED: uncharacterized protein LOC103942...  50.1    4e-04   
ref|XP_010054821.1|  PREDICTED: WAS/WASL-interacting protein fami...  50.4    4e-04   
gb|KFK41248.1|  hypothetical protein AALP_AA2G104700                  50.1    4e-04   
ref|XP_008355575.1|  PREDICTED: uncharacterized protein LOC103419...  50.1    4e-04   
ref|XP_002876553.1|  hypothetical protein ARALYDRAFT_486516           50.4    4e-04   
emb|CDY65949.1|  BnaC02g45680D                                        50.4    5e-04   
gb|EMT22245.1|  hypothetical protein F775_30060                       50.1    5e-04   
ref|XP_004137319.1|  PREDICTED: uncharacterized protein LOC101214785  50.1    5e-04   
gb|KHN11403.1|  hypothetical protein glysoja_015298                   47.0    6e-04   
ref|XP_004961312.1|  PREDICTED: mucin-1-like isoform X1               49.3    7e-04   
ref|XP_010915123.1|  PREDICTED: uncharacterized protein LOC105040337  49.3    7e-04   
gb|EPS65347.1|  hypothetical protein M569_09426                       48.1    7e-04   
ref|NP_001142799.1|  hypothetical protein                             48.9    8e-04   
gb|EPS59705.1|  hypothetical protein M569_15101                       47.0    0.001   



>ref|XP_009587544.1| PREDICTED: uncharacterized protein LOC104085254 [Nicotiana tomentosiformis]
Length=265

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EKR R KFSVPL++REIEEDFMA++G RP RRPKKR KLVQ++LDTLFPGLWL+EITPDL
Sbjct  199  EKRQRVKFSVPLSRREIEEDFMAMVGHRPHRRPKKRAKLVQKNLDTLFPGLWLTEITPDL  258

Query  371  YKVPDDH  351
            YKVP+D 
Sbjct  259  YKVPEDQ  265



>ref|XP_006360448.1| PREDICTED: uncharacterized protein LOC102591618 [Solanum tuberosum]
Length=136

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EKR R KFSVPL++REI+EDFMA++G RP RRPKKRPKLVQ++LDT+FPGLWL+EIT D+
Sbjct  70   EKRQRVKFSVPLSRREIDEDFMAMVGHRPLRRPKKRPKLVQKNLDTIFPGLWLTEITADM  129

Query  371  YKVPDDH  351
            YKVPDD 
Sbjct  130  YKVPDDQ  136



>ref|XP_006344145.1| PREDICTED: uncharacterized protein LOC102580705 [Solanum tuberosum]
Length=291

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EKR R  FSV L +REIEEDFMA++G RPPRRPKKR K+VQ++LDTLFPGLWL+EITPDL
Sbjct  225  EKRKRTNFSVSLGRREIEEDFMAMVGHRPPRRPKKRAKMVQKNLDTLFPGLWLTEITPDL  284

Query  371  YKVPDDH  351
            YKVPDD 
Sbjct  285  YKVPDDQ  291



>ref|XP_006360447.1| PREDICTED: uncharacterized protein LOC102591290 [Solanum tuberosum]
Length=257

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EKR R K+SVPL+++EIEEDFMA++G RPPRRP+KR KLVQ++LDTLFPGLWL+EIT DL
Sbjct  191  EKRQRVKYSVPLSRKEIEEDFMAMIGHRPPRRPRKRAKLVQKNLDTLFPGLWLTEITADL  250

Query  371  YKVPDDH  351
            YKVP+D 
Sbjct  251  YKVPEDQ  257



>ref|XP_009795808.1| PREDICTED: uncharacterized protein LOC104242454 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009795809.1| PREDICTED: uncharacterized protein LOC104242454 isoform X2 [Nicotiana 
sylvestris]
Length=267

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EKR R KFSVPL++ EIEEDFMA++G RPPRRPKKR K VQ++LDTLFPGLWL+EITPDL
Sbjct  201  EKRQRVKFSVPLSRGEIEEDFMAMVGHRPPRRPKKRAKFVQKNLDTLFPGLWLTEITPDL  260

Query  371  YKVPDDH  351
            YKVP+D 
Sbjct  261  YKVPEDQ  267



>ref|XP_009782262.1| PREDICTED: uncharacterized protein LOC104231037 [Nicotiana sylvestris]
 ref|XP_009782263.1| PREDICTED: uncharacterized protein LOC104231037 [Nicotiana sylvestris]
 ref|XP_009782264.1| PREDICTED: uncharacterized protein LOC104231037 [Nicotiana sylvestris]
Length=278

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EKR+R KFSVPL+++EIEEDFM ++G RPPRRPKKR K VQ++LDTLFPGLWL+EIT DL
Sbjct  212  EKRERVKFSVPLSRKEIEEDFMDMVGHRPPRRPKKRAKFVQKNLDTLFPGLWLTEITADL  271

Query  371  YKVPDDH  351
            YKVPDD 
Sbjct  272  YKVPDDQ  278



>ref|XP_009795807.1| PREDICTED: uncharacterized protein LOC104242454 isoform X1 [Nicotiana 
sylvestris]
Length=284

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EKR R KFSVPL++ EIEEDFMA++G RPPRRPKKR K VQ++LDTLFPGLWL+EITPDL
Sbjct  201  EKRQRVKFSVPLSRGEIEEDFMAMVGHRPPRRPKKRAKFVQKNLDTLFPGLWLTEITPDL  260

Query  371  YKVPDDH  351
            +KVP D 
Sbjct  261  FKVPKDQ  267



>emb|CBI26998.3| unnamed protein product [Vitis vinifera]
Length=209

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK++RAKFSV L+++EIEEDFMAI G RP RRPKKR K VQ+ LDTLFPGLWL+E+TPD 
Sbjct  138  EKKERAKFSVSLSRQEIEEDFMAITGHRPARRPKKRAKNVQKQLDTLFPGLWLTEVTPDS  197

Query  371  YKVPD  357
            YKVPD
Sbjct  198  YKVPD  202



>ref|XP_002279484.2| PREDICTED: uncharacterized protein LOC100244117 [Vitis vinifera]
Length=259

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK++RAKFSV L+++EIEEDFMAI G RP RRPKKR K VQ+ LDTLFPGLWL+E+TPD 
Sbjct  188  EKKERAKFSVSLSRQEIEEDFMAITGHRPARRPKKRAKNVQKQLDTLFPGLWLTEVTPDS  247

Query  371  YKVPD  357
            YKVPD
Sbjct  248  YKVPD  252



>ref|XP_011076562.1| PREDICTED: uncharacterized protein LOC105160775 [Sesamum indicum]
Length=312

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EKR+RAKFSV L KR+IEEDF+AI+G R PRRPKKR K++QR LDTLFPG+WL E+TPD+
Sbjct  245  EKRERAKFSVSLCKRDIEEDFLAIVGHRLPRRPKKRAKIIQRQLDTLFPGVWLIEVTPDM  304

Query  371  YKVPD  357
            YKVP+
Sbjct  305  YKVPE  309



>ref|XP_011070785.1| PREDICTED: uncharacterized protein LOC105156369 [Sesamum indicum]
Length=311

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EKR+RAKFSVPLAKREIEEDF A++G RPPRRPKKR K+VQ+ LDTLFPGLWL+E+T D+
Sbjct  244  EKRERAKFSVPLAKREIEEDFFAMVGHRPPRRPKKRAKIVQKQLDTLFPGLWLTEVTADM  303

Query  371  YKV  363
            YKV
Sbjct  304  YKV  306



>gb|EYU29997.1| hypothetical protein MIMGU_mgv1a010415mg [Erythranthe guttata]
Length=313

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EKR+R KFSVPL+KREIE+DF A++G RPPRRPKKR + VQR LDTLFPGLWL+E+TPD+
Sbjct  246  EKREREKFSVPLSKREIEDDFFAMVGHRPPRRPKKRARFVQRQLDTLFPGLWLTEVTPDM  305

Query  371  YKV  363
            YKV
Sbjct  306  YKV  308



>ref|XP_009587546.1| PREDICTED: uncharacterized protein LOC104085255 [Nicotiana tomentosiformis]
Length=274

 Score = 85.1 bits (209),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EKR+R KFSVPL+++EIE+DFM ++G RPPRRPKKR K VQ++LDT FPGLWL+EIT DL
Sbjct  208  EKRERVKFSVPLSRKEIEDDFMDMVGHRPPRRPKKRAKFVQKNLDTSFPGLWLTEITADL  267

Query  371  YKVPDDH  351
            YKVPDD 
Sbjct  268  YKVPDDQ  274


 Score = 27.3 bits (59),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = -3

Query  690  GGSSRGLNIDVTNPNVSPSRTTDNKSP  610
            GGS  GL I+V   N S    T+NKSP
Sbjct  163  GGSKGGLKIEVNRANASSPLRTENKSP  189



>emb|CAN72500.1| hypothetical protein VITISV_027274 [Vitis vinifera]
Length=300

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK++RAKFSV L+++EIEEDFMA  G RP RRPKKR K VQ+ LDTLFPGLWL+E+TPD 
Sbjct  145  EKKERAKFSVSLSRQEIEEDFMAXTGHRPARRPKKRAKXVQKQLDTLFPGLWLTEVTPDS  204

Query  371  YKVPD  357
            YKVPD
Sbjct  205  YKVPD  209



>ref|XP_004236994.1| PREDICTED: uncharacterized protein LOC101257950 [Solanum lycopersicum]
Length=267

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK+ + KFSVPL++REI+EDFMA+ G RPPRRPKKRP+LVQ++LD +FPGLWL+EIT D+
Sbjct  201  EKKQKVKFSVPLSRREIDEDFMAMAGHRPPRRPKKRPRLVQKNLDMIFPGLWLTEITADM  260

Query  371  YKVPDDH  351
            YKVPDD 
Sbjct  261  YKVPDDQ  267



>ref|XP_004239412.1| PREDICTED: uncharacterized protein LOC101244288 [Solanum lycopersicum]
Length=290

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EKR +  FS+ L + EIEEDFMA++G RPPRRPKKR K+VQ++LDT+FPGLWL+EITPDL
Sbjct  224  EKRKKKNFSISLGRIEIEEDFMAMIGHRPPRRPKKRAKMVQKNLDTIFPGLWLTEITPDL  283

Query  371  YKVPDDH  351
            YKVPDD 
Sbjct  284  YKVPDDQ  290



>ref|XP_004237003.1| PREDICTED: uncharacterized protein LOC101260633 [Solanum lycopersicum]
Length=259

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK+ R K+SV L+++EIEEDF A++G RPPRRPKKR +LVQ++LDTLFPGLWL+EIT DL
Sbjct  193  EKKQRVKYSVSLSRKEIEEDFTAMIGHRPPRRPKKRARLVQKNLDTLFPGLWLTEITADL  252

Query  371  YKVPDDH  351
            YKVP+D 
Sbjct  253  YKVPEDQ  259



>gb|EYU40770.1| hypothetical protein MIMGU_mgv1a010835mg [Erythranthe guttata]
Length=300

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EKR+R KF+V L+KR++EEDF++++G RPPRRPKKR K+VQR LDTLFPGLWL+E+TPD+
Sbjct  233  EKRERPKFTVALSKRDVEEDFLSMVGHRPPRRPKKRAKIVQRQLDTLFPGLWLTEVTPDM  292

Query  371  YKV  363
            YKV
Sbjct  293  YKV  295



>ref|XP_004166843.1| PREDICTED: uncharacterized protein LOC101226094 [Cucumis sativus]
Length=269

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK++R KFSV L+K+EIEEDFMA++ +RPPRRPKKRP++VQ  +DTLFPGLWL+EITPDL
Sbjct  198  EKKEREKFSVSLSKKEIEEDFMAMIERRPPRRPKKRPRIVQNQMDTLFPGLWLTEITPDL  257

Query  371  YKVPD  357
            Y+VP+
Sbjct  258  YEVPE  262



>ref|XP_008446612.1| PREDICTED: uncharacterized protein LOC103489295 [Cucumis melo]
Length=310

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK++R KFSV L+K+EIEEDFMA++ +RPPRRPKKRP++VQ  +DTLFPGLWL+EITPDL
Sbjct  239  EKKEREKFSVSLSKKEIEEDFMAMIERRPPRRPKKRPRIVQNQMDTLFPGLWLTEITPDL  298

Query  371  YKVPD  357
            Y+VP+
Sbjct  299  YEVPE  303



>ref|XP_004135397.1| PREDICTED: uncharacterized protein LOC101211482 [Cucumis sativus]
Length=302

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK++R KFSV L+K+EIEEDFMA++ +RPPRRPKKRP++VQ  +DTLFPGLWL+EITPDL
Sbjct  231  EKKEREKFSVSLSKKEIEEDFMAMIERRPPRRPKKRPRIVQNQMDTLFPGLWLTEITPDL  290

Query  371  YKVPD  357
            Y+VP+
Sbjct  291  YEVPE  295



>ref|XP_011003255.1| PREDICTED: uncharacterized protein LOC105110053 [Populus euphratica]
Length=278

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            +++RAKFSVPL+K+EIEEDFM +L QRP RRPKKRP++VQ+ +D LFPGLWL+EIT D Y
Sbjct  208  EKERAKFSVPLSKKEIEEDFMVMLCQRPARRPKKRPRIVQKQMDALFPGLWLAEITVDTY  267

Query  368  KVPD  357
            KVP+
Sbjct  268  KVPE  271



>ref|XP_011022313.1| PREDICTED: uncharacterized protein LOC105124132 [Populus euphratica]
Length=278

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            +++RAKFSVPL+K+EIEEDFM +L QRP RRPKKRP++VQ+ +D LFPGLWL+EIT D Y
Sbjct  208  EKERAKFSVPLSKKEIEEDFMVMLCQRPARRPKKRPRIVQKQMDALFPGLWLAEITVDTY  267

Query  368  KVPD  357
            KVP+
Sbjct  268  KVPE  271



>ref|XP_002312408.2| hypothetical protein POPTR_0008s12160g [Populus trichocarpa]
 gb|EEE89775.2| hypothetical protein POPTR_0008s12160g [Populus trichocarpa]
Length=280

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            ++++RAKFSVPL+K+EIEEDFM +L QRP RRPKKRP++VQ+ +D LFPGLWL+E+T D 
Sbjct  209  KEKERAKFSVPLSKKEIEEDFMVMLCQRPARRPKKRPRIVQKQMDALFPGLWLAEVTVDT  268

Query  371  YKVPD  357
            YKVP+
Sbjct  269  YKVPE  273



>gb|KGN52094.1| hypothetical protein Csa_5G609800 [Cucumis sativus]
Length=489

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK++R KFSV L+K+EIEEDFMA++ +RPPRRPKKRP++VQ  +DTLFPGLWL+EITPDL
Sbjct  244  EKKEREKFSVSLSKKEIEEDFMAMIERRPPRRPKKRPRIVQNQMDTLFPGLWLTEITPDL  303

Query  371  YKVPD  357
            Y+VP+
Sbjct  304  YEVPE  308



>emb|CDP00644.1| unnamed protein product [Coffea canephora]
Length=326

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK++RAKFSV + ++EIEEDF+AI G+RPPRRP+KR K +Q++LDTLFPGLWL EIT ++
Sbjct  260  EKKERAKFSVSITRQEIEEDFLAIAGRRPPRRPQKRSKYIQKNLDTLFPGLWLIEITAEM  319

Query  371  YKVPD  357
            YKVP+
Sbjct  320  YKVPE  324



>ref|XP_010921914.1| PREDICTED: uncharacterized protein LOC105045357 [Elaeis guineensis]
Length=263

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            KR+R KFSV L   EIEED  A+ G RP RRPKKRP++VQ+ LD+LFPGLWLSEIT D+Y
Sbjct  199  KRERPKFSVALTPEEIEEDIYAVTGSRPRRRPKKRPRIVQKQLDSLFPGLWLSEITADMY  258

Query  368  KVPDD  354
            KVPDD
Sbjct  259  KVPDD  263



>ref|XP_011007676.1| PREDICTED: uncharacterized protein LOC105113268 [Populus euphratica]
Length=280

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            ++++R  FSVPL+K+EIEEDFMA+LG RP RRPKKRP++VQ+ +D LFPGLWLSE+T D 
Sbjct  209  KEKERVVFSVPLSKKEIEEDFMAMLGHRPSRRPKKRPRIVQKQMDALFPGLWLSEVTVDN  268

Query  371  YKVPD  357
            YKVP+
Sbjct  269  YKVPE  273



>ref|XP_002314852.2| hypothetical protein POPTR_0010s13260g [Populus trichocarpa]
 gb|EEF01023.2| hypothetical protein POPTR_0010s13260g [Populus trichocarpa]
Length=290

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            ++++R  FSVPL+K+EIEEDFMA+LG RP RRPKKRP++VQ+ +D LFPGLWLSE+T D 
Sbjct  219  KEKERVVFSVPLSKKEIEEDFMAMLGHRPSRRPKKRPRIVQKQMDALFPGLWLSEVTVDN  278

