BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF025F09

Length=763
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006341557.1|  PREDICTED: guanine nucleotide-binding protei...    358   3e-120   
ref|XP_009611065.1|  PREDICTED: guanine nucleotide-binding protei...    355   3e-119   Nicotiana tomentosiformis
gb|ABB86277.1|  ArcA2 protein-like                                      355   5e-119   Solanum tuberosum [potatoes]
gb|AJE63428.1|  transcription factor ArcA1                              355   7e-119   Capsicum annuum
ref|XP_009776114.1|  PREDICTED: guanine nucleotide-binding protei...    354   2e-118   Nicotiana sylvestris
emb|CAA96528.1|  G protein beta-subunit-like protein                    354   2e-118   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009780116.1|  PREDICTED: guanine nucleotide-binding protei...    353   2e-118   Nicotiana sylvestris
ref|XP_009600162.1|  PREDICTED: guanine nucleotide-binding protei...    352   8e-118   Nicotiana tomentosiformis
ref|NP_001233881.1|  ArcA2 protein                                      351   2e-117   
gb|ABB02625.1|  G protein beta subunit-like protein                     348   2e-117   Solanum tuberosum [potatoes]
ref|XP_004252270.1|  PREDICTED: guanine nucleotide-binding protei...    351   2e-117   Solanum lycopersicum
ref|XP_009624187.1|  PREDICTED: guanine nucleotide-binding protei...    351   3e-117   Nicotiana tomentosiformis
ref|XP_006353816.1|  PREDICTED: guanine nucleotide-binding protei...    349   1e-116   Solanum tuberosum [potatoes]
gb|EYU40229.1|  hypothetical protein MIMGU_mgv1a008949mg                350   2e-116   Erythranthe guttata [common monkey flower]
ref|XP_009778426.1|  PREDICTED: guanine nucleotide-binding protei...    347   6e-116   Nicotiana sylvestris
ref|XP_011072970.1|  PREDICTED: guanine nucleotide-binding protei...    347   8e-116   Sesamum indicum [beniseed]
sp|P49026.1|GBLP_TOBAC  RecName: Full=Guanine nucleotide-binding ...    346   2e-115   Nicotiana tabacum [American tobacco]
sp|P93340.1|GBLP_NICPL  RecName: Full=Guanine nucleotide-binding ...    346   2e-115   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_003631071.1|  Guanine nucleotide-binding protein subunit b...    345   4e-115   Medicago truncatula
gb|EYU17645.1|  hypothetical protein MIMGU_mgv1a009858mg                345   4e-115   Erythranthe guttata [common monkey flower]
ref|XP_006365404.1|  PREDICTED: guanine nucleotide-binding protei...    344   1e-114   Solanum tuberosum [potatoes]
ref|NP_001233876.1|  ArcA1 protein                                      344   1e-114   
gb|KHN21658.1|  Guanine nucleotide-binding protein subunit beta-l...    340   1e-114   Glycine soja [wild soybean]
gb|EPS70887.1|  hypothetical protein M569_03871                         343   4e-114   Genlisea aurea
gb|AFK36580.1|  unknown                                                 343   4e-114   Medicago truncatula
gb|ACR77528.1|  heterotrimeric G protein beta 1 subunit                 342   6e-114   Nicotiana benthamiana
sp|O24076.1|GBLP_MEDSA  RecName: Full=Guanine nucleotide-binding ...    342   6e-114   Medicago sativa [alfalfa]
gb|KHN00175.1|  Guanine nucleotide-binding protein subunit beta-l...    338   8e-114   Glycine soja [wild soybean]
emb|CDO98381.1|  unnamed protein product                                367   1e-113   Coffea canephora [robusta coffee]
gb|KJB37175.1|  hypothetical protein B456_006G192600                    342   1e-113   Gossypium raimondii
gb|KHG00880.1|  Guanine nucleotide-binding protein subunit beta-l...    341   2e-113   Gossypium arboreum [tree cotton]
gb|KJB53022.1|  hypothetical protein B456_008G288800                    340   3e-113   Gossypium raimondii
ref|XP_004299548.1|  PREDICTED: guanine nucleotide-binding protei...    340   4e-113   Fragaria vesca subsp. vesca
ref|NP_001241455.1|  uncharacterized protein LOC100778205               340   4e-113   Glycine max [soybeans]
ref|XP_002529557.1|  receptor for activated protein kinase C, put...    339   9e-113   Ricinus communis
gb|KHG17882.1|  Guanine nucleotide-binding protein subunit beta-l...    339   1e-112   Gossypium arboreum [tree cotton]
ref|NP_001235369.1|  guanine nucleotide-binding protein subunit b...    338   2e-112   Glycine max [soybeans]
ref|XP_008453452.1|  PREDICTED: guanine nucleotide-binding protei...    338   2e-112   Cucumis melo [Oriental melon]
ref|XP_004137327.1|  PREDICTED: guanine nucleotide-binding protei...    338   2e-112   Cucumis sativus [cucumbers]
gb|KDO62873.1|  hypothetical protein CISIN_1g048118mg                   338   2e-112   Citrus sinensis [apfelsine]
ref|XP_006451669.1|  hypothetical protein CICLE_v10008909mg             338   2e-112   Citrus clementina [clementine]
gb|ACJ24167.1|  Rack                                                    338   2e-112   Phaseolus vulgaris [French bean]
ref|XP_007160506.1|  hypothetical protein PHAVU_002G327500g             338   2e-112   Phaseolus vulgaris [French bean]
ref|XP_007036696.1|  Transducin/WD40 repeat-like superfamily protein    337   9e-112   Theobroma cacao [chocolate]
gb|KFK43977.1|  guanine nucleotide-binding protein subunit beta-l...    335   5e-111   Arabis alpina [alpine rockcress]
ref|XP_010032559.1|  PREDICTED: guanine nucleotide-binding protei...    334   7e-111   Eucalyptus grandis [rose gum]
gb|KHG29145.1|  Guanine nucleotide-binding protein subunit beta-l...    334   1e-110   Gossypium arboreum [tree cotton]
ref|XP_009110365.1|  PREDICTED: guanine nucleotide-binding protei...    333   2e-110   Brassica rapa
ref|XP_006416642.1|  hypothetical protein EUTSA_v10008183mg             333   2e-110   Eutrema salsugineum [saltwater cress]
ref|XP_002894122.1|  hypothetical protein ARALYDRAFT_474002             333   3e-110   
ref|XP_009117627.1|  PREDICTED: guanine nucleotide-binding protei...    333   3e-110   Brassica rapa
gb|KJB08186.1|  hypothetical protein B456_001G069800                    333   3e-110   Gossypium raimondii
ref|XP_010678120.1|  PREDICTED: guanine nucleotide-binding protei...    332   4e-110   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009149259.1|  PREDICTED: guanine nucleotide-binding protei...    332   4e-110   Brassica rapa
gb|KDP37901.1|  hypothetical protein JCGZ_05340                         332   5e-110   Jatropha curcas
ref|XP_002890259.1|  hypothetical protein ARALYDRAFT_889221             332   6e-110   Arabidopsis lyrata subsp. lyrata
ref|XP_002281279.1|  PREDICTED: guanine nucleotide-binding protei...    331   1e-109   Vitis vinifera
emb|CAA06154.1|  arcA 3                                                 329   2e-109   Nicotiana tabacum [American tobacco]
ref|XP_010540016.1|  PREDICTED: guanine nucleotide-binding protei...    331   2e-109   Tarenaya hassleriana [spider flower]
ref|XP_010036939.1|  PREDICTED: guanine nucleotide-binding protei...    330   2e-109   Eucalyptus grandis [rose gum]
ref|XP_010537487.1|  PREDICTED: guanine nucleotide-binding protei...    330   2e-109   Tarenaya hassleriana [spider flower]
ref|XP_006305354.1|  hypothetical protein CARUB_v10009733mg             330   3e-109   Capsella rubella
ref|NP_173248.1|  guanine nucleotide-binding protein subunit beta...    330   3e-109   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188441.1|  receptor for activated C kinase 1C                    330   4e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009360100.1|  PREDICTED: guanine nucleotide-binding protei...    330   4e-109   Pyrus x bretschneideri [bai li]
gb|AAB82647.1|  WD-40 repeat protein                                    329   7e-109   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54321.1|  RACK1                                                   329   1e-108   Phaseolus vulgaris [French bean]
ref|XP_010097592.1|  Guanine nucleotide-binding protein subunit b...    329   1e-108   Morus notabilis
ref|XP_008393404.1|  PREDICTED: guanine nucleotide-binding protei...    328   1e-108   Malus domestica [apple tree]
ref|XP_008374821.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    328   1e-108   Malus domestica [apple tree]
ref|XP_002318528.1|  GTP-binding protein beta chain                     328   1e-108   Populus trichocarpa [western balsam poplar]
ref|XP_010506450.1|  PREDICTED: guanine nucleotide-binding protei...    328   2e-108   Camelina sativa [gold-of-pleasure]
ref|XP_011039103.1|  PREDICTED: guanine nucleotide-binding protei...    328   2e-108   Populus euphratica