Query  371  YKVPD  357
            YKVP+
Sbjct  279  YKVPE  283



>gb|KJB50186.1| hypothetical protein B456_008G158100 [Gossypium raimondii]
 gb|KJB50187.1| hypothetical protein B456_008G158100 [Gossypium raimondii]
 gb|KJB50188.1| hypothetical protein B456_008G158100 [Gossypium raimondii]
 gb|KJB50189.1| hypothetical protein B456_008G158100 [Gossypium raimondii]
Length=309

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            +KR R KFSVPL+K+EIEEDFM + G RPPRRPKKR + VQ+ LD LFPGLWL+E+T D 
Sbjct  238  KKRSRPKFSVPLSKKEIEEDFMVMAGHRPPRRPKKRARNVQKQLDYLFPGLWLTEVTADA  297

Query  371  YKVPD  357
            YKVP+
Sbjct  298  YKVPE  302



>ref|XP_010265083.1| PREDICTED: uncharacterized protein LOC104602914 [Nelumbo nucifera]
Length=280

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK+ RAKFS+ L++ EIEEDF+ + G RPPRRPKKRP++VQ+ LD +FPGLWL+EITPD 
Sbjct  209  EKKGRAKFSISLSREEIEEDFVGVTGTRPPRRPKKRPRIVQKQLDIMFPGLWLTEITPDT  268

Query  371  YKVPD  357
            YKV D
Sbjct  269  YKVHD  273



>ref|XP_010907003.1| PREDICTED: uncharacterized protein LOC105033781 [Elaeis guineensis]
Length=272

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EKR+R KFSV L + EIEED  A+ G RP RRPKKRP++VQ+ LD+LFPGLWL+EIT D 
Sbjct  207  EKRERPKFSVALTREEIEEDVYAMTGSRPRRRPKKRPRIVQKQLDSLFPGLWLAEITVDS  266

Query  371  YKVPDD  354
            YKVPDD
Sbjct  267  YKVPDD  272



>ref|XP_008799251.1| PREDICTED: diacylglycerol kinase kappa-like [Phoenix dactylifera]
Length=279

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            KR+R K SV L   EIEED  A+ G RP RRPKKRP++VQ+ LD+LFPGLWLSEIT DLY
Sbjct  215  KRERPKLSVALTPEEIEEDIYAVTGSRPRRRPKKRPRIVQKQLDSLFPGLWLSEITADLY  274

Query  368  KVPDD  354
            KVPDD
Sbjct  275  KVPDD  279



>ref|XP_007153450.1| hypothetical protein PHAVU_003G036300g [Phaseolus vulgaris]
 gb|ESW25444.1| hypothetical protein PHAVU_003G036300g [Phaseolus vulgaris]
Length=258

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            +K +R KF V L+K+EI+EDFMAILGQR PRRP KRPKL QR LDTL PGLWL+EIT D+
Sbjct  175  DKTERVKFDVQLSKKEIDEDFMAILGQRAPRRPTKRPKLQQRMLDTLSPGLWLTEITADM  234

Query  371  YKV  363
            YKV
Sbjct  235  YKV  237



>gb|EPS70235.1| hypothetical protein M569_04525, partial [Genlisea aurea]
Length=88

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            ++++R KFSV L+KREIEEDF A+ G+RP RRPKKR K VQ+ ++TLFPG WL EIT D+
Sbjct  22   QQKERPKFSVSLSKREIEEDFFAMDGRRPSRRPKKRSKTVQKQIETLFPGSWLVEITADM  81

Query  371  YKVPDD  354
            YKVP+ 
Sbjct  82   YKVPES  87



>ref|XP_010249704.1| PREDICTED: uncharacterized protein LOC104592180 [Nelumbo nucifera]
 ref|XP_010249706.1| PREDICTED: uncharacterized protein LOC104592181 [Nelumbo nucifera]
Length=274

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            +K++R KFS+ L++ E+EEDF+A+ G RPPRRPKKRP+++Q+  D +FPGLWL+EITPD 
Sbjct  201  DKKERPKFSISLSRYEVEEDFLAMTGTRPPRRPKKRPRIIQKQQDAIFPGLWLTEITPDT  260

Query  371  YKVPD  357
            YKVPD
Sbjct  261  YKVPD  265



>ref|XP_006605904.1| PREDICTED: uncharacterized protein LOC100782256 [Glycine max]
Length=290

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            E+R   KFS+ LAK+EIEEDFM I+G RPPRRPKKRP+ VQ+ LDTLFPG WLSE+  D 
Sbjct  219  EERRPVKFSLTLAKKEIEEDFMRIVGHRPPRRPKKRPRNVQKQLDTLFPGQWLSEVCADS  278

Query  371  YKVPDD  354
            YKVPDD
Sbjct  279  YKVPDD  284



>ref|XP_004497073.1| PREDICTED: uncharacterized protein LOC101492865 [Cicer arietinum]
Length=243

 Score = 70.5 bits (171),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            D+ KFS+ L K+EIEEDFM ++G RPPRRPKKRP+ VQ+ LD LFPG+WLSE++ D YKV
Sbjct  175  DKVKFSLTLTKKEIEEDFMKMVGHRPPRRPKKRPRNVQKQLDNLFPGMWLSEVSADAYKV  234

Query  362  PD  357
            P+
Sbjct  235  PE  236


 Score = 27.3 bits (59),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -3

Query  693  AGGSSRGLNIDVTNPNVSPSRTTD  622
            AG S +GL ID   PN SPSR  +
Sbjct  142  AGESGKGLKIDEKKPNGSPSRNVN  165



>ref|XP_003535721.2| PREDICTED: uncharacterized protein LOC100779683 [Glycine max]
Length=257

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            E+R   KFS+ LAK+EIEEDFM ++G RPPRRPKKRP+ VQ+ LDTLFPG WLSE+  D 
Sbjct  186  EERRAVKFSLMLAKKEIEEDFMRMVGHRPPRRPKKRPRNVQKQLDTLFPGQWLSEVCADS  245

Query  371  YKVPDD  354
            YKVPDD
Sbjct  246  YKVPDD  251



>ref|XP_003525235.1| PREDICTED: uncharacterized protein LOC100801179 [Glycine max]
Length=129

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            +RAKFSV L+K ++E+DF A LG RPPRRPKKRP++VQ++LDTLFPGLWL+++T + YKV
Sbjct  68   ERAKFSVSLSKEQVEQDFWAFLGTRPPRRPKKRPRIVQKNLDTLFPGLWLTDVTAESYKV  127

Query  362  PD  357
            P+
Sbjct  128  PE  129



>gb|ACU20234.1| unknown [Glycine max]
Length=129

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            +RAKFSV L+K ++E+DF A LG RPPRRPKKRP++VQ++LDTLFPGLWL+++T + YKV
Sbjct  68   ERAKFSVSLSKEQVEQDFWAFLGTRPPRRPKKRPRIVQKNLDTLFPGLWLTDVTAESYKV  127

Query  362  PD  357
            P+
Sbjct  128  PE  129



>ref|XP_010921901.1| PREDICTED: uncharacterized protein LOC105045350 [Elaeis guineensis]
Length=246

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK +R KFS+ L + E+EEDF+A+ G++PPRRPKKR K+VQ+ LD++FPGLWLSEITPDL
Sbjct  182  EKGERPKFSISLTREEVEEDFLAMKGKKPPRRPKKRAKIVQKQLDSIFPGLWLSEITPDL  241

Query  371  YKVPD  357
            YKV D
Sbjct  242  YKVDD  246



>ref|XP_003592634.1| hypothetical protein MTR_1g110370 [Medicago truncatula]
 gb|AES62885.1| DUF1639 family protein [Medicago truncatula]
Length=240

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVP  360
            + KFS+ L K+EIEEDF+ + GQ+P RRPKKRP+ VQ+ +DTLFPG+WLSEI  D YKVP
Sbjct  170  KVKFSLSLMKKEIEEDFITMTGQKPHRRPKKRPRNVQKQMDTLFPGMWLSEINADSYKVP  229

Query  359  DD  354
            DD
Sbjct  230  DD  231



>ref|XP_010907004.1| PREDICTED: uncharacterized protein LOC105033783 [Elaeis guineensis]
Length=249

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            E+ +R KFSV L   E+E+DF+A+ G +PPRRPKKR K+VQ+ LD++FPGLWLSEITPDL
Sbjct  185  EEGERRKFSVSLTSEEVEQDFLALKGTKPPRRPKKRAKIVQKQLDSIFPGLWLSEITPDL  244

Query  371  YKV  363
            YKV
Sbjct  245  YKV  247



>ref|XP_007044281.1| Uncharacterized protein TCM_009632 [Theobroma cacao]
 gb|EOY00113.1| Uncharacterized protein TCM_009632 [Theobroma cacao]
Length=312

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            +KR R KFSV L+K+EIEEDFM + G RP RRPKKRP+ VQ  LD+LFPGLWL+E+T D 
Sbjct  241  KKRPRPKFSVSLSKKEIEEDFMVMAGHRPLRRPKKRPRYVQNQLDSLFPGLWLTEVTVDS  300

Query  371  YKVPD  357
            YKVP+
Sbjct  301  YKVPE  305



>ref|XP_009390935.1| PREDICTED: uncharacterized protein LOC103977210 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009390936.1| PREDICTED: uncharacterized protein LOC103977210 [Musa acuminata 
subsp. malaccensis]
Length=250

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EKR+R KFS+ L++ EIE DF  + G +PPRRPKKRP++VQR LD+LFPGLWLSE+TP+ 
Sbjct  186  EKRERRKFSISLSREEIEHDFWVMKGTKPPRRPKKRPRIVQRQLDSLFPGLWLSEVTPET  245

Query  371  YKVPD  357
            YKV D
Sbjct  246  YKVDD  250



>ref|XP_008803535.1| PREDICTED: uncharacterized protein LOC103717072 [Phoenix dactylifera]
Length=254

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            E+ +R KFSV L   E+E+DF+A+ G +PPRRPKKR K+VQ+ LD++FPGLWLSEITPDL
Sbjct  185  ERGERQKFSVSLTPEEVEQDFLALKGTKPPRRPKKRAKVVQKQLDSIFPGLWLSEITPDL  244

Query  371  YKV  363
            YKV
Sbjct  245  YKV  247



>gb|KDP20140.1| hypothetical protein JCGZ_05909 [Jatropha curcas]
Length=240

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  545  RDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYK  366
            ++R KFSVPL+K EIE+DFM I   RPPRRPKKRP++VQ+ LD++FPGLWL+E+TPD YK
Sbjct  174  KERIKFSVPLSKTEIEQDFMEIARIRPPRRPKKRPRIVQKYLDSIFPGLWLAEVTPDSYK  233

Query  365  VPD  357
            VP+
Sbjct  234  VPE  236



>ref|XP_010264343.1| PREDICTED: uncharacterized protein LOC104602373 [Nelumbo nucifera]
 ref|XP_010264352.1| PREDICTED: uncharacterized protein LOC104602373 [Nelumbo nucifera]
 ref|XP_010264361.1| PREDICTED: uncharacterized protein LOC104602373 [Nelumbo nucifera]
 ref|XP_010264370.1| PREDICTED: uncharacterized protein LOC104602373 [Nelumbo nucifera]
Length=281

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK++R KFS+ L++ EIEEDF+ I G RP RRPKKR + +Q+ LD   PGLWL+EITPD 
Sbjct  210  EKKEREKFSISLSREEIEEDFVGITGTRPHRRPKKRARNIQKLLDATLPGLWLTEITPDT  269

Query  371  YKVPD  357
            YKVPD
Sbjct  270  YKVPD  274



>ref|XP_006448443.1| hypothetical protein CICLE_v10016320mg [Citrus clementina]
 ref|XP_006468717.1| PREDICTED: uncharacterized protein LOC102623112 [Citrus sinensis]
 gb|ESR61683.1| hypothetical protein CICLE_v10016320mg [Citrus clementina]
 gb|KDO76960.1| hypothetical protein CISIN_1g025032mg [Citrus sinensis]
Length=259

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            K++R KF+V L ++EIEEDFM ++G RPPRRPKKRP++VQ+ +D+LFPGLWL+E+T D Y
Sbjct  189  KKERPKFAVSLMRKEIEEDFMEMVGHRPPRRPKKRPRIVQKQMDSLFPGLWLTEVTVDSY  248

Query  368  KVPD  357
            KVP+
Sbjct  249  KVPE  252



>ref|XP_002526996.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35368.1| conserved hypothetical protein [Ricinus communis]
Length=266

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVP  360
            R K SV L+K+EIEEDFMA++  RPPRRPKKR + VQ+ LD+LFPGLWLSE+T D YKVP
Sbjct  199  RPKLSVALSKKEIEEDFMALVSHRPPRRPKKRSRYVQKQLDSLFPGLWLSEVTVDTYKVP  258

Query  359  D  357
            D
Sbjct  259  D  259



>ref|XP_008797797.1| PREDICTED: uncharacterized protein LOC103712882 [Phoenix dactylifera]
Length=256

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            E+RDR KFS+ L + EIEED  A+ G R  RRPKKRP++VQ+ LD LFPG WLSEIT D 
Sbjct  192  ERRDRPKFSITLTREEIEEDIYAVTGSRARRRPKKRPRVVQKQLDALFPGSWLSEITADT  251

Query  371  YKVPD  357
            Y+VP+
Sbjct  252  YRVPE  256



>ref|XP_010549544.1| PREDICTED: uncharacterized protein LOC104820683 [Tarenaya hassleriana]
Length=267

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            +K +R KFSV L K+EIEEDFMA++G  PPRRPKKRP  VQR LD++FPGLWL E+ PD 
Sbjct  190  DKPERPKFSVTLTKKEIEEDFMAMVGHLPPRRPKKRPGNVQRQLDSVFPGLWLKEVMPDS  249

Query  371  YKVPD  357
            Y V D
Sbjct  250  YSVSD  254



>ref|XP_009409918.1| PREDICTED: uncharacterized protein LOC103992060 [Musa acuminata 
subsp. malaccensis]
Length=265

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            E ++R KFS+ L + EIEED  A+ G R  RRP+KRP+LVQ+ LD LFPG WLSEIT D 
Sbjct  201  EPKERTKFSITLTREEIEEDIYAVTGHRARRRPRKRPRLVQKQLDLLFPGSWLSEITLDT  260

Query  371  YKVPD  357
            YKVPD
Sbjct  261  YKVPD  265



>ref|XP_010477941.1| PREDICTED: uncharacterized protein LOC104756966 [Camelina sativa]
Length=269

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            K+ R KF+V L+K+EIEEDF+ +LG RPPRRPKKRP+ VQ+ LD+LFPGL+L+E+T D Y
Sbjct  201  KKMRPKFAVKLSKKEIEEDFVGMLGHRPPRRPKKRPRTVQKQLDSLFPGLYLTEVTLDAY  260

Query  368  KVPDDHSK  345
            KVP++ +K
Sbjct  261  KVPEETTK  268



>ref|XP_010254097.1| PREDICTED: uncharacterized protein LOC104595181 [Nelumbo nucifera]
Length=271

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK++R KFS+ L++ EIEEDF+ +   RPPRRPKKRPK++Q  LD  FPGLWL+E+TPD 
Sbjct  200  EKKERPKFSISLSREEIEEDFLTMTRTRPPRRPKKRPKIIQNQLDANFPGLWLTEVTPDS  259

Query  371  YKVPD  357
            YKVPD
Sbjct  260  YKVPD  264



>gb|KJB61217.1| hypothetical protein B456_009G347700 [Gossypium raimondii]
 gb|KJB61219.1| hypothetical protein B456_009G347700 [Gossypium raimondii]
Length=317

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
             KR R KFSVPL+K+EIEEDFM ++G+RP +RPKKR + VQR LD+LFPGL L+E+  D 
Sbjct  245  NKRARPKFSVPLSKKEIEEDFMVMVGRRPRKRPKKRARYVQRELDSLFPGLQLTEVRVDS  304

Query  371  YKVPD  357
            YKVP+
Sbjct  305  YKVPE  309



>gb|KJB61218.1| hypothetical protein B456_009G347700 [Gossypium raimondii]
Length=316

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
             KR R KFSVPL+K+EIEEDFM ++G+RP +RPKKR + VQR LD+LFPGL L+E+  D 
Sbjct  245  NKRARPKFSVPLSKKEIEEDFMVMVGRRPRKRPKKRARYVQRELDSLFPGLQLTEVRVDS  304

Query  371  YKVPD  357
            YKVP+
Sbjct  305  YKVPE  309



>gb|KJB61220.1| hypothetical protein B456_009G347700 [Gossypium raimondii]
Length=324

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
             KR R KFSVPL+K+EIEEDFM ++G+RP +RPKKR + VQR LD+LFPGL L+E+  D 
Sbjct  245  NKRARPKFSVPLSKKEIEEDFMVMVGRRPRKRPKKRARYVQRELDSLFPGLQLTEVRVDS  304

Query  371  YKVPD  357
            YKVP+
Sbjct  305  YKVPE  309



>ref|XP_010916412.1| PREDICTED: uncharacterized protein LOC105041237 [Elaeis guineensis]
Length=256

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            E+RDR KFS+ L + EIEED  A+ G R  RRPKKRP++VQ+ LD LFPG WLSEIT D 
Sbjct  192  ERRDRPKFSITLTREEIEEDIYAVTGSRARRRPKKRPRVVQKQLDGLFPGSWLSEITADT  251

Query  371  YKVPD  357
            Y+VP+
Sbjct  252  YRVPE  256



>ref|XP_002317907.1| hypothetical protein POPTR_0012s05150g [Populus trichocarpa]
 gb|EEE96127.1| hypothetical protein POPTR_0012s05150g [Populus trichocarpa]
Length=226

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            E +++ KFSV L+KREIEEDF+ ++  RPPRRPKKRP++VQ++LD++FPGLWL+EITPD 
Sbjct  158  EMKEKVKFSVSLSKREIEEDFLEMVRIRPPRRPKKRPRIVQKNLDSIFPGLWLAEITPDS  217

Query  371  YKV  363
            YKV
Sbjct  218  YKV  220



>gb|EEE64607.1| hypothetical protein OsJ_19459 [Oryza sativa Japonica Group]
Length=233

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            +R RA FSV L   EIEED  A+ G RP RRP+KRP++VQR LD+LFPGLWL+E+T D Y
Sbjct  169  RRKRAPFSVALTPEEIEEDIYALTGSRPRRRPRKRPRVVQRQLDSLFPGLWLTEVTADAY  228

Query  368  KVPDD  354
            +VPD+
Sbjct  229  RVPDE  233



>ref|XP_008243261.1| PREDICTED: uncharacterized protein LOC103341506 [Prunus mume]
Length=306

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVP  360
            R KF+V L K+EIEEDFM +LG RPPRRPKKRP+ VQ+ LDTLFPG+WL+E++ + YKVP
Sbjct  239  RVKFAVSLTKKEIEEDFMVMLGHRPPRRPKKRPRNVQKQLDTLFPGMWLTEVSAETYKVP  298

Query  359  D  357
            +
Sbjct  299  E  299



>ref|XP_006415864.1| hypothetical protein EUTSA_v10008407mg [Eutrema salsugineum]
 gb|ESQ34217.1| hypothetical protein EUTSA_v10008407mg [Eutrema salsugineum]
Length=283

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVP  360
            R KFSV L K+EIEEDFMA LG RPPRRPKKRP+ VQ+ LD LFPG +L+E+T D YKVP
Sbjct  216  RPKFSVKLTKKEIEEDFMAALGHRPPRRPKKRPRTVQKKLDNLFPGFYLTEVTLDAYKVP  275

Query  359  DD  354
            ++
Sbjct  276  EE  277



>ref|XP_008799250.1| PREDICTED: uncharacterized protein LOC103713962 [Phoenix dactylifera]
Length=245

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK +R KFS+ L + E+EEDF+ + G++PPRRPKKR K+VQ+ LD++FPGLWLSEITPDL
Sbjct  181  EKGERQKFSISLTREEVEEDFLVMKGKKPPRRPKKRAKIVQKQLDSIFPGLWLSEITPDL  240

Query  371  YKV  363
            YKV
Sbjct  241  YKV  243



>ref|XP_004971632.1| PREDICTED: uncharacterized protein LOC101773547 [Setaria italica]
Length=229

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            DRA+FSV L   EIEED  A+ G RP RRP++RP+ VQ+ LD LFPG WLSEIT + Y+V
Sbjct  166  DRARFSVTLTSEEIEEDIYAVTGARPRRRPRRRPRPVQKQLDMLFPGSWLSEITAETYRV  225

Query  362  PDD  354
            PDD
Sbjct  226  PDD  228



>ref|XP_009103062.1| PREDICTED: uncharacterized protein LOC103829148 [Brassica rapa]
Length=258

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVP  360
            R KFSV L+K+EIEEDFMA LG RPPRRPKKRP+ VQ+ LD+L PG +LSE+T D YKVP
Sbjct  191  RGKFSVKLSKKEIEEDFMAALGHRPPRRPKKRPRTVQKKLDSLHPGFYLSEVTLDAYKVP  250

Query  359  DD  354
            ++
Sbjct  251  EE  252



>ref|XP_002441479.1| hypothetical protein SORBIDRAFT_09g027650 [Sorghum bicolor]
 gb|EES19909.1| hypothetical protein SORBIDRAFT_09g027650 [Sorghum bicolor]
Length=269

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVP  360
            RA FSV L   EIEED  A+ G RP RRP+KRP+ VQR +D+LFPGLWL+EITPD Y+VP
Sbjct  208  RAPFSVSLTAEEIEEDIYALTGARPRRRPRKRPRAVQRHVDSLFPGLWLTEITPDAYRVP  267

Query  359  DD  354
            D+
Sbjct  268  DE  269



>ref|XP_007160389.1| hypothetical protein PHAVU_002G317700g [Phaseolus vulgaris]
 gb|ESW32383.1| hypothetical protein PHAVU_002G317700g [Phaseolus vulgaris]
Length=170

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -1

Query  536  AKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPD  357
             KFSV L+K E+E DF+A+LG RPPRRPKKRP++VQ++LD+LFPGLWLSE+T + Y+VP+
Sbjct  108  TKFSVSLSKEEVEHDFLALLGNRPPRRPKKRPRIVQKNLDSLFPGLWLSEVTAESYEVPE  167



>gb|KDP29438.1| hypothetical protein JCGZ_18359 [Jatropha curcas]
Length=299

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVP  360
            R KFSV L+++EIEEDFM ++G RP RRPKKR + VQ+ LD LFPGLWL+E+T D YKVP
Sbjct  232  RPKFSVALSRKEIEEDFMEMVGHRPARRPKKRSRNVQKQLDCLFPGLWLTEVTVDTYKVP  291

Query  359  D  357
            +
Sbjct  292  E  292



>ref|NP_001043921.1| Os01g0689000 [Oryza sativa Japonica Group]
 dbj|BAB85370.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF05835.1| Os01g0689000 [Oryza sativa Japonica Group]
 gb|EAZ13147.1| hypothetical protein OsJ_03066 [Oryza sativa Japonica Group]
 dbj|BAG99181.1| unnamed protein product [Oryza sativa Japonica Group]
Length=245

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            +R  F+V LA  EIEED  A+ G RP RRP+KRP++VQR LD+LFPGLWL+EIT D YKV
Sbjct  183  ERPPFAVALAAEEIEEDMYALTGGRPRRRPRKRPRVVQRQLDSLFPGLWLTEITADAYKV  242

Query  362  PDD  354
            PDD
Sbjct  243  PDD  245



>gb|EAY98934.1| hypothetical protein OsI_20889 [Oryza sativa Indica Group]
Length=264

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            +R RA FSV L   EIEED  A+ G RP RRP+KRP++VQR LD+LFPGLWL+E+T D Y
Sbjct  200  RRKRAPFSVALTPEEIEEDIYALTGSRPRRRPRKRPRVVQRQLDSLFPGLWLTEVTADAY  259

Query  368  KVPDD  354
            +VPD+
Sbjct  260  RVPDE  264



>ref|XP_008803533.1| PREDICTED: uncharacterized protein LOC103717071 [Phoenix dactylifera]
Length=277

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            E  +R KFSV L + EIEED  A+ G RP RRPKKRP+ +Q+ LD++FPGLWLSEIT D 
Sbjct  212  ETSERPKFSVALTREEIEEDIYALTGSRPRRRPKKRPRTIQKQLDSVFPGLWLSEITVDS  271

Query  371  YKVPDD  354
            YKVPDD
Sbjct  272  YKVPDD  277



>gb|KHN05554.1| hypothetical protein glysoja_035754 [Glycine soja]
Length=62

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -1

Query  518  LAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPDD  354
            LAK+EIEEDFM ++G RPPRRPKKRP+ VQ+ LDTLFPG WLSE+  D YKVPDD
Sbjct  2    LAKKEIEEDFMRMVGHRPPRRPKKRPRNVQKQLDTLFPGQWLSEVCADSYKVPDD  56



>gb|KHG24859.1| hypothetical protein F383_07684 [Gossypium arboreum]
Length=315

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            KR R KFSVPL+K+EIEEDFM ++G+RP +RPKKR + VQR LD+LFPGL L E+  D Y
Sbjct  244  KRARPKFSVPLSKKEIEEDFMVMVGRRPRKRPKKRARYVQRELDSLFPGLQLREVRVDSY  303

Query  368  KVPD  357
            KVP+
Sbjct  304  KVPE  307



>ref|XP_008673758.1| PREDICTED: uncharacterized protein LOC103649836 [Zea mays]
 tpg|DAA53622.1| TPA: hypothetical protein ZEAMMB73_231959 [Zea mays]
Length=209

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            E  DRA+FSV L   EIEED  ++ G RP RRP++RP+ VQ+ LD LFPGLWLSEIT + 
Sbjct  143  EALDRARFSVTLTSEEIEEDIYSVTGARPRRRPRRRPRPVQKQLDMLFPGLWLSEITAET  202

Query  371  YKVPDD  354
            Y+VPD 
Sbjct  203  YRVPDH  208



>ref|XP_010460392.1| PREDICTED: uncharacterized protein LOC104741277 [Camelina sativa]
Length=265

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            +K+ R KF+V L+K+EIEEDF+ +LG RPPRRPKKRP+ VQ+ LD+LFPGL+L+E+T D 
Sbjct  197  KKKMRPKFAVKLSKKEIEEDFVGMLGHRPPRRPKKRPRTVQKQLDSLFPGLYLTEVTLDA  256

Query  371  YKVPDD  354
            YKVP++
Sbjct  257  YKVPEE  262



>ref|XP_010926019.1| PREDICTED: uncharacterized protein LOC105048419 [Elaeis guineensis]
Length=253

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK +R KFS+ L++ EIEEDF+   G +PPRRPKKR ++VQ+ LD++ PGLWLSEITPDL
Sbjct  189  EKGERQKFSISLSREEIEEDFLLFKGTKPPRRPKKRQRIVQKQLDSVLPGLWLSEITPDL  248

Query  371  YKV  363
            YK+
Sbjct  249  YKI  251



>ref|NP_001241159.1| uncharacterized protein LOC100805289 [Glycine max]
 ref|XP_006582933.1| PREDICTED: uncharacterized protein LOC100805289 isoform X1 [Glycine 
max]
 gb|ACU19791.1| unknown [Glycine max]
 gb|KHN20745.1| hypothetical protein glysoja_019062 [Glycine soja]
Length=198

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            ++ KFSV L+K E+E+DF A+LG RPPRRPKKRP++VQR L+TLFPGLWL+EIT + YKV
Sbjct  134  EKVKFSVSLSKEEVEQDFWALLGARPPRRPKKRPRIVQRQLNTLFPGLWLAEITAESYKV  193

Query  362  PD  357
             D
Sbjct  194  AD  195



>ref|NP_001174514.1| Os05g0551350 [Oryza sativa Japonica Group]
 dbj|BAH93242.1| Os05g0551350 [Oryza sativa Japonica Group]
Length=268

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            +R RA FSV L   EIEED  A+ G RP RRP+KRP++VQR LD+LFPGLWL+E+T D Y
Sbjct  204  RRKRAPFSVALTPEEIEEDIYALTGSRPRRRPRKRPRVVQRQLDSLFPGLWLTEVTADAY  263

Query  368  KVPDD  354
            +VPD+
Sbjct  264  RVPDE  268



>ref|XP_010499118.1| PREDICTED: uncharacterized protein LOC104776709 [Camelina sativa]
Length=258

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            K+ R KF+V L+K+EIEEDF+ +LG RPPRRPKKRP+ VQ+ LD+LFPGL+L+E+T D Y
Sbjct  191  KKMRPKFAVKLSKKEIEEDFVGMLGHRPPRRPKKRPRTVQKKLDSLFPGLYLTEVTLDAY  250

Query  368  KVPDD  354
            KVP++
Sbjct  251  KVPEE  255



>ref|XP_004515140.1| PREDICTED: uncharacterized protein LOC101491652 [Cicer arietinum]
Length=270

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
             K +R KFSV L+++EIEEDFMA++G RPPRRP KRPK VQ+ L+ LFPGLWL E+  D+
Sbjct  182  NKTERPKFSVQLSRKEIEEDFMAMVGHRPPRRPYKRPKPVQKQLNNLFPGLWLREVNVDM  241

Query  371  YKVPD  357
            YKV D
Sbjct  242  YKVLD  246



>ref|XP_010688487.1| PREDICTED: uncharacterized protein LOC104902410 [Beta vulgaris 
subsp. vulgaris]
Length=222

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            +R+KFSV ++++E+E+DF+ ++G+RPPR+PKKRP+ +Q+ LDTLFPGLWLSEIT D+YKV
Sbjct  155  ERSKFSVSISRQEVEDDFIEMIGRRPPRKPKKRPRYIQKQLDTLFPGLWLSEITADMYKV  214

Query  362  PDD  354
             ++
Sbjct  215  NNN  217



>ref|XP_002890693.1| hypothetical protein ARALYDRAFT_313393 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66952.1| hypothetical protein ARALYDRAFT_313393 [Arabidopsis lyrata subsp. 
lyrata]
Length=780

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 43/65 (66%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            K+ R KFSV L+K+EIEEDF+ ILG RPPRRPKKRP+ VQ+ LD+L+PGL+L+E+T D Y
Sbjct  713  KKMRVKFSVKLSKKEIEEDFIGILGHRPPRRPKKRPRTVQKKLDSLYPGLYLTEVTHDAY  772

Query  368  KVPDD  354
            KVP++
Sbjct  773  KVPEE  777



>ref|XP_009390227.1| PREDICTED: uncharacterized protein LOC103976664 [Musa acuminata 
subsp. malaccensis]
Length=252

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            E+R+R KFS+ L + EIEED  A+ G R PRRP+KR K++Q  LD+LFPG WLSEIT D 
Sbjct  188  ERRERPKFSISLTREEIEEDIYAMTGCRAPRRPRKRAKVIQNQLDSLFPGSWLSEITADS  247

Query  371  YKVPD  357
            Y+VPD
Sbjct  248  YRVPD  252



>ref|XP_010258813.1| PREDICTED: uncharacterized protein LOC104598448 [Nelumbo nucifera]
Length=292

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK+++ KFS+ L++ EIEED   + G +P RRPKKR K +Q+ LD +FPGLWL+ ITPD 
Sbjct  223  EKKEKQKFSISLSREEIEEDIFVMTGSKPARRPKKRAKNIQKQLDNVFPGLWLAGITPDS  282

Query  371  YKVPD  357
            YKVPD
Sbjct  283  YKVPD  287



>ref|XP_006304090.1| hypothetical protein CARUB_v10009968mg [Capsella rubella]
 gb|EOA36988.1| hypothetical protein CARUB_v10009968mg [Capsella rubella]
Length=278

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            K+ R KF++ L K+EIEEDF+ I GQRP RRPKKR + VQ++LD+LFPGL+L+E+T D Y
Sbjct  211  KKVRPKFAMRLTKKEIEEDFIGIFGQRPSRRPKKRARAVQKNLDSLFPGLYLTEVTLDAY  270

Query  368  KVPDD  354
            KVP++
Sbjct  271  KVPEE  275



>ref|XP_002533698.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28681.1| conserved hypothetical protein [Ricinus communis]
Length=213

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVP  360
            + KFSVPL K EIE+DF  I   RPPRRPKKRP+++Q+ LD++FPGLWLSE+TPD YKVP
Sbjct  149  KVKFSVPLLKEEIEQDFFQIARIRPPRRPKKRPRILQKYLDSIFPGLWLSEVTPDSYKVP  208

Query  359  D  357
            D
Sbjct  209  D  209



>emb|CDY03857.1| BnaC07g10820D [Brassica napus]
Length=255

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVP  360
            R KFSV L K+EIEEDFMA LG RPPRRPKKRP+ VQ+ LD+L PG +LSE+T D YKVP
Sbjct  191  RPKFSVKLTKKEIEEDFMAALGHRPPRRPKKRPRTVQKKLDSLHPGFYLSEVTLDAYKVP  250

Query  359  DD  354
            ++
Sbjct  251  EE  252



>emb|CDY24408.1| BnaCnng04750D [Brassica napus]
Length=250

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVP  360
            R KFSV L+K+EIEEDFMA  G RPPRRPKKRP+ VQ+ LD+L PGL+L+E+T D YKVP
Sbjct  185  RPKFSVKLSKKEIEEDFMAAFGHRPPRRPKKRPRTVQKKLDSLHPGLYLTEVTLDAYKVP  244

Query  359  DD  354
            ++
Sbjct  245  EE  246



>ref|XP_008675169.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Zea 
mays]
 tpg|DAA58047.1| TPA: hypothetical protein ZEAMMB73_819370 [Zea mays]
Length=244