ref|XP_010498185.1|  PREDICTED: guanine nucleotide-binding protei...    328   2e-108   Camelina sativa [gold-of-pleasure]
ref|XP_006305339.1|  hypothetical protein CARUB_v10009720mg             328   2e-108   Capsella rubella
ref|XP_008240184.1|  PREDICTED: guanine nucleotide-binding protei...    328   2e-108   Prunus mume [ume]
ref|NP_175296.1|  receptor for activated C kinase 1B                    328   2e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007209348.1|  hypothetical protein PRUPE_ppa008536mg             328   2e-108   Prunus persica
ref|XP_010476972.1|  PREDICTED: guanine nucleotide-binding protei...    328   2e-108   Camelina sativa [gold-of-pleasure]
ref|XP_011039104.1|  PREDICTED: guanine nucleotide-binding protei...    328   3e-108   Populus euphratica
ref|XP_010487724.1|  PREDICTED: guanine nucleotide-binding protei...    327   6e-108   Camelina sativa [gold-of-pleasure]
emb|CDY64888.1|  BnaC06g40840D                                          325   1e-107   Brassica napus [oilseed rape]
ref|XP_010500401.1|  PREDICTED: guanine nucleotide-binding protei...    326   1e-107   Camelina sativa [gold-of-pleasure]
gb|KFK39137.1|  guanine nucleotide-binding protein subunit beta-l...    326   2e-107   Arabis alpina [alpine rockcress]
gb|AAM65407.1|  guanine nucleotide-binding protein, putative            326   2e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006393380.1|  hypothetical protein EUTSA_v10011646mg             325   2e-107   Eutrema salsugineum [saltwater cress]
ref|XP_010465892.1|  PREDICTED: guanine nucleotide-binding protei...    325   2e-107   Camelina sativa [gold-of-pleasure]
ref|XP_006297909.1|  hypothetical protein CARUB_v10013951mg             327   3e-107   
sp|Q39336.1|GBLP_BRANA  RecName: Full=Guanine nucleotide-binding ...    325   3e-107   Brassica napus [oilseed rape]
ref|XP_010479287.1|  PREDICTED: guanine nucleotide-binding protei...    325   4e-107   Camelina sativa [gold-of-pleasure]
ref|XP_010461692.1|  PREDICTED: guanine nucleotide-binding protei...    325   5e-107   Camelina sativa [gold-of-pleasure]
ref|XP_010549078.1|  PREDICTED: guanine nucleotide-binding protei...    324   6e-107   Tarenaya hassleriana [spider flower]
ref|XP_006406649.1|  hypothetical protein EUTSA_v10021128mg             323   1e-106   Eutrema salsugineum [saltwater cress]
ref|XP_010549077.1|  PREDICTED: guanine nucleotide-binding protei...    323   2e-106   Tarenaya hassleriana [spider flower]
ref|XP_009147950.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    323   2e-106   Brassica rapa
ref|XP_009145001.1|  PREDICTED: guanine nucleotide-binding protei...    322   3e-106   Brassica rapa
ref|XP_004503304.1|  PREDICTED: guanine nucleotide-binding protei...    322   4e-106   Cicer arietinum [garbanzo]
ref|XP_002885240.1|  guanine nucleotide-binding family protein          322   4e-106   Arabidopsis lyrata subsp. lyrata
pdb|3DM0|A  Chain A, Maltose Binding Protein Fusion With Rack1 Fr...    333   8e-106   Escherichia coli K-12
ref|XP_009113515.1|  PREDICTED: guanine nucleotide-binding protei...    321   1e-105   Brassica rapa
emb|CDY18497.1|  BnaA01g26980D                                          321   1e-105   Brassica napus [oilseed rape]
ref|XP_010551145.1|  PREDICTED: guanine nucleotide-binding protei...    320   2e-105   Tarenaya hassleriana [spider flower]
ref|XP_011000479.1|  PREDICTED: guanine nucleotide-binding protei...    320   3e-105   Populus euphratica
emb|CDX95554.1|  BnaC01g34460D                                          320   3e-105   
emb|CDY44104.1|  BnaA01g13120D                                          319   4e-105   Brassica napus [oilseed rape]
ref|XP_009145932.1|  PREDICTED: guanine nucleotide-binding protei...    319   9e-105   Brassica rapa
emb|CDX92200.1|  BnaA05g22070D                                          318   1e-104   
emb|CDX95784.1|  BnaC05g35350D                                          318   2e-104   
ref|XP_002321505.1|  GTP-binding protein beta chain                     318   2e-104   Populus trichocarpa [western balsam poplar]
ref|XP_011084467.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    316   7e-104   Sesamum indicum [beniseed]
ref|XP_010256121.1|  PREDICTED: guanine nucleotide-binding protei...    312   2e-102   Nelumbo nucifera [Indian lotus]
ref|XP_010243791.1|  PREDICTED: guanine nucleotide-binding protei...    310   2e-101   Nelumbo nucifera [Indian lotus]
ref|XP_010916329.1|  PREDICTED: guanine nucleotide-binding protei...    309   5e-101   Elaeis guineensis
ref|XP_006837182.1|  hypothetical protein AMTR_s00105p00058690          305   2e-99    Amborella trichopoda
ref|XP_010924141.1|  PREDICTED: guanine nucleotide-binding protei...    305   2e-99    Elaeis guineensis
ref|XP_010430893.1|  PREDICTED: guanine nucleotide-binding protei...    303   3e-99    
ref|XP_009405003.1|  PREDICTED: guanine nucleotide-binding protei...    304   4e-99    Musa acuminata subsp. malaccensis [pisang utan]
emb|CAC09579.1|  gbf1 protein                                           302   5e-99    Fagus sylvatica
ref|XP_010495439.1|  PREDICTED: guanine nucleotide-binding protei...    303   1e-98    
ref|XP_008803271.1|  PREDICTED: guanine nucleotide-binding protei...    300   2e-97    Phoenix dactylifera
ref|XP_009400497.1|  PREDICTED: guanine nucleotide-binding protei...    300   2e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010923802.1|  PREDICTED: guanine nucleotide-binding protei...    300   3e-97    Elaeis guineensis
gb|AFV60006.1|  heterotrimeric guanine nucleotide-binding protein...    298   7e-97    Eschscholzia californica
ref|XP_009380503.1|  PREDICTED: guanine nucleotide-binding protei...    298   1e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004252271.1|  PREDICTED: guanine nucleotide-binding protei...    295   7e-96    Solanum lycopersicum
gb|ABK25010.1|  unknown                                                 294   3e-95    Picea sitchensis
gb|ACN41093.1|  unknown                                                 294   4e-95    Picea sitchensis
ref|XP_008812615.1|  PREDICTED: guanine nucleotide-binding protei...    293   2e-94    
gb|ABK26798.1|  unknown                                                 288   7e-93    Picea sitchensis
ref|NP_001136800.1|  guanine nucleotide-binding protein beta subu...    286   8e-92    Zea mays [maize]
ref|NP_001146976.1|  LOC100280585                                       286   1e-91    Zea mays [maize]
gb|ACL54313.1|  unknown                                                 286   1e-91    Zea mays [maize]
ref|XP_002440202.1|  hypothetical protein SORBIDRAFT_09g027690          285   3e-91    Sorghum bicolor [broomcorn]
ref|XP_001780288.1|  predicted protein                                  282   1e-90    
ref|XP_002945887.1|  hypothetical protein VOLCADRAFT_78914              282   1e-90    Volvox carteri f. nagariensis
ref|XP_008811978.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    282   2e-90    Phoenix dactylifera
ref|XP_001779496.1|  predicted protein                                  281   4e-90    
ref|XP_001754916.1|  predicted protein                                  281   6e-90    
ref|XP_001698065.1|  receptor of activated protein kinase C 1           281   6e-90    Chlamydomonas reinhardtii
gb|ACJ85349.1|  unknown                                                 279   1e-89    Medicago truncatula
ref|XP_004969582.1|  PREDICTED: guanine nucleotide-binding protei...    281   1e-89    Setaria italica
ref|XP_006644561.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    278   6e-89    Oryza brachyantha
ref|XP_005847990.1|  hypothetical protein CHLNCDRAFT_31033              277   1e-88    Chlorella variabilis
ref|XP_004961307.1|  PREDICTED: guanine nucleotide-binding protei...    278   1e-88    Setaria italica
ref|NP_001043910.1|  Os01g0686800                                       278   1e-88    
emb|CEG00110.1|  G-protein beta WD-40 repeat                            276   2e-88    Ostreococcus tauri
gb|EMS52917.1|  Guanine nucleotide-binding protein subunit beta-l...    277   4e-88    Triticum urartu
dbj|BAJ90663.1|  predicted protein                                      276   4e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003567944.1|  PREDICTED: guanine nucleotide-binding protei...    276   6e-88    Brachypodium distachyon [annual false brome]