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  545  RDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYK  366
            R+RA F++ L   E+EED  A+ G RP RRP+KRP++VQR LD+LFPGLWL+EIT D+YK
Sbjct  181  RERAPFALALTAGEVEEDVYALTGARPRRRPRKRPRVVQRQLDSLFPGLWLTEITTDVYK  240

Query  365  VPDD  354
            VPD+
Sbjct  241  VPDE  244



>ref|XP_009404510.1| PREDICTED: uncharacterized protein LOC103987813 [Musa acuminata 
subsp. malaccensis]
Length=241

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            E+++R KFS+ L + EI+ED  ++ G R  RRP+KR ++VQ+ LD LFPG WLSEIT D 
Sbjct  177  ERKERPKFSITLTREEIDEDIYSVTGHRARRRPRKRHRVVQKQLDLLFPGSWLSEITHDT  236

Query  371  YKVPD  357
            YKVPD
Sbjct  237  YKVPD  241



>ref|XP_008812763.1| PREDICTED: uncharacterized protein LOC103723584 [Phoenix dactylifera]
Length=251

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            ++RDR KFS+ L   EIEED  A+ G RP RRPK+RP++VQ+ LD LFPG WLSEIT D 
Sbjct  187  DRRDRPKFSITLTVEEIEEDIYAVTGSRPRRRPKRRPRVVQKQLDALFPGSWLSEITADT  246

Query  371  YKVPD  357
            Y+VP+
Sbjct  247  YRVPE  251



>ref|XP_008445636.1| PREDICTED: uncharacterized protein LOC103488593 [Cucumis melo]
Length=279

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -1

Query  521  PLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPD  357
            PL+KREI+EDFM ++G RPPRRPKKR ++VQ+ LDTLFPGLWLSEIT DLYKV +
Sbjct  215  PLSKREIDEDFMEMVGLRPPRRPKKRTRIVQKQLDTLFPGLWLSEITADLYKVSE  269



>ref|XP_004969600.1| PREDICTED: formin-like protein 5-like [Setaria italica]
Length=241

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            +RA F+V L   E+EED  A+ G RP RRP+KRP++VQR LD+LFPGLWL+EIT D YKV
Sbjct  179  ERAPFAVALTAEEVEEDVYALTGARPRRRPRKRPRVVQRQLDSLFPGLWLTEITADAYKV  238

Query  362  PDD  354
            PD+
Sbjct  239  PDE  241



>ref|XP_009109878.1| PREDICTED: uncharacterized protein LOC103835453 [Brassica rapa]
Length=245

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVP  360
            R KFSV L+K+EIEEDFMA  G+RPPRRPKKRP+ VQ+ LD+L PGL+L+E+T D YKVP
Sbjct  178  RPKFSVKLSKKEIEEDFMAAFGRRPPRRPKKRPRTVQKKLDSLHPGLYLAEVTLDAYKVP  237

Query  359  DD  354
            ++
Sbjct  238  EE  239



>ref|XP_010099253.1| hypothetical protein L484_015442 [Morus notabilis]
 gb|EXB77517.1| hypothetical protein L484_015442 [Morus notabilis]
Length=296

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            +++R  FSV L K+EIEEDFM +LG RPPRRPKKRP++VQ+ LDTLFPGL L E+T + Y
Sbjct  212  EKERVNFSVALEKKEIEEDFMELLGHRPPRRPKKRPRIVQKQLDTLFPGLLLREVTAETY  271

Query  368  KVPD  357
            KVP+
Sbjct  272  KVPE  275



>ref|XP_004138348.1| PREDICTED: uncharacterized protein LOC101205564 [Cucumis sativus]
 ref|XP_004160212.1| PREDICTED: uncharacterized protein LOC101227806 [Cucumis sativus]
 gb|KGN45937.1| hypothetical protein Csa_6G024940 [Cucumis sativus]
Length=279

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -1

Query  521  PLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPD  357
            PL+KREI+EDFM ++G RPPRRPKKR ++VQ+ LDTLFPGLWLSEIT DLYKV +
Sbjct  215  PLSKREIDEDFMEMVGLRPPRRPKKRTRIVQKQLDTLFPGLWLSEITADLYKVSE  269



>ref|XP_004512910.1| PREDICTED: uncharacterized protein LOC101496171 [Cicer arietinum]
Length=205

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            D+ KFSV L+K E+E+DF A++G RPPRRPKKRP++VQR L+TL PG+WL+E+T D YKV
Sbjct  141  DKVKFSVSLSKEEVEQDFWALVGTRPPRRPKKRPRIVQRQLNTLLPGMWLAEVTADSYKV  200

Query  362  PD  357
             +
Sbjct  201  SE  202



>emb|CDY36111.1| BnaA08g19370D [Brassica napus]
Length=247

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVP  360
            R KFSV L+K+EIEEDFMA  G+RPPRRPKKRP+ VQ+ LD+L PGL+L+E+T D YKVP
Sbjct  180  RPKFSVKLSKKEIEEDFMAAFGRRPPRRPKKRPRTVQKKLDSLHPGLYLAEVTLDAYKVP  239

Query  359  DD  354
            ++
Sbjct  240  EE  241



>ref|XP_004248522.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Solanum 
lycopersicum]
Length=404

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            +K  R +FS+ L++ EI+ED  A+ G +  R+PKKR K VQ+ LDTLFPGLWL+ ITPDL
Sbjct  335  KKEKRPRFSIALSREEIDEDIYAMTGSKATRKPKKRVKNVQKQLDTLFPGLWLTSITPDL  394

Query  371  YKV  363
            YKV
Sbjct  395  YKV  397



>ref|XP_010926018.1| PREDICTED: uncharacterized protein LOC105048418 [Elaeis guineensis]
Length=253

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            ++RDR KFS+ L   EIEED  A+ G RP RRPK+RP++VQ+ LD LFPG WLSEIT D 
Sbjct  189  DRRDRPKFSITLKVEEIEEDIYAVTGSRPRRRPKRRPRVVQKQLDALFPGSWLSEITADT  248

Query  371  YKVPD  357
            Y++P+
Sbjct  249  YRIPE  253



>ref|XP_011045843.1| PREDICTED: uncharacterized protein LOC105140636 [Populus euphratica]
 ref|XP_011045844.1| PREDICTED: uncharacterized protein LOC105140636 [Populus euphratica]
Length=226

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            E +++ KFS+ L+K+EIEEDF+ ++  RPPRRPKKRP++ Q++LD++FPGLWL+EITPD 
Sbjct  158  EMKEKVKFSISLSKKEIEEDFLEMVRIRPPRRPKKRPRIAQKNLDSIFPGLWLAEITPDS  217

Query  371  YKV  363
            YKV
Sbjct  218  YKV  220



>ref|XP_008655607.1| PREDICTED: uncharacterized protein LOC103634794 [Zea mays]
 gb|AFW79956.1| hypothetical protein ZEAMMB73_990097 [Zea mays]
Length=208

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            E   RA+FSV L + EIEED  A+ G RP RRP++RP+ VQ+ LD LFPG WLSEIT + 
Sbjct  142  EALGRARFSVALTREEIEEDVFAVTGARPRRRPRRRPRPVQKQLDILFPGSWLSEITAET  201

Query  371  YKVPD  357
            Y+VPD
Sbjct  202  YRVPD  206



>ref|XP_007142930.1| hypothetical protein PHAVU_007G029200g [Phaseolus vulgaris]
 gb|ESW14924.1| hypothetical protein PHAVU_007G029200g [Phaseolus vulgaris]
Length=263

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = -1

Query  551  EKRDR-AKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPD  375
            EK +R AKFS+ L K+EIE+DFM ++G RPPRRPKKRP+  Q+ LDTLFPG WLSE++ D
Sbjct  191  EKDERPAKFSMTLTKKEIEDDFMNLVGHRPPRRPKKRPRNAQKQLDTLFPGQWLSEVSAD  250

Query  374  LYKVPDD  354
             YKVP++
Sbjct  251  CYKVPEE  257



>ref|XP_006345268.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X1 [Solanum tuberosum]
Length=415

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            R +FS+ L++ EI+ED  A+ G +  R+PKKR K VQ+ LDTLFPGLWL+ ITPDLYKV
Sbjct  350  RPRFSIALSREEIDEDIYAMTGSKATRKPKKRVKTVQKQLDTLFPGLWLASITPDLYKV  408



>ref|XP_010551248.1| PREDICTED: uncharacterized protein LOC104821917 [Tarenaya hassleriana]
Length=320

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  545  RDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYK  366
            ++R KFSVPL ++EIEEDFM ++G R PRRPKKRP+ VQ+ LD L PGL+L+E+T D YK
Sbjct  251  KERPKFSVPLKRKEIEEDFMEVMGHRLPRRPKKRPRTVQKQLDFLCPGLYLTEVTLDTYK  310

Query  365  VPD  357
            VP+
Sbjct  311  VPE  313



>ref|XP_007154144.1| hypothetical protein PHAVU_003G094100g [Phaseolus vulgaris]
 gb|ESW26138.1| hypothetical protein PHAVU_003G094100g [Phaseolus vulgaris]
Length=190

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            +R KFSV L+K ++E+DF A++G RPPRRP+KRP++VQR L+TLFPGLWL+E++ + YKV
Sbjct  126  ERVKFSVSLSKEDVEQDFWALVGTRPPRRPRKRPRIVQRQLNTLFPGLWLAEVSAESYKV  185

Query  362  PD  357
             D
Sbjct  186  TD  187



>emb|CDM83881.1| unnamed protein product [Triticum aestivum]
Length=223

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVP  360
            R  F+V L   EIEED  A+ G RP RRP+KR ++VQR LD+LFPGLWL+EIT D Y+VP
Sbjct  161  RGPFAVALDAEEIEEDVYALTGARPRRRPRKRARVVQRHLDSLFPGLWLTEITADAYRVP  220

Query  359  DD  354
            DD
Sbjct  221  DD  222



>ref|XP_009415790.1| PREDICTED: uncharacterized protein LOC103996587 [Musa acuminata 
subsp. malaccensis]
Length=234

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  533  KFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            KFS+ L++ EIEEDF AI G +P RRPKKR K+VQR LD+LFPGL LSEITPD Y+V
Sbjct  176  KFSISLSRSEIEEDFFAIKGTKPSRRPKKRAKIVQRELDSLFPGLSLSEITPDSYEV  232



>ref|XP_002456171.1| hypothetical protein SORBIDRAFT_03g031600 [Sorghum bicolor]
 gb|EES01291.1| hypothetical protein SORBIDRAFT_03g031600 [Sorghum bicolor]
Length=262

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -1

Query  545  RDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYK  366
            ++RA F+V L   E+EED  A+ G RP RRP+KRP++VQR LD+LFPGLWL+EIT D YK
Sbjct  199  QERAPFAVALTAEEVEEDVYALTGARPRRRPRKRPRVVQRQLDSLFPGLWLTEITADAYK  258

Query  365  VPDD  354
            VP++
Sbjct  259  VPEE  262



>emb|CDY58598.1| BnaA07g36930D [Brassica napus]
Length=294

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVP  360
            R +FSV L+K+EIEEDF+A LG RPPRRPKKRP+ VQ+ LD+L PG +LSE+T D YKVP
Sbjct  190  RGRFSVKLSKKEIEEDFVAALGHRPPRRPKKRPRTVQKKLDSLHPGFYLSEVTLDAYKVP  249

Query  359  DD  354
            ++
Sbjct  250  EE  251



>ref|XP_008389276.1| PREDICTED: uncharacterized protein LOC103451638 [Malus domestica]
Length=308

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            +R KFS+ L K+EIEEDFM +LG RP RRPK+RP+ VQ+ LD LFPG WL+E++ + YKV
Sbjct  240  ERPKFSLTLTKKEIEEDFMKMLGHRPLRRPKRRPRNVQKQLDGLFPGTWLTEVSAETYKV  299

Query  362  PD  357
            P+
Sbjct  300  PE  301



>ref|XP_010549117.1| PREDICTED: uncharacterized protein LOC104820388 [Tarenaya hassleriana]
Length=242

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS-EITPD  375
            EK  + KFSVPL + EIEEDF A++G+RPPRRPKKRP++VQ+ L++LFPGLWL+ E+T D
Sbjct  173  EKNGKLKFSVPLLREEIEEDFAAMIGKRPPRRPKKRPRIVQKQLNSLFPGLWLTEEVTAD  232

Query  374  LYKVPD  357
             Y VP+
Sbjct  233  SYNVPE  238



>dbj|BAK05502.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90967.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVP  360
            RA F+V L + EIEED  A+ G RP RRP+KR ++VQR LD+LFPGLWL+EIT D Y+VP
Sbjct  167  RAPFAVALDEEEIEEDVYALTGARPRRRPRKRARVVQRQLDSLFPGLWLTEITADAYRVP  226

Query  359  D  357
            D
Sbjct  227  D  227



>ref|XP_009403973.1| PREDICTED: uncharacterized protein LOC103987404 [Musa acuminata 
subsp. malaccensis]
Length=263

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            E+R+R KFS+ L + EI+ED  A+ G R  RRP+KR ++VQ+ LD LFPG WLSEI  D 
Sbjct  199  ERRERPKFSISLTREEIDEDIYAVTGCRARRRPRKRARVVQKRLDALFPGSWLSEIAADA  258

Query  371  YKVPD  357
            Y+VPD
Sbjct  259  YRVPD  263



>emb|CBI15476.3| unnamed protein product [Vitis vinifera]
Length=117

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -1

Query  530  FSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPD  357
            FSV L++ E+ +DFMA++G RPPRRPKKR ++VQ+ LD++FPGLWL+EIT D YK+PD
Sbjct  53   FSVSLSREEVRDDFMAMVGTRPPRRPKKRARIVQKQLDSIFPGLWLTEITLDTYKLPD  110



>ref|XP_010532317.1| PREDICTED: uncharacterized protein LOC104808336 [Tarenaya hassleriana]
Length=328

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  545  RDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYK  366
            ++R KFS  L+++EIEEDFM +LG RPPRRPKKRPK VQR LD LFPGL+L+E+T D YK
Sbjct  259  KERPKFSSRLSRKEIEEDFMELLGHRPPRRPKKRPKTVQRQLDFLFPGLYLTEVTLDTYK  318

Query  365  VPD  357
            +P+
Sbjct  319  IPE  321



>gb|KCW86313.1| hypothetical protein EUGRSUZ_B03003 [Eucalyptus grandis]
Length=318

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            +RAKF+V L ++EIEEDFM ++G RPPRR KKRPK VQ+ LD LFPGLWL+EI+ D YKV
Sbjct  250  ERAKFAVALKRKEIEEDFMEMVGHRPPRRFKKRPKNVQKQLDLLFPGLWLTEISADTYKV  309

Query  362  PDD  354
             ++
Sbjct  310  DEN  312



>ref|XP_003567946.1| PREDICTED: formin-like protein 14 isoform X2 [Brachypodium distachyon]
Length=213

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            +R RA FSV L+  EIEED  A+ G R  RRP+KRP+ VQR LD+LFPGLWL+EIT D Y
Sbjct  149  RRKRAPFSVALSPEEIEEDIYALTGGRQRRRPRKRPRGVQRQLDSLFPGLWLTEITADDY  208

Query  368  KVPDD  354
            +VPD+
Sbjct  209  RVPDE  213



>dbj|BAK06052.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=223

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -1

Query  530  FSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPDD  354
            FSV L+  EIEED  A+ G RP RRP+KRP+ VQR LD+LFPGLWL+E+T D YKVPDD
Sbjct  164  FSVALSTEEIEEDIYALTGGRPRRRPRKRPRAVQRQLDSLFPGLWLAEVTADDYKVPDD  222



>ref|XP_008654594.1| PREDICTED: uncharacterized protein LOC100273686 isoform X1 [Zea 
mays]
 gb|AFW83609.1| hypothetical protein ZEAMMB73_504655 [Zea mays]
Length=247

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            +RA F+V L   E+E+D  A+ G RP RRP+KRP++VQR LD LFPGLWL+EIT D YKV
Sbjct  185  ERAPFAVALTAEEVEDDVYALTGARPRRRPRKRPRVVQRQLDALFPGLWLTEITADAYKV  244

Query  362  PDD  354
            PD+
Sbjct  245  PDE  247



>ref|XP_010066709.1| PREDICTED: uncharacterized protein LOC104453783 [Eucalyptus grandis]
 gb|KCW64715.1| hypothetical protein EUGRSUZ_G02307 [Eucalyptus grandis]
Length=295

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            +R KF+VPL ++EIE+DF+ + G RP RRPKKR + VQ++LD +FPGLWL+E+T D YKV
Sbjct  227  EREKFAVPLKRKEIEKDFLEMTGHRPSRRPKKRNRTVQKNLDAVFPGLWLTEVTADAYKV  286



>ref|XP_003618367.1| hypothetical protein MTR_6g008660 [Medicago truncatula]
 gb|AES74585.1| DUF1639 family protein [Medicago truncatula]
Length=273