gb|AEF79971.1|  receptor of activated protein kinase C 1                274   2e-87    Dunaliella salina
ref|XP_001421096.1|  Receptor of activated protein kinase C 1A, c...    274   2e-87    Ostreococcus lucimarinus CCE9901
ref|XP_003082627.1|  GTP-binding regulatory protein beta chain ho...    279   4e-87    
ref|NP_001056254.1|  Os05g0552300                                       274   4e-87    
gb|AEO44580.1|  receptor for activated C kinase 1                       273   9e-87    Dunaliella salina
ref|XP_006654750.1|  PREDICTED: guanine nucleotide-binding protei...    273   9e-87    Oryza brachyantha
ref|XP_002456166.1|  hypothetical protein SORBIDRAFT_03g031520          272   2e-86    Sorghum bicolor [broomcorn]
ref|XP_003060952.1|  predicted protein                                  271   3e-86    Micromonas pusilla CCMP1545
ref|XP_002502835.1|  predicted protein                                  271   3e-86    Micromonas commoda
gb|EMT00770.1|  hypothetical protein F775_19376                         279   4e-86    
ref|XP_010480509.1|  PREDICTED: guanine nucleotide-binding protei...    266   1e-85    
ref|XP_002967499.1|  hypothetical protein SELMODRAFT_144795             268   5e-85    Selaginella moellendorffii
ref|XP_005652002.1|  WD40 repeat-like protein                           267   2e-84    Coccomyxa subellipsoidea C-169
ref|XP_002960209.1|  hypothetical protein SELMODRAFT_266532             264   1e-83    
ref|XP_003569582.1|  PREDICTED: guanine nucleotide-binding protei...    264   3e-83    Brachypodium distachyon [annual false brome]
gb|KIY98327.1|  Guanine nucleotide-binding protein subunit beta-l...    263   8e-83    Monoraphidium neglectum
ref|XP_005711409.1|  receptor for activated protein kinase C            261   3e-82    Chondrus crispus [carageen]
dbj|BAJ98167.1|  predicted protein                                      261   3e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM83867.1|  unnamed protein product                                260   7e-82    Triticum aestivum [Canadian hard winter wheat]
gb|KDD72035.1|  hypothetical protein H632_c3969p0                       257   1e-81    Helicosporidium sp. ATCC 50920
emb|CDY59680.1|  BnaA05g36460D                                          256   2e-81    Brassica napus [oilseed rape]
dbj|BAF47116.1|  G protein beta-subunit-like protein                    253   2e-81    Nicotiana tabacum [American tobacco]
ref|XP_007508318.1|  predicted protein                                  258   3e-81    Bathycoccus prasinos
dbj|BAF47119.1|  G protein beta-subunit-like protein                    249   3e-80    Nicotiana tabacum [American tobacco]
emb|CDY71917.1|  BnaCnng75080D                                          253   4e-80    Brassica napus [oilseed rape]
ref|XP_009836542.1|  guanine nucleotide-binding protein subunit b...    254   2e-79    Aphanomyces astaci
ref|XP_002903189.1|  guanine nucleotide-binding protein subunit b...    253   2e-79    Phytophthora infestans T30-4
ref|XP_010926201.1|  PREDICTED: guanine nucleotide-binding protei...    253   3e-79    Elaeis guineensis
gb|ETM44908.1|  guanine nucleotide-binding protein subunit beta-l...    254   3e-79    Phytophthora parasitica
ref|XP_009531042.1|  hypothetical protein PHYSODRAFT_355000             253   4e-79    Phytophthora sojae
gb|KDO19117.1|  guanine nucleotide-binding protein subunit beta-2...    252   8e-79    Saprolegnia parasitica CBS 223.65
ref|XP_008608530.1|  guanine nucleotide-binding protein subunit b...    252   8e-79    Saprolegnia diclina VS20
ref|XP_011397272.1|  Guanine nucleotide-binding protein subunit b...    252   1e-78    Auxenochlorella protothecoides
ref|XP_004343796.1|  guanine nucleotide-binding protein                 251   1e-78    Capsaspora owczarzaki ATCC 30864
emb|CCI48432.1|  unnamed protein product                                249   1e-77    Albugo candida
emb|CCA26420.1|  guanine nucleotidebinding protein subunit beta2l...    249   1e-77    Albugo laibachii Nc14
ref|XP_009037831.1|  hypothetical protein AURANDRAFT_37768              249   1e-77    Aureococcus anophagefferens
gb|ACQ83470.1|  receptor of activated protein kinase C                  249   1e-77    Platynereis dumerilii
gb|ETI45096.1|  guanine nucleotide-binding protein subunit beta-l...    252   2e-77    Phytophthora parasitica P1569
emb|CEG76293.1|  Putative Guanine nucleotide-binding protein subu...    247   2e-77    Rhizopus microsporus
ref|XP_002286095.1|  guanine nucleotide binding protein beta subu...    248   3e-77    Thalassiosira pseudonana CCMP1335
ref|XP_005795376.1|  PREDICTED: guanine nucleotide-binding protei...    247   1e-76    Xiphophorus maculatus
gb|EIE78732.1|  guanine nucleotide-binding protein subunit beta-2...    246   1e-76    Rhizopus delemar RA 99-880
ref|XP_002181732.1|  predicted protein                                  246   1e-76    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_004073369.1|  PREDICTED: guanine nucleotide-binding protei...    246   1e-76    Oryzias latipes [Japanese rice fish]
ref|XP_004696065.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    244   1e-76    
ref|XP_005703361.1|  hypothetical protein Gasu_55280                    246   2e-76    Galdieria sulphuraria
ref|XP_004540947.1|  PREDICTED: guanine nucleotide-binding protei...    246   2e-76    Maylandia zebra
ref|NP_001266445.1|  guanine nucleotide-binding protein subunit b...    246   2e-76    Oreochromis niloticus
emb|CEG67117.1|  Putative Guanine nucleotide-binding protein subu...    246   2e-76    Rhizopus microsporus
gb|ETP42980.1|  guanine nucleotide-binding protein subunit beta-l...    249   2e-76    Phytophthora parasitica P10297
gb|AAX94566.1|  Gpa1 interacting G protein subunit                      243   2e-76    Cryptococcus neoformans var. grubii
gb|EDL33790.1|  guanine nucleotide binding protein (G protein), b...    243   2e-76    Mus musculus [mouse]
ref|XP_009576203.1|  PREDICTED: guanine nucleotide-binding protei...    242   3e-76    Fulmarus glacialis
gb|ERE68979.1|  guanine nucleotide-binding protein subunit beta-2...    243   3e-76    Cricetulus griseus [Chinese hamsters]
gb|KFM07186.1|  Guanine nucleotide-binding protein subunit beta-2...    242   3e-76    Aptenodytes forsteri
ref|XP_006746631.1|  PREDICTED: guanine nucleotide-binding protei...    244   3e-76    Leptonychotes weddellii
ref|XP_005977784.1|  PREDICTED: guanine nucleotide-binding protei...    244   3e-76    Pantholops hodgsonii [Tibetan antelope]
gb|EWM27643.1|  guanine nucleotide binding protein                      245   3e-76    Nannochloropsis gaditana
ref|XP_007527211.1|  PREDICTED: guanine nucleotide-binding protei...    244   3e-76    Erinaceus europaeus [common hedgehog]
ref|XP_005891160.1|  PREDICTED: guanine nucleotide-binding protei...    244   3e-76    Bos mutus
ref|XP_009277073.1|  PREDICTED: guanine nucleotide-binding protei...    243   3e-76    
gb|EAW53697.1|  guanine nucleotide binding protein (G protein), b...    242   3e-76    Homo sapiens [man]
gb|AAR24619.1|  proliferation-inducing gene 21                          244   3e-76    Homo sapiens [man]
gb|ELK03178.1|  Guanine nucleotide-binding protein subunit beta-2...    243   3e-76    Pteropus alecto
gb|EJT47727.1|  G protein beta subunit-like protein Rkp1                245   3e-76    Trichosporon asahii var. asahii CBS 2479
gb|EPQ05298.1|  Guanine nucleotide-binding protein subunit beta-2...    243   4e-76    Myotis brandtii
gb|ABY75292.1|  putative guanine nucleotide binding protein beta ...    242   4e-76    Ovis aries [domestic sheep]
ref|XP_004657524.1|  PREDICTED: guanine nucleotide-binding protei...    243   4e-76    Jaculus jaculus
ref|NP_571519.1|  guanine nucleotide-binding protein subunit beta...    245   4e-76    Danio rerio [leopard danio]
dbj|BAE39095.1|  unnamed protein product                                242   4e-76    Mus musculus [mouse]
ref|XP_008063710.1|  PREDICTED: guanine nucleotide-binding protei...    243   5e-76    Carlito syrichta
gb|EPB90862.1|  guanine nucleotide-binding protein subunit beta-2...    244   5e-76    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_007548404.1|  PREDICTED: guanine nucleotide-binding protei...    245   5e-76    Poecilia formosa
ref|XP_005989393.1|  PREDICTED: guanine nucleotide-binding protei...    245   6e-76    Latimeria chalumnae
ref|XP_002804718.1|  PREDICTED: guanine nucleotide-binding protei...    243   6e-76    
dbj|BAG53102.1|  unnamed protein product                                243   6e-76    Homo sapiens [man]
ref|XP_007244608.1|  PREDICTED: guanine nucleotide-binding protei...    244   7e-76    Astyanax mexicanus [blind cave fish]
gb|AAI50408.1|  Guanine nucleotide binding protein (G protein), b...    244   8e-76    Danio rerio [leopard danio]
ref|XP_006147504.1|  PREDICTED: guanine nucleotide-binding protei...    242   9e-76    
gb|ADO27998.1|  guanine nucleotide-binding protein subunit beta-2...    244   1e-75    Ictalurus furcatus
ref|XP_572317.1|  cytoplasm protein                                     244   1e-75    Cryptococcus neoformans var. neoformans JEC21
emb|CEP13972.1|  hypothetical protein                                   244   1e-75    Parasitella parasitica
ref|XP_009080129.1|  PREDICTED: guanine nucleotide-binding protei...    241   1e-75    Acanthisitta chloris
emb|CCQ18636.1|  G protein beta subunit-like protein                    244   1e-75    Sycon ciliatum
emb|CEP08121.1|  hypothetical protein                                   244   1e-75    Parasitella parasitica
ref|NP_001187435.1|  guanine nucleotide-binding protein subunit b...    244   1e-75    Ictalurus punctatus
gb|EDL33792.1|  guanine nucleotide binding protein (G protein), b...    242   1e-75    Mus musculus [mouse]
gb|AEW43729.1|  activated protein kinase C receptor                     243   1e-75    Epinephelus coioides [estuary cod]
ref|XP_009922131.1|  PREDICTED: guanine nucleotide-binding protei...    243   1e-75    Haliaeetus albicilla
gb|KFP96911.1|  Guanine nucleotide-binding protein subunit beta-2...    243   1e-75    Haliaeetus albicilla
gb|KFQ89059.1|  Guanine nucleotide-binding protein subunit beta-2...    243   1e-75    Phoenicopterus ruber ruber
gb|KFP58388.1|  Guanine nucleotide-binding protein subunit beta-2...    243   2e-75    Cathartes aura
gb|KFP61115.1|  Guanine nucleotide-binding protein subunit beta-2...    243   2e-75    Cariama cristata
ref|XP_009489930.1|  PREDICTED: guanine nucleotide-binding protei...    243   2e-75    Pelecanus crispus
ref|XP_003197003.1|  G protein beta subunit-like protein Rkp1           243   2e-75    Cryptococcus gattii WM276
dbj|BAB28114.1|  unnamed protein product                                242   2e-75    Mus musculus [mouse]
ref|XP_007070338.1|  PREDICTED: guanine nucleotide-binding protei...    242   2e-75    
ref|XP_008873892.1|  guanine nucleotide-binding protein subunit b...    244   2e-75    Aphanomyces invadans
ref|XP_009701898.1|  PREDICTED: guanine nucleotide-binding protei...    243   2e-75    Cariama cristata
gb|KFQ96249.1|  Guanine nucleotide-binding protein subunit beta-2...    243   2e-75    Nipponia nippon
ref|XP_005658294.1|  PREDICTED: guanine nucleotide binding protei...    243   2e-75    
ref|XP_006037851.1|  PREDICTED: guanine nucleotide-binding protei...    243   2e-75    
ref|XP_005234127.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    243   2e-75    Falco peregrinus [peregrine]
gb|KFQ66729.1|  Guanine nucleotide-binding protein subunit beta-2...    243   2e-75    Pelecanus crispus
ref|XP_010296751.1|  PREDICTED: guanine nucleotide-binding protei...    243   2e-75    Balearica regulorum gibbericeps
ref|XP_009462428.1|  PREDICTED: guanine nucleotide-binding protei...    243   2e-75    Nipponia nippon
gb|KFQ99079.1|  Guanine nucleotide-binding protein subunit beta-2...    242   2e-75    Opisthocomus hoazin [hoatzin]
dbj|BAE40059.1|  unnamed protein product                                243   2e-75    Mus musculus [mouse]
ref|XP_009448630.1|  PREDICTED: guanine nucleotide-binding protei...    242   2e-75    
dbj|BAE40068.1|  unnamed protein product                                243   2e-75    Mus musculus [mouse]
gb|EHB05258.1|  Guanine nucleotide-binding protein subunit beta-2...    243   2e-75    Heterocephalus glaber [naked mole rat]
gb|KFO08948.1|  Guanine nucleotide-binding protein subunit beta-2...    242   2e-75    Balearica regulorum gibbericeps
ref|XP_005758143.1|  receptor of activated protein kinase C             243   2e-75    Emiliania huxleyi CCMP1516
ref|XP_009329421.1|  PREDICTED: guanine nucleotide-binding protei...    242   2e-75    Pygoscelis adeliae
gb|KFO20808.1|  Guanine nucleotide-binding protein subunit beta-2...    243   2e-75    Fukomys damarensis [Damara mole rat]
gb|AAI02287.2|  GNB2L1 protein                                          243   2e-75    Bos taurus [bovine]
gb|AAP36938.1|  Homo sapiens guanine nucleotide binding protein (...    243   2e-75    synthetic construct
ref|XP_005435183.1|  PREDICTED: guanine nucleotide-binding protei...    243   2e-75    Falco cherrug
ref|XP_006631768.1|  PREDICTED: guanine nucleotide-binding protei...    243   2e-75    Lepisosteus oculatus
ref|NP_006089.1|  guanine nucleotide-binding protein subunit beta...    243   2e-75    Homo sapiens [man]
ref|XP_010291551.1|  PREDICTED: guanine nucleotide-binding protei...    243   2e-75    Phaethon lepturus
ref|XP_009995617.1|  PREDICTED: guanine nucleotide-binding protei...    242   3e-75    Chaetura pelagica
ref|XP_004387229.1|  PREDICTED: guanine nucleotide-binding protei...    243   3e-75    Trichechus manatus latirostris
gb|EPB88453.1|  guanine nucleotide-binding protein subunit beta-2...    243   3e-75    Mucor circinelloides f. circinelloides 1006PhL
pdb|4AOW|A  Chain A, Crystal Structure Of The Human Rack1 Protein...    244   3e-75    Homo sapiens [man]
ref|XP_007431363.1|  PREDICTED: guanine nucleotide-binding protei...    243   3e-75    Python bivittatus
gb|KFQ81036.1|  Guanine nucleotide-binding protein subunit beta-2...    243   3e-75    Phaethon lepturus
gb|KFW72146.1|  Guanine nucleotide-binding protein subunit beta-2...    242   3e-75    Pygoscelis adeliae
ref|XP_010391434.1|  PREDICTED: guanine nucleotide-binding protei...    241   3e-75    
gb|AAW82329.1|  guanine nucleotide binding 12.3                         243   3e-75    
ref|XP_008325350.1|  PREDICTED: guanine nucleotide-binding protei...    243   3e-75    
gb|KFO76552.1|  Guanine nucleotide-binding protein subunit beta-2...    243   3e-75    
gb|KIR44237.1|  guanine nucleotide-binding protein subunit beta-l...    243   3e-75    
gb|KFO58265.1|  Guanine nucleotide-binding protein subunit beta-2...    241   3e-75    
ref|XP_005018374.1|  PREDICTED: guanine nucleotide-binding protei...    244   4e-75    
gb|EAW53699.1|  guanine nucleotide binding protein (G protein), b...    244   4e-75    
ref|XP_009931788.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    243   4e-75    
gb|AAA18951.1|  protein kinase C receptor                               243   4e-75    
ref|XP_008630825.1|  PREDICTED: guanine nucleotide-binding protei...    241   4e-75    
ref|XP_005534099.1|  PREDICTED: guanine nucleotide-binding protei...    243   4e-75    
gb|EPY85923.1|  guanine nucleotide binding protein, beta polypept...    243   4e-75    
ref|XP_006679085.1|  hypothetical protein BATDEDRAFT_33248              243   4e-75    
gb|AAO21313.1|  lung cancer oncogene 7                                  243   4e-75    
ref|XP_007229955.1|  PREDICTED: guanine nucleotide-binding protei...    243   5e-75    
ref|XP_005862397.1|  PREDICTED: guanine nucleotide-binding protei...    244   5e-75    
gb|ACV53651.1|  guanine nucleotide-binding protein beta polypepti...    243   5e-75    
ref|XP_004468645.1|  PREDICTED: guanine nucleotide-binding protei...    243   5e-75    
ref|XP_006766909.1|  PREDICTED: guanine nucleotide-binding protei...    244   5e-75    
ref|XP_006105825.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    244   5e-75    
gb|ESA03866.1|  hypothetical protein GLOINDRAFT_336518                  242   5e-75    
ref|XP_008681951.1|  PREDICTED: guanine nucleotide-binding protei...    244   5e-75    
gb|EAW53696.1|  guanine nucleotide binding protein (G protein), b...    243   6e-75    
ref|XP_009884754.1|  PREDICTED: guanine nucleotide-binding protei...    241   6e-75    
ref|XP_008156879.1|  PREDICTED: guanine nucleotide-binding protei...    244   7e-75    
gb|ABI26262.1|  receptor for activated protein kinase c                 242   7e-75    
dbj|BAD96208.1|  guanine nucleotide binding protein (G protein), ...    242   7e-75    
ref|NP_001118140.1|  RACK1                                              242   8e-75    
dbj|BAE93065.1|  guanine nucleotide binding protein beta polypept...    242   8e-75    
gb|ACH70647.1|  guanine nucleotide binding protein (G protein) be...    242   9e-75    