 Score = 65.1 bits (157),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -1

Query  533  KFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPD  357
            KFS+ L K+EIEEDF+ + GQ PPRRPK+R K VQ+ ++ LFPG+WLSE+  D YKVPD
Sbjct  179  KFSLSLTKKEIEEDFIKMTGQMPPRRPKRRSKNVQKKMNALFPGVWLSEVNADSYKVPD  237


 Score = 24.3 bits (51),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = -3

Query  690  GGSSRGLNIDVTNPNVS  640
            G + +GL ID  NPN+S
Sbjct  148  GDAGKGLKIDEKNPNIS  164



>ref|XP_002278683.1| PREDICTED: uncharacterized protein LOC100259406 [Vitis vinifera]
Length=187

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -1

Query  530  FSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPD  357
            FSV L++ E+ +DFMA++G RPPRRPKKR ++VQ+ LD++FPGLWL+EIT D YK+PD
Sbjct  123  FSVSLSREEVRDDFMAMVGTRPPRRPKKRARIVQKQLDSIFPGLWLTEITLDTYKLPD  180



>ref|XP_009389592.1| PREDICTED: uncharacterized protein LOC103976124 [Musa acuminata 
subsp. malaccensis]
Length=236

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            +R KFS+ L + EIEED  ++ G R  RRP+KRP+++Q+ LD LFPG WLSEIT D YKV
Sbjct  175  ERPKFSITLTREEIEEDIYSVTGHRARRRPRKRPRVIQKQLDLLFPGSWLSEITLDTYKV  234

Query  362  PD  357
            PD
Sbjct  235  PD  236



>ref|XP_009591074.1| PREDICTED: uncharacterized protein LOC104088143 [Nicotiana tomentosiformis]
Length=304

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVP  360
            R +FS+ L++ EI+ED  A+ G +  RRPKKR K+VQ+ LDTLFPGLWL+ ITPD YKV 
Sbjct  239  RQRFSIALSREEIDEDLYAMTGLKAARRPKKRVKVVQKQLDTLFPGLWLASITPDSYKVC  298

Query  359  DD  354
            ++
Sbjct  299  EN  300



>ref|XP_009390225.1| PREDICTED: uncharacterized protein LOC103976663 [Musa acuminata 
subsp. malaccensis]
Length=248

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            E  +R KFSV L++ EIE+D  AI G++  RRPKKR ++VQR LD LFPGLWLSE+TP+ 
Sbjct  184  ENGERQKFSVSLSRDEIEQDIWAIKGRKLLRRPKKRLRIVQRQLDLLFPGLWLSEVTPET  243

Query  371  YKV  363
            Y++
Sbjct  244  YRI  246



>ref|XP_009390934.1| PREDICTED: uncharacterized protein LOC103977209 [Musa acuminata 
subsp. malaccensis]
Length=260

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            E+R+  +FS+ L + EIEED  A+ G R  RRP+KR ++VQ+ LD+ FPGLWLSEIT D 
Sbjct  194  ERREWPRFSISLTREEIEEDIYAVTGCRARRRPRKRARVVQKQLDSSFPGLWLSEITVDS  253

Query  371  YKVPD  357
            Y+VPD
Sbjct  254  YRVPD  258



>ref|XP_010534217.1| PREDICTED: uncharacterized protein LOC104809833 [Tarenaya hassleriana]
 ref|XP_010534218.1| PREDICTED: uncharacterized protein LOC104809833 [Tarenaya hassleriana]
 ref|XP_010534219.1| PREDICTED: uncharacterized protein LOC104809833 [Tarenaya hassleriana]
Length=235

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS-EITPD  375
            EK ++ KFSVPL + EIEEDF A++G+RPPRRPKKR ++VQ+ L++LFPGLWL+ E+T D
Sbjct  166  EKNEKLKFSVPLLREEIEEDFAAMIGKRPPRRPKKRHRIVQKQLNSLFPGLWLTEEVTAD  225

Query  374  LYKV  363
             Y V
Sbjct  226  SYNV  229



>ref|XP_009383650.1| PREDICTED: uncharacterized protein LOC103971372 [Musa acuminata 
subsp. malaccensis]
Length=177

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            +K +  KFS+ L++ EIE+DF AI G +PPRRPK R K++QR LD+LFPGLWLSEIT + 
Sbjct  113  KKGEMTKFSISLSRAEIEDDFFAIKGTKPPRRPKTRAKIIQRELDSLFPGLWLSEITRET  172

Query  371  YKV  363
            YK+
Sbjct  173  YKI  175



>gb|KJB22887.1| hypothetical protein B456_004G071800 [Gossypium raimondii]
Length=291

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            +K  + KFS+ L + EI+ED  A+ G +  RRPKKR K VQ+ LD +FPGLWLS ITPD 
Sbjct  222  KKAKKQKFSISLTREEIDEDIFAMTGSKASRRPKKRAKNVQKQLDCVFPGLWLSSITPDS  281

Query  371  YKVPD  357
            Y+VP+
Sbjct  282  YRVPE  286



>ref|XP_008339652.1| PREDICTED: uncharacterized protein LOC103402678 [Malus domestica]
Length=312

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            +R KFS+ L K+EIEEDFM +LG RPPRRPK+RP+ VQ+ L+ LFPG WL+E++ + YKV
Sbjct  244  ERPKFSLTLTKKEIEEDFMKMLGHRPPRRPKRRPRNVQKQLEGLFPGTWLTEVSAETYKV  303

Query  362  PD  357
            P+
Sbjct  304  PE  305



>ref|XP_009380290.1| PREDICTED: uncharacterized protein LOC103968712 [Musa acuminata 
subsp. malaccensis]
Length=263

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -1

Query  545  RDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYK  366
            R+R KFS+ L + EIEED  A+ G+R  +RP+KR ++VQ+ LD L PG WL+EIT D Y+
Sbjct  199  RERPKFSISLTREEIEEDIYAVTGRRARQRPRKRARVVQKQLDALLPGSWLTEITADTYR  258

Query  365  VPD  357
            VPD
Sbjct  259  VPD  261



>ref|XP_009388794.1| PREDICTED: uncharacterized protein LOC103975535 [Musa acuminata 
subsp. malaccensis]
Length=205

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            DR +FS+ L++ EIEED  A+ G R  RRP+KRP++VQ+ LD LFPG WLSE+T D Y+V
Sbjct  144  DRPRFSISLSREEIEEDIYAVTGCRARRRPRKRPRVVQKQLDGLFPGAWLSEVTVDSYRV  203

Query  362  PD  357
            P+
Sbjct  204  PE  205



>ref|XP_009356989.1| PREDICTED: uncharacterized protein LOC103947762 [Pyrus x bretschneideri]
Length=310

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            +R KFS+ L K+EIEEDFM +LG RPPRRPK+RP+ VQ+ L+ LFPG WL+E++ + YKV
Sbjct  242  ERPKFSLTLNKKEIEEDFMKMLGHRPPRRPKRRPRNVQKQLEGLFPGTWLTEVSAETYKV  301

Query  362  PD  357
            P+
Sbjct  302  PE  303



>ref|NP_564231.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM61389.1| unknown [Arabidopsis thaliana]
 gb|AEE30613.1| uncharacterized protein AT1G25370 [Arabidopsis thaliana]
Length=263

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  545  RDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYK  366
            + R  FS+ L+K+E+EEDF+ ++G R PRRPKKR K VQ+ LD+LFPGL+L+E+T D YK
Sbjct  201  KKRPMFSMKLSKKEMEEDFIGMVGHRAPRRPKKRSKTVQKKLDSLFPGLYLTEVTHDAYK  260

Query  365  VPD  357
            VP+
Sbjct  261  VPE  263



>ref|XP_010096359.1| hypothetical protein L484_021107 [Morus notabilis]
 gb|EXB63834.1| hypothetical protein L484_021107 [Morus notabilis]
Length=262

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK +R KF+V L+++EIE DF  +LG+RPP RPKKRP+ +QR LD+LFPG+ L EIT + 
Sbjct  190  EKEERVKFAVALSRKEIESDFAVMLGKRPPSRPKKRPRPIQRQLDSLFPGVLLGEITTET  249

Query  371  YKVPDDHSK  345
            YKVP+   K
Sbjct  250  YKVPEAPKK  258



>ref|XP_002461468.1| hypothetical protein SORBIDRAFT_02g003140 [Sorghum bicolor]
 gb|EER97989.1| hypothetical protein SORBIDRAFT_02g003140 [Sorghum bicolor]
Length=251

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
             RA+FSV L   EIEED  A+ G RP R P++RP+LVQ+ LD LFPG WLSE+T +  +V
Sbjct  171  HRARFSVTLTSEEIEEDIYAVTGARPRRCPRRRPRLVQKQLDMLFPGSWLSEVTVETCRV  230

Query  362  PDD  354
            PDD
Sbjct  231  PDD  233



>ref|XP_003620440.1| hypothetical protein MTR_6g083920 [Medicago truncatula]
 gb|AES76658.1| DUF1639 family protein [Medicago truncatula]
Length=230

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
             + ++ KFSV L+K E+EEDF A+ G RPPRRPKKR ++VQR L+TL PG+WLSE+T + 
Sbjct  163  NENEKVKFSVSLSKEEVEEDFWALAGTRPPRRPKKRSRIVQRQLNTLLPGMWLSEVTAES  222

Query  371  YKVPD  357
            YKV +
Sbjct  223  YKVSE  227



>ref|XP_009798000.1| PREDICTED: ankyrin-2 [Nicotiana sylvestris]
Length=339

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            +K  R +FS+ L++ EI+ED  A+ G +  RRPKKR K VQ+ LDTLFPGLWL+ ITPD 
Sbjct  270  KKEKRQRFSMALSREEIDEDIYAMTGLKAARRPKKRIKAVQKQLDTLFPGLWLASITPDS  329

Query  371  YKVPDD  354
            YKV ++
Sbjct  330  YKVCEN  335



>ref|XP_008656010.1| PREDICTED: atherin-like [Zea mays]
 gb|AFW81006.1| hypothetical protein ZEAMMB73_657495 [Zea mays]
Length=257

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -1

Query  530  FSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPDD  354
            FSV L   EIEED  A+ G RP RRP+KRP+ VQR +D+LFPGLWL+EIT D Y+VPD+
Sbjct  199  FSVSLKAEEIEEDIYALTGSRPRRRPRKRPRAVQRHVDSLFPGLWLTEITADAYRVPDE  257



>ref|XP_004961314.1| PREDICTED: protein enabled homolog [Setaria italica]
Length=265

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -1

Query  530  FSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPDD  354
            FSV L   EIEED  A+ G RP RRP+KRP+ VQR LD+LFPGLWL+EIT D Y+VPD+
Sbjct  207  FSVSLTAEEIEEDIYALTGARPRRRPRKRPRAVQRQLDSLFPGLWLTEITADAYRVPDE  265



>gb|KJB22886.1| hypothetical protein B456_004G071800 [Gossypium raimondii]
Length=406

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            +K  + KFS+ L + EI+ED  A+ G +  RRPKKR K VQ+ LD +FPGLWLS ITPD 
Sbjct  337  KKAKKQKFSISLTREEIDEDIFAMTGSKASRRPKKRAKNVQKQLDCVFPGLWLSSITPDS  396

Query  371  YKVPD  357
            Y+VP+
Sbjct  397  YRVPE  401



>ref|XP_009107337.1| PREDICTED: uncharacterized protein LOC103832982 [Brassica rapa]
 ref|XP_009107338.1| PREDICTED: uncharacterized protein LOC103832982 [Brassica rapa]
Length=166

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS-EITPD  375
            EK ++ KFSV L K EIEED+  I+G+RPPRRPKKRP++VQ+ L+T+FPG+WLS E+T D
Sbjct  97   EKNEKLKFSVSLLKAEIEEDYSIIIGKRPPRRPKKRPRIVQKKLNTIFPGMWLSEEVTID  156

Query  374  LYKVPD  357
             Y VP+
Sbjct  157  SYNVPE  162



>ref|XP_011017319.1| PREDICTED: uncharacterized protein LOC105120709 isoform X2 [Populus 
euphratica]
Length=284

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -1

Query  533  KFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPDD  354
            +FS+PL + EIEED  ++ G +P RR KKR K VQ+ LD LFPG+WL+ ITP+ YKV + 
Sbjct  221  RFSIPLTREEIEEDIYSLTGSKPARRSKKRAKHVQKQLDCLFPGMWLASITPECYKVHEA  280

Query  353  HSK  345
             SK
Sbjct  281  PSK  283



>ref|XP_006386535.1| hypothetical protein POPTR_0002s13700g [Populus trichocarpa]
 gb|ERP64332.1| hypothetical protein POPTR_0002s13700g [Populus trichocarpa]
Length=285

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -1

Query  533  KFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPDD  354
            +FS+PL + EIEED  ++ G +P RR KKR K VQ+ LD LFPG+WL+ ITP+ YKV + 
Sbjct  220  RFSIPLTREEIEEDIYSLTGSKPARRSKKRAKHVQKQLDCLFPGMWLASITPECYKVHEA  279

Query  353  HSK  345
             SK
Sbjct  280  PSK  282



>ref|XP_002302487.1| hypothetical protein POPTR_0002s13700g [Populus trichocarpa]
 gb|EEE81760.1| hypothetical protein POPTR_0002s13700g [Populus trichocarpa]
Length=283

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -1

Query  533  KFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPDD  354
            +FS+PL + EIEED  ++ G +P RR KKR K VQ+ LD LFPG+WL+ ITP+ YKV + 
Sbjct  220  RFSIPLTREEIEEDIYSLTGSKPARRSKKRAKHVQKQLDCLFPGMWLASITPECYKVHEA  279

Query  353  HSK  345
             SK
Sbjct  280  PSK  282



>ref|XP_011017318.1| PREDICTED: uncharacterized protein LOC105120709 isoform X1 [Populus 
euphratica]
Length=286

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -1

Query  533  KFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPDD  354
            +FS+PL + EIEED  ++ G +P RR KKR K VQ+ LD LFPG+WL+ ITP+ YKV + 
Sbjct  221  RFSIPLTREEIEEDIYSLTGSKPARRSKKRAKHVQKQLDCLFPGMWLASITPECYKVHEA  280

Query  353  HSK  345
             SK
Sbjct  281  PSK  283



>ref|XP_006375105.1| hypothetical protein POPTR_0014s04430g [Populus trichocarpa]
 gb|ERP52902.1| hypothetical protein POPTR_0014s04430g [Populus trichocarpa]
Length=308

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -1

Query  533  KFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPDD  354
            +FS+PL K EIEED  ++ G +P RRPKKR K VQ+ LD LFPG+WL  ITPD YKV + 
Sbjct  245  RFSIPLTKVEIEEDIYSLTGSKPARRPKKRAKHVQKQLDCLFPGMWLDSITPDCYKVHEA  304

Query  353  HSK  345
             SK
Sbjct  305  PSK  307



>ref|XP_011031753.1| PREDICTED: probable serine/threonine-protein kinase roco9 [Populus 
euphratica]
Length=311

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -1

Query  533  KFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPDD  354
            +FS+PL K EIEED  ++ G +P RRPKKR K VQ+ LD LFPG+WL  ITPD YKV + 
Sbjct  248  RFSIPLTKVEIEEDIYSLTGSKPARRPKKRAKHVQKQLDCLFPGMWLDSITPDCYKVHEA  307

Query  353  HSK  345
             SK
Sbjct  308  PSK  310



>ref|XP_009392921.1| PREDICTED: uncharacterized protein LOC103978740 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=201

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            +KR ++  +V L   EIEED  A+ G RP RRPKKRP+ VQR LD+LFPGLWLSEIT + 
Sbjct  136  DKRRKSGLTVSLTAEEIEEDIYAVTGSRPRRRPKKRPRAVQRLLDSLFPGLWLSEITVES  195

Query  371  YKVPDD  354
            YKV DD
Sbjct  196  YKVGDD  201



>emb|CDY40606.1| BnaC06g02220D [Brassica napus]
Length=165

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS-EITPD  375
            EK ++ KFSV L K+EIEEDF  ++G+R PRRPKKRP+ VQ+ L+T+FPGLWLS E+T D
Sbjct  96   EKDEKLKFSVSLMKKEIEEDFSNMIGKRLPRRPKKRPRTVQKKLNTIFPGLWLSEEVTID  155

Query  374  LYKVPD  357
             Y VP+
Sbjct  156  SYDVPE  161



>emb|CDY16463.1| BnaA08g03040D [Brassica napus]
Length=158

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS-EITPD  375
            E  ++ KFSV L K EIEEDF  I+G+RPPRRPKKRP++VQ+ L+T+FPG+WLS E+T D
Sbjct  89   ENNEKLKFSVSLLKAEIEEDFSFIIGKRPPRRPKKRPRIVQKKLNTIFPGMWLSEEVTID  148

Query  374  LYKVPD  357
             Y VP+
Sbjct  149  SYNVPE  154



>ref|NP_188458.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB01095.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAR92245.1| At3g18295 [Arabidopsis thaliana]
 gb|AAS76237.1| At3g18295 [Arabidopsis thaliana]
 gb|AEE76079.1| uncharacterized protein AT3G18295 [Arabidopsis thaliana]
Length=216