gb|AHG98118.1|  guanine nucleotide-binding protein subunit beta-2...    241   9e-75    
ref|NP_001274728.1|  guanine nucleotide-binding protein subunit b...    241   1e-74    
gb|AHG98116.1|  guanine nucleotide-binding protein subunit beta-2...    241   1e-74    
gb|AAS49532.1|  guanine nucleotide binding protein beta polypepti...    241   1e-74    
gb|AHG98119.1|  guanine nucleotide-binding protein subunit beta-2...    241   1e-74    
gb|AAM88904.1|  guanine nucleotide-binding protein                      241   1e-74    
gb|AAT35603.1|  receptor for activated protein kinase C                 241   1e-74    
gb|ABX90099.1|  receptor for activated C kinase 1                       241   1e-74    
gb|AAP04406.1|  G-protein beta subunit like-protein                     241   1e-74    
ref|XP_008013783.1|  PREDICTED: guanine nucleotide-binding protei...    244   1e-74    
gb|AAF22119.1|AF124742_1  guanine nucleotide-binding protein            241   1e-74    
ref|XP_008955153.1|  PREDICTED: guanine nucleotide-binding protei...    244   1e-74    
ref|XP_006270088.1|  PREDICTED: guanine nucleotide-binding protei...    241   2e-74    
ref|XP_006898235.1|  PREDICTED: guanine nucleotide-binding protei...    238   2e-74    
ref|NP_001279416.1|  guanine nucleotide-binding protein subunit b...    241   2e-74    
gb|EAW53694.1|  guanine nucleotide binding protein (G protein), b...    243   2e-74    
dbj|BAA06185.1|  G protein beta subuit like                             241   2e-74    
gb|ACJ06767.1|  receptor for activated C-kinase                         241   2e-74    
ref|XP_003900707.2|  PREDICTED: guanine nucleotide-binding protei...    243   2e-74    
ref|XP_007899557.1|  PREDICTED: guanine nucleotide-binding protei...    241   2e-74    
ref|XP_001105066.1|  PREDICTED: guanine nucleotide-binding protei...    243   2e-74    
ref|XP_004341795.1|  guanine nucleotide-binding protein beta subu...    241   2e-74    
gb|ACQ58047.1|  Guanine nucleotide-binding protein subunit beta-2...    241   2e-74    
dbj|BAE35378.1|  unnamed protein product                                241   2e-74    
ref|XP_007408997.1|  hypothetical protein MELLADRAFT_116221             241   2e-74    
ref|XP_010780163.1|  PREDICTED: guanine nucleotide-binding protei...    241   2e-74    
gb|ETE60795.1|  Guanine nucleotide-binding protein subunit beta-2...    243   3e-74    
ref|XP_010124278.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    237   3e-74    
gb|AAD42045.1|AF105259_1  activated protein kinase C receptor           240   3e-74    
ref|NP_001086465.1|  uncharacterized protein LOC446289                  240   3e-74    
gb|AHG98209.1|  guanine nucleotide-binding protein subunit beta-2...    240   3e-74    
ref|XP_008282647.1|  PREDICTED: guanine nucleotide-binding protei...    240   3e-74    
ref|XP_010223334.1|  PREDICTED: guanine nucleotide-binding protei...    239   4e-74    
gb|AAS59422.1|  G-protein beta subunit like-protein                     236   4e-74    
ref|XP_002735015.1|  PREDICTED: guanine nucleotide-binding protei...    240   4e-74    
ref|NP_001004946.1|  guanine nucleotide binding protein (G protei...    240   4e-74    
emb|CDH49812.1|  guanine nucleotide binding protein beta subunit        240   4e-74    
ref|XP_007083117.1|  PREDICTED: guanine nucleotide-binding protei...    243   5e-74    
ref|XP_002834824.3|  PREDICTED: guanine nucleotide-binding protei...    243   5e-74    
emb|CAL48986.1|  Receptor of Activated Kinase C 1                       240   5e-74    
gb|EGV96576.1|  Guanine nucleotide-binding protein subunit beta-2...    238   5e-74    
ref|XP_007642752.1|  PREDICTED: guanine nucleotide-binding protei...    239   5e-74    
gb|EAW53700.1|  guanine nucleotide binding protein (G protein), b...    243   7e-74    
gb|KDQ57687.1|  hypothetical protein JAAARDRAFT_35372                   239   7e-74    
gb|AFK73701.1|  receptor of activated kinase C                          239   7e-74    
gb|EIE91439.1|  guanine nucleotide-binding protein subunit beta-l...    238   7e-74    
gb|ACO09909.1|  Guanine nucleotide-binding protein subunit beta 2...    239   7e-74    
ref|XP_003970442.1|  PREDICTED: guanine nucleotide-binding protei...    239   1e-73    
ref|NP_001279371.1|  uncharacterized protein LOC103175775               239   1e-73    
gb|EIE76651.1|  guanine nucleotide-binding protein subunit beta-2...    239   1e-73    
ref|NP_001291025.1|  guanine nucleotide binding protein (G protei...    238   2e-73    
ref|XP_010733915.1|  PREDICTED: guanine nucleotide-binding protei...    238   2e-73    
ref|XP_011445926.1|  PREDICTED: guanine nucleotide-binding protei...    238   2e-73    
gb|KIJ49590.1|  hypothetical protein M422DRAFT_205027                   238   2e-73    
ref|XP_006958593.1|  WD40 repeat-like protein                           238   3e-73    
gb|AGN75114.1|  receptor for activated C kinase 1                       238   3e-73    
emb|CCA74715.1|  probable CPC2 protein, guanine nucleotide-bindin...    238   3e-73    
gb|ACU33969.1|  receptor of activated kinase C                          238   3e-73    
emb|CAG01204.1|  unnamed protein product                                238   3e-73    
dbj|BAC56715.1|  receptor for activated protein kinase C homolog        238   4e-73    
ref|XP_009267143.1|  Guanine nucleotide-binding protein subunit b...    236   4e-73    
gb|KFH73669.1|  guanine nucleotide-binding protein subunit beta-l...    237   5e-73    
emb|CDH49357.1|  guanine nucleotide binding protein beta subunit        237   5e-73    
ref|XP_010020213.1|  PREDICTED: guanine nucleotide-binding protei...    233   5e-73    
emb|CDS03837.1|  Putative Guanine nucleotide-binding proteinFT su...    237   6e-73    
gb|ABA01128.1|  G protein beta subunit-like polypeptide                 236   7e-73    
ref|XP_009983622.1|  PREDICTED: guanine nucleotide-binding protei...    235   8e-73    
ref|XP_007864562.1|  WD40 repeat-like protein                           236   9e-73    
gb|AAZ29606.1|  activated C kinase 1 receptor                           236   1e-72    
gb|AAZ29605.1|  activated C kinase 1 receptor                           236   1e-72    
gb|AAM88905.1|  guanine nucleotide-binding protein                      236   1e-72    
gb|AFV81452.1|  receptor for activated protein kinase C                 236   1e-72    
gb|KHJ35931.1|  putative guanine nucleotide-binding protein subun...    236   1e-72    
gb|KDO24030.1|  guanine nucleotide-binding protein subunit beta-2...    233   2e-72    
dbj|BAD52259.1|  receptor for activated protein kinase C homolog        236   2e-72    
ref|XP_008034536.1|  guanine nucleotide binding protein beta subunit    235   3e-72    
gb|KFU89350.1|  Guanine nucleotide-binding protein subunit beta-2...    234   3e-72    
dbj|GAN10996.1|  guanine nucleotide-binding protein                     233   3e-72    
emb|CCF48119.1|  probable CPC2 protein, guanine nucleotide-bindin...    235   3e-72    
dbj|BAM17717.1|  receptor of activated protein kinase C 1               235   4e-72    
emb|CEG70024.1|  Putative Guanine nucleotide-binding protein subu...    234   5e-72    
gb|ELW66848.1|  Guanine nucleotide-binding protein subunit beta-2...    243   5e-72    
emb|CEJ02996.1|  Putative Guanine nucleotide-binding protein subu...    234   5e-72    
gb|KIO09923.1|  hypothetical protein M404DRAFT_995909                   234   5e-72    
gb|AEB26318.1|  receptor for activated protein kinase C                 234   5e-72    
gb|EMS22902.1|  G-protein complex beta subunit                          234   6e-72    
ref|XP_008494697.1|  PREDICTED: guanine nucleotide-binding protei...    233   6e-72    
ref|XP_009547379.1|  hypothetical protein HETIRDRAFT_418643             234   6e-72    
ref|XP_007362000.1|  guanine nucleotide binding protein beta subunit    234   7e-72    
gb|ADO33039.1|  receptor for activated protein kinase C RACK isof...    234   7e-72    
ref|XP_007007889.1|  hypothetical protein TREMEDRAFT_45853              234   8e-72    
ref|XP_007877264.1|  hypothetical protein PFL1_01563                    235   8e-72    
gb|EMP25897.1|  Guanine nucleotide-binding protein subunit beta-2...    245   8e-72    
emb|CEG70023.1|  Putative Guanine nucleotide-binding protein subu...    234   9e-72    
gb|KIM24190.1|  hypothetical protein M408DRAFT_331939                   234   1e-71    