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS-EITPD  375
             K ++ KFSV L + EIE+DF A++G+RPPRRPKKRP+LVQ+ ++TLFPGLWL+ E+T D
Sbjct  147  NKNEKVKFSVSLLREEIEQDFSALIGKRPPRRPKKRPRLVQKQMNTLFPGLWLAEEVTAD  206

Query  374  LYKVPD  357
             Y VP+
Sbjct  207  SYDVPE  212



>emb|CDX77286.1| BnaC08g03310D [Brassica napus]
Length=165

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS-EITPD  375
            EK ++ KFSV L K EIEED+  I G+RPPRRPKKRP++VQ+ L+T+FPG+WLS E+T D
Sbjct  96   EKNEKLKFSVSLLKAEIEEDYSIITGKRPPRRPKKRPRIVQKKLNTIFPGMWLSEEVTID  155

Query  374  LYKVPD  357
             Y VP+
Sbjct  156  SYNVPE  161



>ref|XP_009147945.1| PREDICTED: uncharacterized protein LOC103871446 [Brassica rapa]
Length=165

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS-EITPD  375
            EK ++ KFSV L K+EIEEDF  ++G+R PRRPKKRP+ VQ+ L+T+FPGLWLS E+T D
Sbjct  96   EKDEKLKFSVSLLKKEIEEDFSNMIGKRLPRRPKKRPRTVQKKLNTIFPGLWLSEEVTID  155

Query  374  LYKVPD  357
             Y VP+
Sbjct  156  SYDVPE  161



>ref|XP_008812761.1| PREDICTED: uncharacterized protein LOC103723583 [Phoenix dactylifera]
 ref|XP_008812762.1| PREDICTED: uncharacterized protein LOC103723583 [Phoenix dactylifera]
Length=252

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK +R KF++ L++ EIEEDF+   G +PPRRPKKR ++ Q+ LD+LFPGLWLSE+T D 
Sbjct  188  EKGERQKFAISLSREEIEEDFLLFKGTKPPRRPKKRQRIAQKQLDSLFPGLWLSEVTLDS  247

Query  371  YKV  363
            YK+
Sbjct  248  YKI  250



>emb|CDX93694.1| BnaA06g03540D [Brassica napus]
Length=165

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS-EITPD  375
            EK ++ KFSV L K+EIEEDF  ++G+R PRRPKKRP+ VQ+ L+T+FPGLWLS E+T D
Sbjct  96   EKDEKLKFSVSLLKKEIEEDFSNMIGKRLPRRPKKRPRTVQKKLNTIFPGLWLSEEVTID  155

Query  374  LYKVPD  357
             Y VP+
Sbjct  156  SYDVPE  161



>gb|KFK39170.1| hypothetical protein AALP_AA3G209200 [Arabis alpina]
Length=208

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 53/65 (82%), Gaps = 1/65 (2%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSE-ITPDL  372
            K ++ KFSV L + EIEEDF A++G++PPRRPKKRP+LVQ+ ++TLFPGLWL+E +T   
Sbjct  140  KNEKVKFSVSLLREEIEEDFTALIGKKPPRRPKKRPRLVQKQMNTLFPGLWLAEQVTQGS  199

Query  371  YKVPD  357
            Y VP+
Sbjct  200  YDVPE  204



>ref|XP_003635203.1| PREDICTED: uncharacterized protein LOC100853295 [Vitis vinifera]
 emb|CBI29500.3| unnamed protein product [Vitis vinifera]
Length=240

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK+++ KF + L++ EIEED   + G +P RRPKKR K VQ+ LD +FPGLWL  +TPD 
Sbjct  171  EKKEKRKFWISLSREEIEEDIFVMTGSKPARRPKKRAKNVQKQLDNVFPGLWLVGVTPDS  230

Query  371  YKVPDDHSK  345
            Y++PD  +K
Sbjct  231  YRLPDAPAK  239



>ref|XP_008797798.1| PREDICTED: uncharacterized protein LOC103712883 [Phoenix dactylifera]
Length=260

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  530  FSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            FS+ L+++EIEEDFM   G +PPR+PKKRPK+VQ  LD+L PGLWLSEITP+ YK+
Sbjct  199  FSISLSRKEIEEDFMLFKGTKPPRKPKKRPKMVQEQLDSLLPGLWLSEITPNSYKI  254



>gb|AFK44975.1| unknown [Lotus japonicus]
Length=223

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            ++ KFSV L+K E+E+DF A+ G RPPRRPKKRP+ VQ+ L TL+PGLWLSE+T D YKV
Sbjct  159  EKIKFSVSLSKEEVEQDFWALAGTRPPRRPKKRPRNVQKQLTTLYPGLWLSELTADSYKV  218

Query  362  PD  357
             D
Sbjct  219  AD  220



>pir||F86383 hypothetical protein F4F7.22 - Arabidopsis thaliana
Length=767

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            ++ R  FS+ L+K+E+EEDF+ ++G R PRRPKKR K VQ+ LD+LFPGL+L+E+T D Y
Sbjct  704  EKKRPMFSMKLSKKEMEEDFIGMVGHRAPRRPKKRSKTVQKKLDSLFPGLYLTEVTHDAY  763

Query  368  KVPD  357
            KVP+
Sbjct  764  KVPE  767



>ref|XP_004490132.1| PREDICTED: uncharacterized protein LOC101493143 [Cicer arietinum]
Length=223

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            +R K SV L+++EIE+D+M ++G  PP +P++RPK VQ+ LDTLFPGLWL E+  ++YKV
Sbjct  145  ERPKLSVQLSRKEIEDDYMVLVGHGPPEKPEERPKAVQKHLDTLFPGLWLREVDENMYKV  204

Query  362  PD  357
             D
Sbjct  205  VD  206



>gb|AAG28819.2|AC079374_22 unknown protein [Arabidopsis thaliana]
Length=786

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            ++ R  FS+ L+K+E+EEDF+ ++G R PRRPKKR K VQ+ LD+LFPGL+L+E+T D Y
Sbjct  723  EKKRPMFSMKLSKKEMEEDFIGMVGHRAPRRPKKRSKTVQKKLDSLFPGLYLTEVTHDAY  782

Query  368  KVPD  357
            KVP+
Sbjct  783  KVPE  786



>ref|XP_008238431.1| PREDICTED: uncharacterized protein LOC103337059 [Prunus mume]
Length=229

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK+++ KF + L+K EIEED   + G RP RRPKKRPK VQ+ LDT FPGLWL  +T D 
Sbjct  160  EKKEKRKFWIALSKEEIEEDIFVMTGSRPARRPKKRPKNVQKQLDTTFPGLWLVGVTVDA  219

Query  371  YKVPDDHSK  345
            YKV D  SK
Sbjct  220  YKVADSPSK  228



>emb|CBI22411.3| unnamed protein product [Vitis vinifera]
Length=117

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -1

Query  530  FSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPD  357
            FSV L++ E+ +DFM ++G RP RRPKKR ++VQ  LD++F GLWL+EIT D YK+PD
Sbjct  53   FSVSLSREEVRDDFMVMVGTRPSRRPKKRARIVQTQLDSIFSGLWLTEITLDTYKLPD  110



>ref|XP_007209536.1| hypothetical protein PRUPE_ppa010718mg [Prunus persica]
 gb|EMJ10735.1| hypothetical protein PRUPE_ppa010718mg [Prunus persica]
Length=238

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK++  KF + L+K EIEED   + G RP RRPKKRPK VQ+ LD  FPGLWL  +T D 
Sbjct  160  EKKENRKFWIALSKEEIEEDIFVMTGSRPARRPKKRPKNVQKQLDITFPGLWLVGVTADA  219

Query  371  YKVPDDHSK*TIPWVMYK  318
            YKV D  SK ++    YK
Sbjct  220  YKVADSPSKVSLSLCFYK  237



>ref|XP_010544582.1| PREDICTED: uncharacterized protein LOC104817196 [Tarenaya hassleriana]
Length=302

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            K  + K ++ L+K EIEED  A+ G +P RRPKKR K VQ+ LD LFPGLW+  +TPD Y
Sbjct  237  KEKKRKLAISLSKTEIEEDIFALTGSKPSRRPKKRVKNVQKQLDVLFPGLWMGNVTPDAY  296

Query  368  KVPD  357
            KV D
Sbjct  297  KVSD  300



>emb|CDY24456.1| BnaC05g34980D [Brassica napus]
Length=195

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS-EITPDLYK  366
            ++ KFSV L + EIEEDF A++G++PPRRPKKRP+LVQ+ ++TLFPGLWL  E+T   Y 
Sbjct  128  EKLKFSVCLLREEIEEDFTALIGKKPPRRPKKRPRLVQKQMNTLFPGLWLGEEVTAGSYD  187

Query  365  VPD  357
            VPD
Sbjct  188  VPD  190



>ref|XP_003616744.1| hypothetical protein MTR_5g083820 [Medicago truncatula]
Length=297

 Score = 60.1 bits (144),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -1

Query  533  KFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPD  357
            KFS+ L K+EIEEDF+ + GQ+PPRRPK+RPK VQ+ ++TLFPG WL  +  D YKV D
Sbjct  179  KFSLSLTKKEIEEDFIKMTGQKPPRRPKRRPKNVQKQMNTLFPGAWLPGVNADSYKVSD  237


 Score = 23.5 bits (49),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 9/18 (50%), Positives = 12/18 (67%), Gaps = 0/18 (0%)
 Frame = -3

Query  693  AGGSSRGLNIDVTNPNVS  640
            AG + +GL ID   PN+S
Sbjct  147  AGETGKGLKIDEKKPNIS  164



>ref|XP_006406620.1| hypothetical protein EUTSA_v10021480mg [Eutrema salsugineum]
 gb|ESQ48073.1| hypothetical protein EUTSA_v10021480mg [Eutrema salsugineum]
Length=222

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS-EITPD  375
             K ++ KFSV L + EIEEDF A++G+RPPRRPKKRP++VQ+ ++TLFPGLWL+ E+T  
Sbjct  153  NKNEKVKFSVSLLREEIEEDFTALIGKRPPRRPKKRPRMVQKQMNTLFPGLWLAEEVTAG  212

Query  374  LYKVPD  357
             Y VP+
Sbjct  213  SYDVPE  218



>gb|AES99702.2| DUF1639 family protein [Medicago truncatula]
Length=284

 Score = 60.1 bits (144),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -1

Query  533  KFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPD  357
            KFS+ L K+EIEEDF+ + GQ+PPRRPK+RPK VQ+ ++TLFPG WL  +  D YKV D
Sbjct  179  KFSLSLTKKEIEEDFIKMTGQKPPRRPKRRPKNVQKQMNTLFPGAWLPGVNADSYKVSD  237


 Score = 23.5 bits (49),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 9/18 (50%), Positives = 12/18 (67%), Gaps = 0/18 (0%)
 Frame = -3

Query  693  AGGSSRGLNIDVTNPNVS  640
            AG + +GL ID   PN+S
Sbjct  147  AGETGKGLKIDEKKPNIS  164



>ref|XP_007052276.1| Uncharacterized protein TCM_005685 [Theobroma cacao]
 gb|EOX96433.1| Uncharacterized protein TCM_005685 [Theobroma cacao]
Length=287

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  530  FSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPD  357
            FS+ L++ EI++D  A+ G +P RRPKKR K VQ+ LD +FPGLWLS ITPD Y+V D
Sbjct  225  FSISLSREEIDDDIFAMTGSKPSRRPKKRAKNVQKQLDCVFPGLWLSSITPDCYRVSD  282



>emb|CBI16671.3| unnamed protein product [Vitis vinifera]
Length=117

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -1

Query  530  FSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPD  357
            FSV L + E+ +DFMA++G RPPRRPKKR ++VQ  LD++F GLWL+EIT D YK+PD
Sbjct  53   FSVSLLREEVRDDFMAMVGTRPPRRPKKRARIVQTQLDSIFSGLWLTEITLDTYKLPD  110



>ref|XP_002511612.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50281.1| conserved hypothetical protein [Ricinus communis]
Length=292

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  530  FSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPD  357
            FS+ L K EIEED  A+ G +P RRPKKR K VQ+ LD LFPGLWL+ +TPD+Y+V D
Sbjct  228  FSISLTKEEIEEDVYALTGSKPARRPKKRAKHVQKQLDYLFPGLWLASVTPDVYRVLD  285



>ref|XP_009380737.1| PREDICTED: uncharacterized protein LOC103969023 [Musa acuminata 
subsp. malaccensis]
Length=203

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            K+     +V L   EIEED  A+ G RP RRPKKRPK+VQR LD+LFPGLWLSEIT + Y
Sbjct  139  KKRNIGLTVSLTAEEIEEDIYAVTGSRPRRRPKKRPKVVQRLLDSLFPGLWLSEITVESY  198

Query  368  KVPDD  354
            KV DD
Sbjct  199  KVEDD  203



>ref|XP_010232954.1| PREDICTED: homeobox even-skipped homolog protein 2 [Brachypodium 
distachyon]
Length=224

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            DR +FS  L   EIEED  A+ G RP RRP++RP+ VQ+ LD+L PG WLSEIT D Y+V
Sbjct  161  DRPRFSATLTADEIEEDVYALTGARPRRRPRRRPRAVQKQLDSLLPGAWLSEITVDSYRV  220

Query  362  PDDH  351
            PD+ 
Sbjct  221  PDER  224



>gb|EPS72660.1| hypothetical protein M569_02097, partial [Genlisea aurea]
Length=68

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVP  360
            RAKF+  L+K+EIEED  +++G+RP RRPKKR + +Q+ ++ + PG WL+E+T D+YKV 
Sbjct  6    RAKFTGTLSKKEIEEDIFSMIGRRPQRRPKKRSRALQKQIENIIPGFWLTEVTADMYKVS  65



>emb|CAN68111.1| hypothetical protein VITISV_000765 [Vitis vinifera]
Length=418

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -1

Query  530  FSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPD  357
            FSV L + E+ +DFMA++G RPPRRPKKR ++VQ  LD++FPGLWL+EIT D YK+PD
Sbjct  123  FSVSLLREEVRDDFMAMVGTRPPRRPKKRARIVQTQLDSIFPGLWLTEITLDTYKLPD  180



>ref|XP_010461705.1| PREDICTED: uncharacterized protein LOC104742402 [Camelina sativa]
Length=189

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = -1

Query  533  KFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS-EITPDLYKVP  360
            KFS+PL++ EIE+DF    G++P RRPKKRP+LVQ+ L+T+FPGLWL+ E+T DLY  P
Sbjct  125  KFSIPLSREEIEQDFSIAFGKKPSRRPKKRPRLVQKKLNTIFPGLWLNEEVTIDLYNGP  183



>ref|XP_003614600.1| hypothetical protein MTR_5g056040 [Medicago truncatula]
 gb|AES97558.1| DUF1639 family protein [Medicago truncatula]
Length=270

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
             K +R KFSV L  +EIEEDF+A +G+ P +RP KRP+ VQR ++ +FPGLWL E+  ++
Sbjct  180  NKIERRKFSVQLLTKEIEEDFVAFMGRGPRKRPTKRPRNVQRQINNIFPGLWLREVNEEM  239

Query  371  YKVPDDH  351
            Y+V D +
Sbjct  240  YEVQDTN  246



>ref|XP_007155691.1| hypothetical protein PHAVU_003G223000g, partial [Phaseolus vulgaris]
 ref|XP_007155692.1| hypothetical protein PHAVU_003G223000g, partial [Phaseolus vulgaris]
 gb|ESW27685.1| hypothetical protein PHAVU_003G223000g, partial [Phaseolus vulgaris]
 gb|ESW27686.1| hypothetical protein PHAVU_003G223000g, partial [Phaseolus vulgaris]
Length=306

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK+++ KF + L++ EIEED   + G RP RRP+KRPK VQ+ +D++FPGLWL  IT D 
Sbjct  237  EKKEKRKFWIALSREEIEEDIFVMTGSRPARRPRKRPKNVQKQMDSVFPGLWLVGITADA  296

Query  371  YKVPDDHSK  345
            Y+VPD  +K
Sbjct  297  YRVPDTPTK  305



>ref|XP_010479306.1| PREDICTED: uncharacterized protein LOC104758179 [Camelina sativa]
Length=188

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS-EITPDLYK  366
            ++ KFS+PL + EIE+DF    G++P RRPKKRP+LVQ+ L+T+FPGLWL+ E+T DLY 
Sbjct  121  EKLKFSIPLTREEIEQDFSIAFGKKPSRRPKKRPRLVQKKLNTIFPGLWLNEEVTIDLYN  180

Query  365  VP  360
             P
Sbjct  181  GP  182



>ref|XP_009409929.1| PREDICTED: uncharacterized protein LOC103992071 [Musa acuminata 
subsp. malaccensis]
Length=225

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPG-LWLSEITPD  375
            EK +  KFS+ L++ EIEEDF AI G++ PRRPKKR K+VQR LD+LFPG L LSEIT D
Sbjct  160  EKGETRKFSISLSRPEIEEDFFAIKGRKLPRRPKKRAKIVQRELDSLFPGLLLLSEITTD  219

Query  374  LYKV  363
             YK+
Sbjct  220  SYKI  223



>ref|XP_009145905.1| PREDICTED: uncharacterized protein LOC103869577 [Brassica rapa]
Length=202

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS-EITPDLYK  366
            ++ KFSV L + EIEEDF A++G++PPRRPKKRP+LVQ+ ++TLFPGLWL  E+T   Y 
Sbjct  133  EKLKFSVCLLREEIEEDFTALIGKKPPRRPKKRPRLVQKQMNTLFPGLWLGEEVTAGSYD  192

Query  365  VPD  357
            VP+
Sbjct  193  VPE  195



>gb|KFK26684.1| hypothetical protein AALP_AA8G279800 [Arabis alpina]
Length=154

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 50/61 (82%), Gaps = 1/61 (2%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS-EITPDLYK  366
            ++ KFSV L K EIEEDF  ++G++PPRRPKKRP++VQ+ L+T+FPGLWLS E+T D Y 
Sbjct  87   EKLKFSVSLLKEEIEEDFFGLIGKKPPRRPKKRPRIVQKKLNTIFPGLWLSEEVTMDSYN  146

Query  365  V  363
            V
Sbjct  147  V  147



>emb|CDX92227.1| BnaA05g21800D [Brassica napus]
Length=207

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS-EITPDLYK  366
            ++ KFSV L + EIEEDF A++G++PPRRPKKRP+LVQ+ ++TLFPGLWL  E+T   Y 
Sbjct  138  EKLKFSVCLLREEIEEDFTALIGKKPPRRPKKRPRLVQKQMNTLFPGLWLGEEVTAGSYD  197

Query  365  VPD  357
            VP+
Sbjct  198  VPE  200



>ref|XP_010465919.1| PREDICTED: uncharacterized protein LOC104746198 [Camelina sativa]
Length=225

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS-EITPDLYK  366
            ++ KFSV L + EIE+DF A++G++PPRRPKKRP+LVQ+ ++ L PGLWL  E+T D Y 
Sbjct  159  NKVKFSVSLLREEIEQDFSALIGKKPPRRPKKRPRLVQKQINNLLPGLWLGEEVTADSYD  218

Query  365  VPDD  354
            VP+D
Sbjct  219  VPED  222



>emb|CDX84983.1| BnaC05g20720D [Brassica napus]
Length=252

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            R K SV L+K+EIEEDFMA++G RPPRRPKKRP+ VQ+ LD+L P  +L+E+T D YKV
Sbjct  186  RPKLSVKLSKKEIEEDFMAVVGHRPPRRPKKRPRTVQKKLDSLHPAFYLTEVTLDDYKV  244



>ref|XP_004508940.1| PREDICTED: uncharacterized protein LOC101492028 [Cicer arietinum]
Length=242

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK+++ KF + L+K EIEED   + G RP RRP+KRPK VQ+ +D++FPGLWL  IT D 
Sbjct  173  EKKEKRKFWIALSKEEIEEDIFVMTGSRPNRRPRKRPKNVQKQMDSVFPGLWLVGITADA  232

Query  371  YKVPDDHSK  345
            Y+V D  +K
Sbjct  233  YRVADTPTK  241



>gb|KDO85566.1| hypothetical protein CISIN_1g022095mg [Citrus sinensis]
Length=302

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -1

Query  530  FSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            FS+ L K EIE+DF A+ G +P RRPKKR K VQ+ LD +FPGLWL+ ITP+ YKV
Sbjct  238  FSISLKKEEIEDDFFAMTGAKPSRRPKKRAKNVQKQLDYVFPGLWLASITPESYKV  293



>ref|XP_006445387.1| hypothetical protein CICLE_v10021338mg [Citrus clementina]
 ref|XP_006464452.1| PREDICTED: uncharacterized protein LOC102609123 isoform X2 [Citrus 
sinensis]
 gb|ESR58627.1| hypothetical protein CICLE_v10021338mg [Citrus clementina]
Length=300

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -1

Query  530  FSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            FS+ L K EIE+DF A+ G +P RRPKKR K VQ+ LD +FPGLWL+ ITP+ YKV
Sbjct  238  FSISLKKEEIEDDFFAMTGAKPSRRPKKRAKNVQKQLDYVFPGLWLASITPESYKV  293



>emb|CDY51938.1| BnaAnng11150D [Brassica napus]
Length=174

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSE-ITPD  375
            EK+++ KFSV L++ EIEEDF ++ G++PPRRPKKRP+LVQ  ++TLFPGLWL+E +T  
Sbjct  108  EKKEKVKFSVSLSRGEIEEDFTSLFGKKPPRRPKKRPRLVQNQINTLFPGLWLAEQVTEG  167

Query  374  LYK  366
             Y+
Sbjct  168  SYE  170



>ref|XP_006445388.1| hypothetical protein CICLE_v10021338mg [Citrus clementina]
 ref|XP_006464451.1| PREDICTED: uncharacterized protein LOC102609123 isoform X1 [Citrus 
sinensis]
 gb|ESR58628.1| hypothetical protein CICLE_v10021338mg [Citrus clementina]
Length=302

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -1

Query  530  FSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            FS+ L K EIE+DF A+ G +P RRPKKR K VQ+ LD +FPGLWL+ ITP+ YKV
Sbjct  238  FSISLKKEEIEDDFFAMTGAKPSRRPKKRAKNVQKQLDYVFPGLWLASITPESYKV  293



>ref|XP_002466732.1| hypothetical protein SORBIDRAFT_01g013085 [Sorghum bicolor]
 gb|EER93730.1| hypothetical protein SORBIDRAFT_01g013085 [Sorghum bicolor]
Length=160

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL--YK  366
            RA+FS+ L   EIEED  A+ G RP RRP+ RP+ VQ+ LD LFPG WLS++T +   Y+
Sbjct  96   RARFSLTLTSEEIEEDIYAVTGARPRRRPRLRPRPVQKQLDMLFPGSWLSKVTAETYRYR  155

Query  365  VPDD  354
            VPDD
Sbjct  156  VPDD  159



>gb|KDO85567.1| hypothetical protein CISIN_1g022095mg [Citrus sinensis]
Length=300

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -1

Query  530  FSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            FS+ L K EIE+DF A+ G +P RRPKKR K VQ+ LD +FPGLWL+ ITP+ YKV
Sbjct  238  FSISLKKEEIEDDFFAMTGAKPSRRPKKRAKNVQKQLDYVFPGLWLASITPESYKV  293



>ref|XP_003614596.1| hypothetical protein MTR_5g055990 [Medicago truncatula]
Length=388

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
             K +R KF +P++++E EEDF+  LG+ P +RP KRPK VQ+ ++ +FPGLWL E+T ++
Sbjct  139  NKIERPKFCIPISRKEKEEDFLTFLGRAPRQRPIKRPKKVQKQINKVFPGLWLREVTAEM  198

Query  371  YKVPDDH  351
            Y+V D +
Sbjct  199  YEVHDTN  205



>ref|XP_006391149.1| hypothetical protein EUTSA_v10018875mg [Eutrema salsugineum]
 gb|ESQ28435.1| hypothetical protein EUTSA_v10018875mg [Eutrema salsugineum]
Length=323

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -1

Query  518  LAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPD  357
            L+K+EIEED+MA++G RPPRRPKKR + VQ+ ++ L+P L++SEITPD+YKV D
Sbjct  263  LSKKEIEEDYMALVGHRPPRRPKKRSRTVQKQIELLYPALYISEITPDMYKVSD  316



>emb|CDY42113.1| BnaA09g28470D [Brassica napus]
Length=238

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            R KF V L+K+EIEEDFMA++G RPPRRPKKRP+ VQ+ LD+L P  +L+E+T D YKV
Sbjct  175  RPKFFVKLSKKEIEEDFMAVVGHRPPRRPKKRPRTVQKKLDSLHPAFYLTEVTLDDYKV  233



>ref|XP_009115304.1| PREDICTED: uncharacterized protein LOC103840559 [Brassica rapa]
Length=281

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            R KF V L+K+EIEEDFMA++G RPPRRPKKRP+ VQ+ LD+L P  +L+E+T D YKV
Sbjct  218  RPKFFVKLSKKEIEEDFMAVVGHRPPRRPKKRPRTVQKKLDSLHPAFYLTEVTLDDYKV  276



>ref|XP_010500418.1| PREDICTED: uncharacterized protein LOC104777796 [Camelina sativa]
Length=182

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS-EITPDLYK  366
            ++ KFS+PL + EIE+DF    G++P RRPKKRP+LVQ+ L+T+FPGLWL+ E+T DLY 
Sbjct  115  EKLKFSIPLTREEIEQDFSIAFGKKPSRRPKKRPRLVQKKLNTIFPGLWLNEEVTIDLYN  174



>ref|XP_009135574.1| PREDICTED: uncharacterized protein LOC103859748 [Brassica rapa]
Length=172

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSE  387
            EK+++ KFSV L++ EIEEDF ++ G++PPRRPKKRP+LVQ  ++TLFPGLWL+E
Sbjct  106  EKKEKVKFSVSLSRGEIEEDFTSLFGKKPPRRPKKRPRLVQNQINTLFPGLWLAE  160



>gb|KJB40993.1| hypothetical protein B456_007G086800 [Gossypium raimondii]
 gb|KJB40994.1| hypothetical protein B456_007G086800 [Gossypium raimondii]
 gb|KJB40996.1| hypothetical protein B456_007G086800 [Gossypium raimondii]
 gb|KJB40997.1| hypothetical protein B456_007G086800 [Gossypium raimondii]
Length=295

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -1

Query  530  FSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            FSV L++ EI++D  A+ G +  RRPKKR K VQ+ LD +FPGLWL+ +TPD Y+V
Sbjct  233  FSVSLSRDEIDDDIFAMTGSKASRRPKKRAKSVQKQLDCVFPGLWLASVTPDCYRV  288



>ref|XP_004510121.1| PREDICTED: histone-lysine N-methyltransferase EHMT2-like [Cicer 
arietinum]
Length=233

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -1

Query  524  VPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPD  357
            VPL+K EIE DF+ + G++P ++P KRPK VQ+ LD +FPGL+L+ ITP+ Y VPD
Sbjct  173  VPLSKEEIENDFILMTGEKPSKKPTKRPKPVQKLLDGIFPGLYLNNITPETYGVPD  228



>ref|XP_008437045.1| PREDICTED: uncharacterized protein LOC103482589 [Cucumis melo]
Length=246

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK+D+ KF + L++ EIEED   + G RP RRPKKRPK VQ+ LDT+FPGLWL  +T D 
Sbjct  177  EKKDKRKFWIALSRDEIEEDIFIMTGSRPSRRPKKRPKNVQKQLDTVFPGLWLVGVTADS  236

Query  371  YKVPDDHSK  345
            Y++ D  +K
Sbjct  237  YRLADSPAK  245



>ref|XP_004152391.1| PREDICTED: uncharacterized protein LOC101222282 [Cucumis sativus]
 ref|XP_004158130.1| PREDICTED: uncharacterized LOC101222282 [Cucumis sativus]
 gb|KGN50280.1| hypothetical protein Csa_5G165250 [Cucumis sativus]
Length=246

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK+D+ KF + L++ EIEED   + G RP RRPKKRPK VQ+ LDT+FPGLWL  +T D 
Sbjct  177  EKKDKRKFWIALSRDEIEEDIFIMTGSRPSRRPKKRPKNVQKQLDTVFPGLWLVGVTADS  236

Query  371  YKVPDDHSK  345
            Y++ D  +K
Sbjct  237  YRLADSPAK  245



>gb|KJB40995.1| hypothetical protein B456_007G086800 [Gossypium raimondii]
Length=295

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -1

Query  530  FSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            FSV L++ EI++D  A+ G +  RRPKKR K VQ+ LD +FPGLWL+ +TPD Y+V
Sbjct  233  FSVSLSRDEIDDDIFAMTGSKASRRPKKRAKSVQKQLDCVFPGLWLASVTPDCYRV  288



>ref|XP_003608674.1| hypothetical protein MTR_4g100570 [Medicago truncatula]
 gb|AES90871.1| DUF1639 family protein [Medicago truncatula]
Length=243

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK+++ KF + L+K EIEED   + G RP RRP+KR K VQ+ +D +FPGLWL  IT D 
Sbjct  174  EKKEKRKFWIALSKDEIEEDIFVMTGSRPNRRPRKRAKNVQKQMDNVFPGLWLVGITADA  233

Query  371  YKVPDDHSK  345
            Y+V D  +K
Sbjct  234  YRVADTPTK  242



>ref|XP_003614606.1| hypothetical protein MTR_5g056110 [Medicago truncatula]
 gb|AES97564.1| DUF1639 family protein [Medicago truncatula]
Length=237

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -1

Query  533  KFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPD  357
            KFS+ L ++EI+EDFM + G RP +RP KRP++VQ+ LD +FPGLWLS++  + YKV D
Sbjct  155  KFSLQLLRKEIDEDFMVLTGCRPRKRPTKRPRVVQKELDNVFPGLWLSDVNAEKYKVHD  213



>ref|XP_003525577.1| PREDICTED: histone-lysine N-methyltransferase 2E-like [Glycine 
max]
Length=241

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK+++ KF + L++ EIEED   + G RP RRP+KRPK VQ+ +D++FPGLWL  IT D 
Sbjct  172  EKKEKRKFWIALSREEIEEDIFVMTGSRPARRPRKRPKNVQKQMDSVFPGLWLVGITADA  231

Query  371  YKVPDDHSK  345
            Y+V D  +K
Sbjct  232  YRVADTPTK  240



>emb|CDX75964.1| BnaC03g40470D [Brassica napus]
Length=489

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 52/66 (79%), Gaps = 1/66 (2%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSE-ITPD  375
            EK+++ KFSV L + EIEEDF ++ G++PPRRPKKRP+LVQ  + TLFPGLWL+E +T  
Sbjct  111  EKKEKVKFSVSLLRGEIEEDFTSLFGKKPPRRPKKRPRLVQNQIITLFPGLWLAEQVTEG  170

Query  374  LYKVPD  357
             Y VP+
Sbjct  171  SYVVPE  176



>gb|KHG28078.1| hypothetical protein F383_15853 [Gossypium arboreum]
Length=295

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -1

Query  530  FSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            FSV L++ EI++D  A+ G +  RRPKKR K VQ+ LD +FPGLWL+ ITPD Y+V
Sbjct  233  FSVSLSREEIDDDIFAMTGSKASRRPKKRAKSVQKQLDFVFPGLWLASITPDCYRV  288



>ref|XP_010487745.1| PREDICTED: uncharacterized protein LOC104765689 [Camelina sativa]
Length=237

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = -1

Query  545  RDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS-EITPDLY  369
             ++ KFSV L + EIE+DF A++G++PPRRPKKRP+LVQ+ ++ L PGLWL  E+T D Y
Sbjct  170  HNKVKFSVSLLREEIEQDFSALIGKKPPRRPKKRPRLVQKQINNLLPGLWLGEEVTADSY  229

Query  368  KVPD  357
             VP+
Sbjct  230  DVPE  233



>ref|XP_010916411.1| PREDICTED: uncharacterized protein LOC105041236 isoform X2 [Elaeis 
guineensis]
Length=270

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            K  R KFS+ L++ EIEED M      PP RPKKRPK+VQ  LD +FPGLWLSEITP  Y
Sbjct  207  KGKRPKFSISLSREEIEEDLMLFKKTMPPWRPKKRPKIVQNQLDLIFPGLWLSEITPKSY  266

Query  368  KV  363
            K+
Sbjct  267  KI  268



>gb|KJB51827.1| hypothetical protein B456_008G233300 [Gossypium raimondii]
Length=209

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK+++ KF + L+K EIEED  A+ G RP RRPKKRPK +++ LD +FPGLWL  +TP+ 
Sbjct  139  EKKEKRKFRIALSKDEIEEDIFALTGARPARRPKKRPKNIEKQLDNVFPGLWLVGLTPEA  198

Query  371  YKVPD  357
            Y++ D
Sbjct  199  YRIVD  203



>ref|XP_010506750.1| PREDICTED: uncharacterized protein LOC104783308 [Camelina sativa]
Length=236

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = -1

Query  545  RDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS-EITPDLY  369
             ++ KFSV L + EIE+DF A++G++PPRRPKKRP+LVQ+ ++ L PGLWL  E+T D Y
Sbjct  169  NNKVKFSVSLLREEIEQDFSALIGKKPPRRPKKRPRLVQKQINNLLPGLWLGEEVTADSY  228

Query  368  KVPD  357
             VP+
Sbjct  229  DVPE  232



>ref|XP_010916410.1| PREDICTED: uncharacterized protein LOC105041236 isoform X1 [Elaeis 
guineensis]
Length=274