emb|CBQ71151.1|  probable CPC2 protein, guanine nucleotide-bindin...    234   1e-71    
emb|CCX15458.1|  Similar to Guanine nucleotide-binding protein su...    235   1e-71    
gb|KII92153.1|  hypothetical protein PLICRDRAFT_104409                  233   1e-71    
ref|XP_011388829.1|  putative guanine nucleotide-binding protein ...    233   1e-71    
gb|KEI37942.1|  hypothetical protein L969DRAFT_89179                    233   1e-71    
ref|XP_007308233.1|  guanine nucleotide binding protein beta subunit    233   1e-71    
ref|XP_973579.1|  PREDICTED: guanine nucleotide-binding protein s...    233   2e-71    
emb|CCM01124.1|  predicted protein                                      233   2e-71    
gb|ETS62557.1|  hypothetical protein PaG_03192                          234   2e-71    
gb|KDQ21830.1|  hypothetical protein BOTBODRAFT_123721                  233   2e-71    
gb|AAU84924.1|  putative activated protein kinase C receptor            233   2e-71    
gb|ACR19030.1|  receptor for activated protein kinase C                 233   2e-71    
ref|XP_003664641.1|  hypothetical protein MYCTH_2307651                 233   2e-71    
ref|NP_001041703.1|  receptor for activated protein kinase C RACK...    233   2e-71    
dbj|BAK78892.1|  receptor of activated protein kinase C1                230   2e-71    
ref|XP_006695086.1|  putative guanine nucleotide-binding protein        233   2e-71    
ref|XP_006665983.1|  guanine nucleotide-binding protein beta subu...    233   2e-71    
gb|ABX55886.1|  activated C kinase 1 receptor                           233   3e-71    
ref|XP_007799385.1|  putative guanine nucleotide-binding protein ...    233   3e-71    
emb|CDI55376.1|  probable CPC2 protein, guanine nucleotide-bindin...    233   3e-71    
dbj|GAC98631.1|  hypothetical protein PHSY_006225                       234   3e-71    
gb|KIH90457.1|  guanine nucleotide-binding protein subunit beta-2...    231   4e-71    
ref|XP_008600266.1|  WD domain-containing protein                       233   4e-71    
ref|XP_007397219.1|  hypothetical protein PHACADRAFT_258442             232   4e-71    
gb|KGB35723.1|  Guanine nucleotide-binding protein subunit beta-2...    232   4e-71    
gb|AEE62785.1|  unknown                                                 232   4e-71    
gb|AAP13580.2|AF407335_1  guanine nucleotide binding protein beta...    232   4e-71    
ref|NP_001280259.1|  guanine nucleotide-binding protein subunit b...    232   4e-71    
ref|XP_001631784.1|  predicted protein                                  232   5e-71    
ref|XP_002850965.1|  G-protein complex beta subunit CpcB                232   5e-71    
gb|EMD37863.1|  guanine nucleotide binding protein beta subunit         232   5e-71    
gb|ERS97367.1|  guanine nucleotide-binding protein subunit beta-l...    232   6e-71    
ref|XP_001226350.1|  guanine nucleotide-binding protein beta subu...    232   6e-71    
ref|XP_661767.1|  GBLP_NEUCR Guanine nucleotide-binding protein b...    232   7e-71    
gb|ENN71239.1|  hypothetical protein YQE_12166                          233   7e-71    
gb|KGL84405.1|  Guanine nucleotide-binding protein subunit beta-2...    230   7e-71    
gb|KIY65838.1|  guanine nucleotide binding protein beta subunit         231   8e-71    
gb|EST05924.1|  putative CPC2 protein, guanine nucleotide-binding...    232   8e-71    
gb|ACO15464.1|  Guanine nucleotide-binding protein subunit beta-2...    231   8e-71    
ref|XP_005062497.1|  PREDICTED: guanine nucleotide-binding protei...    231   9e-71    
gb|KIJ67868.1|  hypothetical protein HYDPIDRAFT_25333                   231   9e-71    
gb|KIK68892.1|  hypothetical protein GYMLUDRAFT_236781                  231   9e-71    
gb|KIV82161.1|  guanine nucleotide-binding protein subunit beta-l...    231   1e-70    
ref|XP_007287787.1|  g-protein beta subunit                             230   1e-70    
ref|XP_007849688.1|  g-protein comlpex beta subunit                     231   1e-70    
gb|EHK21487.1|  cross-pathway control WD-repeat protein cpc2            231   1e-70    
gb|KIK28004.1|  hypothetical protein PISMIDRAFT_148977                  231   1e-70    
gb|KDE05309.1|  guanine nucleotide-binding protein subunit beta-l...    231   1e-70    
ref|XP_009160336.1|  guanine nucleotide-binding protein subunit b...    233   1e-70    
gb|KFP02898.1|  Guanine nucleotide-binding protein subunit beta-2...    230   1e-70    
gb|ACN10148.1|  Guanine nucleotide-binding protein subunit beta-2...    231   1e-70    
sp|Q93134.1|GBLP_BIOGL  RecName: Full=Guanine nucleotide-binding ...    231   1e-70    
gb|KIW62858.1|  guanine nucleotide-binding protein subunit beta-l...    231   2e-70    
ref|XP_004780256.1|  PREDICTED: guanine nucleotide-binding protei...    231   2e-70    
ref|XP_002613759.1|  hypothetical protein BRAFLDRAFT_84515              231   2e-70    
gb|KIX03579.1|  guanine nucleotide-binding protein subunit beta-l...    231   2e-70    
ref|XP_001830441.1|  guanine nucleotide binding protein beta subunit    231   2e-70    
gb|KDR18184.1|  Guanine nucleotide-binding protein subunit beta-l...    231   2e-70    
ref|XP_003176836.1|  G-protein comlpex beta subunit CpcB                231   2e-70    
ref|XP_001903663.1|  hypothetical protein                               231   2e-70    
emb|CEJ92213.1|  Putative Pc22g03140 protein                            231   2e-70    
gb|EPT05016.1|  hypothetical protein FOMPIDRAFT_1045684                 230   2e-70    
ref|XP_003051079.1|  predicted protein                                  231   2e-70    
gb|KIM69177.1|  hypothetical protein SCLCIDRAFT_1208600                 231   2e-70    
dbj|GAE00026.1|  hypothetical protein PVAR5_8757                        231   2e-70    
gb|ABU41071.1|  receptor for activated protein kinase C-like protein    231   2e-70    
gb|EXX68230.1|  Asc1p                                                   230   2e-70    
gb|KIW10778.1|  guanine nucleotide-binding protein subunit beta-l...    231   2e-70    
gb|EQB48545.1|  hypothetical protein CGLO_12231                         231   2e-70    
gb|AAM88903.1|  guanine nucleotide-binding protein                      230   2e-70    
ref|XP_006962578.1|  cross-pathway control WD-repeat-containing p...    230   2e-70    
gb|KDN52294.1|  putative CPC2 protein                                   230   2e-70    
ref|XP_007723621.1|  guanine nucleotide-binding protein subunit b...    230   2e-70    
ref|XP_007761319.1|  guanine nucleotide-binding protein subunit b...    230   2e-70    
gb|KFH46842.1|  Guanine nucleotide-binding protein subunit beta-l...    230   2e-70    
gb|KIP05099.1|  hypothetical protein PHLGIDRAFT_74762                   230   2e-70    
gb|ABR23464.1|  G protein beta subunit-like protein                     230   2e-70    
ref|XP_003651077.1|  hypothetical protein THITE_2169762                 230   3e-70    
ref|XP_008052288.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    230   3e-70    
gb|KIK47181.1|  hypothetical protein CY34DRAFT_799718                   230   3e-70    
ref|XP_007339269.1|  guanine nucleotide binding protein beta subunit    230   3e-70    
gb|AHW80379.1|  guanine nucleotide-binding protein                      230   3e-70    
gb|KIW40911.1|  guanine nucleotide-binding protein subunit beta-l...    230   4e-70    
emb|CCO34704.1|  Guanine nucleotide-binding protein subunit beta-...    230   4e-70    
ref|XP_001537609.1|  hypothetical protein HCAG_07031                    230   4e-70    
ref|XP_005094913.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    230   4e-70    
ref|XP_005818516.1|  small subunit ribosomal protein RACK1, cytop...    230   4e-70    
ref|XP_001212378.1|  hypothetical protein ATEG_03200                    229   4e-70    
gb|EYE92822.1|  GBLP_NEUCR guanine nucleotide-binding protein bet...    229   4e-70    
ref|XP_009261603.1|  FGB1                                               229   4e-70    
ref|XP_007839961.1|  Guanine nucleotide-binding protein subunit b...    229   5e-70    
gb|ABI63548.1|  receptor for activated protein kinase C-like            229   5e-70    
ref|XP_007602725.1|  guanine nucleotide-binding protein subunit b...    229   5e-70    
gb|KIO29426.1|  hypothetical protein M407DRAFT_242642                   229   5e-70    
gb|ENH83707.1|  g-protein beta subunit                                  229   6e-70    
gb|KDN41366.1|  Guanine nucleotide-binding protein subunit beta-l...    229   6e-70    