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            K  R KFS+ L++ EIEED M      PP RPKKRPK+VQ  LD +FPGLWLSEITP  Y
Sbjct  207  KGKRPKFSISLSREEIEEDLMLFKKTMPPWRPKKRPKIVQNQLDLIFPGLWLSEITPKSY  266

Query  368  KV  363
            K+
Sbjct  267  KI  268



>ref|XP_004969599.1| PREDICTED: dual specificity protein phosphatase 8-like isoform 
X2 [Setaria italica]
Length=211

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -1

Query  530  FSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            FSV L+K EI EDFMAI G RPPRRPKKRP+ VQR LD L+PGL L+++TP  YK+
Sbjct  153  FSVVLSKEEIAEDFMAIRGSRPPRRPKKRPRTVQRQLDLLYPGLSLADVTPGSYKI  208



>ref|XP_002888655.1| hypothetical protein ARALYDRAFT_894597 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64914.1| hypothetical protein ARALYDRAFT_894597 [Arabidopsis lyrata subsp. 
lyrata]
Length=251

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -1

Query  545  RDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYK  366
            +DR++    L+K+EIEED+M ++GQ+PPRRPKKR + VQ+ +D L  G +++EIT DLY 
Sbjct  182  KDRSRLYYTLSKKEIEEDYMKMMGQKPPRRPKKRSRNVQKQIDLLNFGSYITEITEDLYN  241

Query  365  VPDDHSK  345
            VPD   K
Sbjct  242  VPDQAEK  248



>gb|KDP39908.1| hypothetical protein JCGZ_03439 [Jatropha curcas]
Length=274

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK+++ KF + L++ EIEED  A+ G RP RRPKKRPK VQ++LD +FPGLWL   T D 
Sbjct  205  EKKEKRKFWIALSREEIEEDIFALTGSRPARRPKKRPKNVQKALDNVFPGLWLVGTTADS  264

Query  371  YKVPD  357
            Y+V D
Sbjct  265  YRVAD  269



>ref|XP_006305620.1| hypothetical protein CARUB_v10010307mg, partial [Capsella rubella]
 gb|EOA38518.1| hypothetical protein CARUB_v10010307mg, partial [Capsella rubella]
Length=206

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWL-SEITPDLYK  366
            ++ KFS+PL++ EIE+DF    G++PPRRPKKRP+LVQ+ L+T+FPGLWL  E+T D Y 
Sbjct  140  EKLKFSIPLSREEIEQDFFIAFGKKPPRRPKKRPRLVQKKLNTIFPGLWLDEEVTIDSYN  199

Query  365  VP  360
             P
Sbjct  200  GP  201



>ref|XP_006402583.1| hypothetical protein EUTSA_v10006081mg [Eutrema salsugineum]
 gb|ESQ44036.1| hypothetical protein EUTSA_v10006081mg [Eutrema salsugineum]
Length=274

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            K  + + S+ L+K EI+ED  A+ G +P RRPKKR K VQ+ LD LFPGLW+  ++PD Y
Sbjct  209  KEKKPRLSIALSKLEIDEDIYALTGSKPSRRPKKRAKNVQKQLDVLFPGLWMGNVSPDAY  268

Query  368  KV  363
            KV
Sbjct  269  KV  270



>ref|NP_175309.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG60119.1|AC073555_3 hypothetical protein [Arabidopsis thaliana]
 gb|AEE32348.1| uncharacterized protein AT1G48770 [Arabidopsis thaliana]
Length=179

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 52/64 (81%), Gaps = 2/64 (3%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS--EITP  378
            +K +++KFS+ L++ EIE+DF  + G++PP+RPKKRP+LVQ+ L+T+FPGLWL+  E+T 
Sbjct  114  KKNEKSKFSIALSRDEIEQDFSFVFGKKPPKRPKKRPRLVQKKLNTIFPGLWLNEEEVTI  173

Query  377  DLYK  366
            D Y 
Sbjct  174  DSYN  177



>ref|XP_006402584.1| hypothetical protein EUTSA_v10006081mg [Eutrema salsugineum]
 gb|ESQ44037.1| hypothetical protein EUTSA_v10006081mg [Eutrema salsugineum]
Length=340

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            K  + + S+ L+K EI+ED  A+ G +P RRPKKR K VQ+ LD LFPGLW+  ++PD Y
Sbjct  275  KEKKPRLSIALSKLEIDEDIYALTGSKPSRRPKKRAKNVQKQLDVLFPGLWMGNVSPDAY  334

Query  368  KV  363
            KV
Sbjct  335  KV  336



>gb|KHG00791.1| Treacle [Gossypium arboreum]
Length=209

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK+++ KF + ++K EIEED  A+ G RP RRPKKRPK +++ LD +FPGLWL  +TP+ 
Sbjct  139  EKKEKRKFRIAISKDEIEEDIFALTGARPARRPKKRPKNIEKQLDNVFPGLWLVGLTPEA  198

Query  371  YKVPD  357
            Y++ D
Sbjct  199  YRIVD  203



>gb|KJB25523.1| hypothetical protein B456_004G196000 [Gossypium raimondii]
 gb|KJB25524.1| hypothetical protein B456_004G196000 [Gossypium raimondii]
 gb|KJB25525.1| hypothetical protein B456_004G196000 [Gossypium raimondii]
Length=224

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK+++ KF + L+K EIEED   I G RP RRPKKRPK +Q+ LD +FPGLWL   T D 
Sbjct  155  EKKEKRKFWIALSKEEIEEDIFVITGSRPARRPKKRPKNIQKQLDNVFPGLWLVGTTADA  214

Query  371  YKVPD  357
            Y++ D
Sbjct  215  YRIAD  219



>gb|KHF98922.1| hypothetical protein F383_19218 [Gossypium arboreum]
Length=255

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK+++ KF + L+K EIEED   I G RP RRPKKRPK +Q+ LD +FPGLWL   T D 
Sbjct  155  EKKEKRKFWIALSKEEIEEDIFVITGSRPARRPKKRPKNIQKQLDNVFPGLWLVGTTADA  214

Query  371  YKVPD  357
            Y++ D
Sbjct  215  YRIAD  219



>ref|XP_006440252.1| hypothetical protein CICLE_v10022000mg [Citrus clementina]
 gb|ESR53492.1| hypothetical protein CICLE_v10022000mg [Citrus clementina]
Length=216

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            +K+++ KF V L++ EIEED   + G RP RRP+KRPK VQ+ LD +FPGLWL  +T D 
Sbjct  147  DKKEKNKFWVTLSREEIEEDIFIMTGSRPARRPRKRPKNVQKQLDNVFPGLWLVGLTADA  206

Query  371  YKVPD  357
            Y+V D
Sbjct  207  YRVSD  211



>ref|XP_004969598.1| PREDICTED: dual specificity protein phosphatase 8-like isoform 
X1 [Setaria italica]
Length=234

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -1

Query  530  FSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            FSV L+K EI EDFMAI G RPPRRPKKRP+ VQR LD L+PGL L+++TP  YK+
Sbjct  153  FSVVLSKEEIAEDFMAIRGSRPPRRPKKRPRTVQRQLDLLYPGLSLADVTPGSYKI  208



>ref|XP_010651199.1| PREDICTED: uncharacterized protein LOC104879578 [Vitis vinifera]
Length=211

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -1

Query  533  KFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            KFS+ L++ EIEEDF+ + G +PPR+P KRPK VQ+ LD L PGLWL E+ P  Y  
Sbjct  144  KFSITLSREEIEEDFLKMTGSKPPRKPNKRPKNVQKVLDNLTPGLWLHEVNPSSYNC  200



>gb|EYU31915.1| hypothetical protein MIMGU_mgv1a015714mg [Erythranthe guttata]
Length=148

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  530  FSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPDDH  351
             S+ L+K+EIEED  ++ G +P RRPKKR K +QR LD +FPG WL  ITPD YKV ++ 
Sbjct  86   ISIALSKQEIEEDIYSLTGLKPARRPKKRAKNIQRELDFVFPGQWLVSITPDSYKVSENS  145

Query  350  SK  345
             K
Sbjct  146  LK  147



>ref|XP_006302663.1| hypothetical protein CARUB_v10020767mg, partial [Capsella rubella]
 gb|EOA35561.1| hypothetical protein CARUB_v10020767mg, partial [Capsella rubella]
Length=278

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            DR +    L+K+EIEED++ I GQRPPRRPKKR + VQ+ +D L P  +++E+T DLY V
Sbjct  210  DRMRLLYTLSKKEIEEDYIKITGQRPPRRPKKRSRTVQKQIDMLNPACYITEVTEDLYNV  269

Query  362  PD  357
            PD
Sbjct  270  PD  271



>ref|XP_011093280.1| PREDICTED: uncharacterized protein LOC105173283 [Sesamum indicum]
Length=372

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -1

Query  530  FSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPDD  354
             SV L+K EIEED  A+ G +P RRPKKR K +Q+ +D++FPGLWL  IT D YKV ++
Sbjct  310  ISVALSKEEIEEDIFALTGSKPARRPKKRAKNIQKQVDSVFPGLWLVSITADSYKVSEN  368



>ref|XP_003549926.1| PREDICTED: uncharacterized protein LOC100812835 isoform X1 [Glycine 
max]
 ref|XP_006600845.1| PREDICTED: uncharacterized protein LOC100812835 isoform X2 [Glycine 
max]
Length=237

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            K+++ KF + L++ EIEED   + G RP RRP+KRPK VQ+ +D++FPGLWL  IT D Y
Sbjct  169  KKEKRKFWIALSREEIEEDIFVMTGSRPARRPRKRPKNVQKQMDSVFPGLWLVGITADAY  228

Query  368  KVPDDHSK  345
            +V D  +K
Sbjct  229  RVADTPAK  236



>ref|XP_006477140.1| PREDICTED: uncharacterized protein LOC102618144 isoform X1 [Citrus 
sinensis]
Length=216

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            +K+++ KF V L++ EIEED   + G RP RRP+KRPK VQ+ LD +FPGLWL  +T D 
Sbjct  147  DKKEKNKFWVTLSREEIEEDIFIMTGSRPARRPRKRPKNVQKQLDNVFPGLWLVGLTVDA  206

Query  371  YKVPD  357
            Y+V D
Sbjct  207  YRVSD  211



>ref|XP_003569589.1| PREDICTED: formin-like protein 15 [Brachypodium distachyon]
Length=236

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  542  DRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKV  363
            +RA F++ L   EIEED  A+ G RP RRP+KR ++VQR LD+LFPGLWL+EIT D Y+V
Sbjct  174  ERAPFALALEAEEIEEDIYALTGARPRRRPRKRSRIVQRQLDSLFPGLWLTEITADAYRV  233

Query  362  PDD  354
            PDD
Sbjct  234  PDD  236



>gb|KDO61351.1| hypothetical protein CISIN_1g027940mg [Citrus sinensis]
 gb|KDO61352.1| hypothetical protein CISIN_1g027940mg [Citrus sinensis]
Length=216

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            +K+++ KF V L++ EIEED   + G RP RRP+KRPK VQ+ LD +FPGLWL  +T D 
Sbjct  147  DKKEKNKFWVTLSREEIEEDIFIMTGSRPARRPRKRPKNVQKQLDNVFPGLWLVGLTVDA  206

Query  371  YKVPD  357
            Y+V D
Sbjct  207  YRVSD  211



>ref|XP_009112799.1| PREDICTED: uncharacterized protein LOC103838123 [Brassica rapa]
Length=181

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -1

Query  533  KFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS-EITPDLYKVPD  357
            KFSV L + EIE+DF A +G++PPRRPKKRP+ VQ+ ++TLFPGLWL+ E+T   Y VP+
Sbjct  117  KFSVALLREEIEDDFTAFVGKKPPRRPKKRPRTVQKQMNTLFPGLWLAEEVTAGSYDVPE  176



>ref|XP_009105379.1| PREDICTED: uncharacterized protein LOC103831248 [Brassica rapa]
Length=184

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = -1

Query  539  RAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVP  360
            R KF+  L K+E+E+DF+A+ G +PPRRPKKRP+ VQ+ +D L P  + +E+T DLY VP
Sbjct  117  RPKFNPTLTKKEVEDDFIAMTGHKPPRRPKKRPRNVQKQIDRLHPASYFAEVTEDLYDVP  176

Query  359  D  357
            D
Sbjct  177  D  177



>ref|XP_009345057.1| PREDICTED: uncharacterized protein LOC103936895 [Pyrus x bretschneideri]
Length=277

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -1

Query  548  KRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLY  369
            K ++ K S+ L + EIEED   + GQRP RRPKKR K VQ+ LD LFPGLW++ ++ + Y
Sbjct  209  KDNKPKISIELTREEIEEDLFIMTGQRPSRRPKKRNKNVQKQLDNLFPGLWMNSVSRESY  268

Query  368  KVPD  357
            +VP+
Sbjct  269  QVPE  272



>ref|XP_010677085.1| PREDICTED: uncharacterized protein LOC104892783 [Beta vulgaris 
subsp. vulgaris]
Length=218

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EKR++ KF + L++ EIEED  ++ G +P RRPKKRPK+VQ+ ++ +FPG WL  +TP+ 
Sbjct  149  EKREKKKFWIALSRDEIEEDIYSMTGHKPSRRPKKRPKIVQKQVENVFPGFWLVGVTPEA  208

Query  371  YK  366
            Y+
Sbjct  209  YR  210



>ref|XP_008374055.1| PREDICTED: uncharacterized protein LOC103437364 [Malus domestica]
Length=314

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            +K ++ K S+ L + EIEED   + GQRP RRPKKR K VQ+ LD LFPGLW++ ++ + 
Sbjct  212  KKDNKPKISIELTREEIEEDLFIMTGQRPSRRPKKRNKNVQKQLDNLFPGLWMNSVSRES  271

Query  371  YKVPD  357
            Y+VP+
Sbjct  272  YQVPE  276



>ref|XP_007203454.1| hypothetical protein PRUPE_ppa022138mg, partial [Prunus persica]
 gb|EMJ04653.1| hypothetical protein PRUPE_ppa022138mg, partial [Prunus persica]
Length=314

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            +K ++ K SV L K EIEED   + G RP RRPKKR K VQ+ LD LFPGLWL+ ++ + 
Sbjct  246  KKDNKLKISVSLTKEEIEEDIFIMTGARPSRRPKKRAKNVQKQLDHLFPGLWLNSVSTNS  305

Query  371  YKVPD  357
            Y+VP+
Sbjct  306  YQVPE  310



>emb|CDY18514.1| BnaA01g26810D [Brassica napus]
Length=181

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -1

Query  533  KFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLS-EITPDLYKVPD  357
            KFSV L + EIE+DF A +G++PPRRPKKRP+ VQ+ ++TLFPGLWL+ E+T   Y VP+
Sbjct  117  KFSVSLLREEIEDDFTAFVGKKPPRRPKKRPRTVQKQMNTLFPGLWLAEEVTAGSYDVPE  176



>emb|CDP20668.1| unnamed protein product [Coffea canephora]
Length=263

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EKR +  F++ L++ EIEED  A+LG +P RRPKKR K VQ+ +D +FPG WL  IT D 
Sbjct  195  EKR-KIGFTLALSREEIEEDLFALLGSKPSRRPKKRSKTVQKLMDNVFPGAWLQSITADS  253

Query  371  YKVPDDHSK  345
            YKV +   K
Sbjct  254  YKVSEHPGK  262



>ref|XP_003592633.1| hypothetical protein MTR_1g110360 [Medicago truncatula]
 gb|AES62884.1| DUF1639 family protein [Medicago truncatula]
Length=240

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 6/59 (10%)
 Frame = -1

Query  533  KFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDLYKVPD  357
            KFS+ L K+EIEEDF+ + GQ+PPRRPK+ PK      +TLFPG WLS++  D YKVPD
Sbjct  181  KFSLSLTKKEIEEDFIKMTGQKPPRRPKRGPK------NTLFPGAWLSQVNADSYKVPD  233



>ref|XP_007039763.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007039764.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007039765.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007039767.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY24264.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY24265.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY24266.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY24268.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=223

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            EK+++ KF + L++ EIEED   + G RP RRPKKRPK +Q+ LD +FPGLWL   T D 
Sbjct  154  EKKEKRKFWIALSREEIEEDIFVMTGSRPARRPKKRPKNIQKQLDAVFPGLWLVGTTADA  213

Query  371  YKVPD  357
            Y+V D
Sbjct  214  YRVAD  218



>ref|XP_009413668.1| PREDICTED: uncharacterized protein LOC103994930 [Musa acuminata 
subsp. malaccensis]
Length=253

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -1

Query  551  EKRDRAKFSVPLAKREIEEDFMAILGQrpprrpkkrpKLVQRSLDTLFPGLWLSEITPDL  372
            E+R+R KFS+ L + EIEED  A+  +R  RRP++RP+ VQ+ L++LFPG  LSEI    
Sbjct  189  ERRERPKFSISLTREEIEEDIYALTARRARRRPRRRPRAVQKQLESLFPGSSLSEINAAT  248

Query  371  YKVPD  357
            Y+VP 
Sbjct  249  YRVPS  253



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1179751321320