>ref|XP_006341557.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Solanum tuberosum]
Length=327

 Score =   358 bits (920),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQDGD H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH+GY
Sbjct  137  GECKYTIQDGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHSGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA SIIH LCFSPNRYWLCAATE+
Sbjct  197  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDASSIIHTLCFSPNRYWLCAATES  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESK+IVVDLRVDLK ESEM+A  + TA KNK+I+CTSLSW+ADGSTLFSGYTD
Sbjct  257  SIKIWDLESKTIVVDLRVDLKHESEMAANESGTAPKNKVIYCTSLSWSADGSTLFSGYTD  316

Query  222  GVIRVWGIGRY  190
            G+IRVWGIGRY
Sbjct  317  GLIRVWGIGRY  327


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/186 (27%), Positives = 82/186 (44%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGAQYGVPRRRLTGHGHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D              G+   + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD--------------GD---SHSDWVSCVRFSPNTLQPTIVSGSWDRT  175

Query  216  IRVWGI  199
            +++W +
Sbjct  176  VKIWNL  181



>ref|XP_009611065.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tomentosiformis]
Length=325

 Score =   355 bits (912),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 172/191 (90%), Positives = 181/191 (95%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI DGD H+ WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH+GY
Sbjct  136  GECKYTITDGDSHSNWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIH LCFSPNRYWLCAATE+
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHTLCFSPNRYWLCAATES  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIVVDLRVDLKQESEMSAEG   AAKNKII+CT LSW+ADGSTLF GYTD
Sbjct  256  SIKIWDLESKSIVVDLRVDLKQESEMSAEG-TAAAKNKIIYCTCLSWSADGSTLFGGYTD  314

Query  222  GVIRVWGIGRY  190
            G+IRVWGIGRY
Sbjct  315  GLIRVWGIGRY  325


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 78/186 (42%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  565
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  13   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGPQYGVPRRRLTGHGHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D                   + +  + C   S N    T+ SG  D  
Sbjct  132  WNTLGECKYTITD-----------------GDSHSNWVSCVRFSPNNLQPTIVSGSWDRT  174

Query  216  IRVWGI  199
            +++W +
Sbjct  175  VKIWNL  180



>gb|ABB86277.1| ArcA2 protein-like [Solanum tuberosum]
Length=327

 Score =   355 bits (911),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQDGD H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH+GY
Sbjct  137  GECKYTIQDGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHSGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA SIIH LCFSPNRYWLCAATE+
Sbjct  197  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDASSIIHTLCFSPNRYWLCAATES  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESK+IVVDLRVDLKQESEM+A  + T  KNK+I+CTSLSW+ADGSTL SGYTD
Sbjct  257  SIKIWDLESKTIVVDLRVDLKQESEMAATESGTGPKNKVIYCTSLSWSADGSTLSSGYTD  316

Query  222  GVIRVWGIGRY  190
            G+IRVWGIGRY
Sbjct  317  GLIRVWGIGRY  327


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/186 (27%), Positives = 82/186 (44%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGAQYGVPRRRLTGHGHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D              G+   + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD--------------GD---SHSDWVSCVRFSPNTLQPTIVSGSWDRT  175

Query  216  IRVWGI  199
            +++W +
Sbjct  176  VKIWNL  181



>gb|AJE63428.1| transcription factor ArcA1 [Capsicum annuum]
Length=330

 Score =   355 bits (910),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 182/194 (94%), Gaps = 3/194 (2%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQDGD H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRSTLAGHTGY
Sbjct  137  GECKYTIQDGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHTGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIH LCFSPNRYWLCAATE+
Sbjct  197  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHTLCFSPNRYWLCAATES  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSA---EGNNTAAKNKIIFCTSLSWNADGSTLFSG  232
            SIKIWDLESKSIVVDLRVDLKQESEM A   +G     KNKII+CTSLSW+ADGSTL+ G
Sbjct  257  SIKIWDLESKSIVVDLRVDLKQESEMLAATPDGGAAPVKNKIIYCTSLSWSADGSTLYRG  316

Query  231  YTDGVIRVWGIGRY  190
            YTDG+IRVWGIGRY
Sbjct  317  YTDGLIRVWGIGRY  330


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 83/186 (45%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  565
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGPTYGVPRRRLTGHGHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G    S    +  + ++ FS  NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARSFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D              G+   + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD--------------GD---SHSDWVSCVRFSPNTLQPTIVSGSWDRT  175

Query  216  IRVWGI  199
            +++W +
Sbjct  176  VKIWNL  181



>ref|XP_009776114.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana sylvestris]
Length=328

 Score =   354 bits (908),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/192 (88%), Positives = 182/192 (95%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+GD H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH GY
Sbjct  137  GECKYTIQEGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHAGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE 
Sbjct  197  VNTVAVSPDGSLCASGGKDGTILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATET  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNN-TAAKNKIIFCTSLSWNADGSTLFSGYT  226
            SIKIWDLESKSIVVDL+VDLKQESEM+ EG   +A KNKI++CT LSW+ADGSTLFSGYT
Sbjct  257  SIKIWDLESKSIVVDLKVDLKQESEMATEGTTGSACKNKIMYCTCLSWSADGSTLFSGYT  316

Query  225  DGVIRVWGIGRY  190
            DG+IRVWGIGRY
Sbjct  317  DGLIRVWGIGRY  328


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 79/184 (43%), Gaps = 23/184 (13%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  565
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSLIVWSLTKDGPQYGVPRRRLTGHGHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKTIKL  132

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+             L +      EG+   + +  + C   S N    T+ SG  D  ++
Sbjct  133  WNT------------LGECKYTIQEGD---SHSDWVSCVRFSPNTLQPTIVSGSWDRTVK  177

Query  210  VWGI  199
            +W +
Sbjct  178  IWNL  181



>emb|CAA96528.1| G protein beta-subunit-like protein [Nicotiana plumbaginifolia]
Length=328

 Score =   354 bits (908),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/192 (88%), Positives = 182/192 (95%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+GD H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH GY
Sbjct  137  GECKYTIQEGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHAGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE 
Sbjct  197  VNTVAVSPDGSLCASGGKDGTILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATET  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNN-TAAKNKIIFCTSLSWNADGSTLFSGYT  226
            SIKIWDLESKSIVVDL+VDLKQESEM+ EG   +A KNKI++CT LSW+ADGSTLFSGYT
Sbjct  257  SIKIWDLESKSIVVDLKVDLKQESEMATEGTTGSACKNKIMYCTCLSWSADGSTLFSGYT  316

Query  225  DGVIRVWGIGRY  190
            DG+IRVWGIGRY
Sbjct  317  DGLIRVWGIGRY  328


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 79/184 (43%), Gaps = 23/184 (13%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  565
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSLIVWSLTKDGPQYGVPRRRLTGHGHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+             L +      EG+   + +  + C   S N    T+ SG  D  ++
Sbjct  133  WNT------------LGECKYTIQEGD---SHSDWVSCVRFSPNTLQPTIVSGSWDRTVK  177

Query  210  VWGI  199
            +W +
Sbjct  178  IWNL  181



>ref|XP_009780116.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana sylvestris]
Length=325

 Score =   353 bits (907),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/191 (89%), Positives = 183/191 (96%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI DGD H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH+GY
Sbjct  136  GECKYTITDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE+
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATES  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIVVDL+VDLKQESEMSAEG   AAKNKII+CT LSW+ADGSTLF GYTD
Sbjct  256  SIKIWDLESKSIVVDLKVDLKQESEMSAEG-TAAAKNKIIYCTCLSWSADGSTLFGGYTD  314

Query  222  GVIRVWGIGRY  190
            G+IRVWGIGRY
Sbjct  315  GLIRVWGIGRY  325


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  565
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  13   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGPQYGVPRRRLTGHGHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSIDNRQIVSASRDKTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D                   + +  + C   S N    T+ SG  D  
Sbjct  132  WNTLGECKYTITD-----------------GDSHSDWVSCVRFSPNNLQPTIVSGSWDRT  174

Query  216  IRVWGI  199
            +++W +
Sbjct  175  VKIWNL  180



>ref|XP_009600162.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tomentosiformis]
Length=328

 Score =   352 bits (903),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 168/192 (88%), Positives = 182/192 (95%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+GD H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH GY
Sbjct  137  GECKYTIQEGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHGGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE 
Sbjct  197  VNTVAVSPDGSLCASGGKDGTILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATET  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNN-TAAKNKIIFCTSLSWNADGSTLFSGYT  226
            SIKIWDLESKS+VVDL+VDLKQESEM+ EG   +A KNKI++CT LSW+ADGSTLFSGYT
Sbjct  257  SIKIWDLESKSVVVDLKVDLKQESEMATEGTTGSACKNKIMYCTCLSWSADGSTLFSGYT  316

Query  225  DGVIRVWGIGRY  190
            DG+IRVWGIGRY
Sbjct  317  DGLIRVWGIGRY  328


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 78/184 (42%), Gaps = 23/184 (13%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  565
             H +WV+ +  +P      IV+ S D+++ VW L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSLIVWALTKDGPQYGVPRRRLTGHGHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+             L +      EG+   + +  + C   S N    T+ SG  D  ++
Sbjct  133  WNT------------LGECKYTIQEGD---SHSDWVSCVRFSPNTLQPTIVSGSWDRTVK  177

Query  210  VWGI  199
            +W +
Sbjct  178  IWNL  181


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 80/187 (43%), Gaps = 31/187 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH  +V  V  S   +    +SGSWD  +++W+L          GHT  V +VA S D  
Sbjct  62   GHGHFVQDVVLSSDGMFA--LSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNR  119

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  394
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      +  + + ++K
Sbjct  120  QIVSASRDKSIKLWNTLGECK--YTIQEGDSHSDWVSCVRFSPNTLQPTIVSGSWDRTVK  177

Query  393  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  214
            IW+L           + K  S ++  G          +  +++ + DGS   SG  DG I
Sbjct  178  IWNL----------TNCKLRSTLAGHGG---------YVNTVAVSPDGSLCASGGKDGTI  218

Query  213  RVWGIGR  193
             +W +  
Sbjct  219  LLWDLAE  225



>ref|NP_001233881.1| ArcA2 protein [Solanum lycopersicum]
 dbj|BAA76896.1| LeArcA2 protein [Solanum lycopersicum]
Length=326

 Score =   351 bits (901),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 182/191 (95%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQDG  H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH+GY
Sbjct  137  GECKYTIQDGHSHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHSGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIH LCFSPNRYWLCAATE+
Sbjct  197  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHTLCFSPNRYWLCAATES  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIVVDL+VDLK ESEM+ E + TA K K+I+CTSLSW+ADGSTLFSGYTD
Sbjct  257  SIKIWDLESKSIVVDLKVDLKHESEMANE-SGTAPKTKVIYCTSLSWSADGSTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            G+IRVWGIGRY
Sbjct  316  GLIRVWGIGRY  326


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGAQYGVPRRRLTGHGHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D                   + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD-----------------GHSHSDWVSCVRFSPNTLQPTIVSGSWDRT  175

Query  216  IRVWGI  199
            +++W +
Sbjct  176  VKIWNL  181



>gb|ABB02625.1| G protein beta subunit-like protein [Solanum tuberosum]
Length=261

 Score =   348 bits (894),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 181/193 (94%), Gaps = 2/193 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNLSNCKLR+TLAGHTGY
Sbjct  69   GECKYTIQDQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLSNCKLRATLAGHTGY  128

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSLD+GSIIHALCFSPNRYWLCAATE+
Sbjct  129  VNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDSGSIIHALCFSPNRYWLCAATES  188

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA--AKNKIIFCTSLSWNADGSTLFSGY  229
            SIKIWDLESKSIVVDLRVDLKQE+EM     +T+  AK K+I+CTSLSW+ADGSTLFSGY
Sbjct  189  SIKIWDLESKSIVVDLRVDLKQETEMFGNATSTSGNAKTKVIYCTSLSWSADGSTLFSGY  248

Query  228  TDGVIRVWGIGRY  190
            TDG+IRVWGIGRY
Sbjct  249  TDGLIRVWGIGRY  261



>ref|XP_004252270.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X1 [Solanum lycopersicum]
Length=329

 Score =   351 bits (901),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 182/193 (94%), Gaps = 2/193 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNLSNCKLR+TLAGHTGY
Sbjct  137  GECKYTIQDQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLSNCKLRATLAGHTGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSLD+GSIIHALCFSPNRYWLCAATE+
Sbjct  197  VNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDSGSIIHALCFSPNRYWLCAATES  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA--AKNKIIFCTSLSWNADGSTLFSGY  229
            SIKIWDLESKSIVVDLRVDLKQE+EMS    +T+  +K K+I+CTSLSW+ADGSTLFSGY
Sbjct  257  SIKIWDLESKSIVVDLRVDLKQETEMSGNATSTSGNSKTKVIYCTSLSWSADGSTLFSGY  316

Query  228  TDGVIRVWGIGRY  190
            TDG+IRVWGIGRY
Sbjct  317  TDGLIRVWGIGRY  329


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 82/186 (44%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  565
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKEGSQYGVPRRRLTGHGHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D      Q+S            +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD------QDSH-----------SDWVSCVRFSPNNLQPTIVSGSWDRT  175

Query  216  IRVWGI  199
            +++W +
Sbjct  176  VKIWNL  181



>ref|XP_009624187.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tomentosiformis]
Length=326

 Score =   351 bits (900),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 183/191 (96%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQDGD H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLR+TLAGHTGY
Sbjct  137  GECKYTIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRATLAGHTGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSL++GSIIH+LCFSPNRYWLCAATE+
Sbjct  197  VNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLESGSIIHSLCFSPNRYWLCAATES  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIV DL+VDLKQESEMS+EG   + KNK+I+CTSLSW+ADGSTLFSGYTD
Sbjct  257  SIKIWDLESKSIVDDLKVDLKQESEMSSEG-TASGKNKVIYCTSLSWSADGSTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            G+IRVWGIGRY
Sbjct  316  GLIRVWGIGRY  326


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 78/186 (42%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  565
             H +WV+ +  +P      IV+ S D+++ VW+++         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPVDNSDMIVTSSRDKSIIVWSITKDGPQYGVPRRRLTGHGHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + SI++
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIRL  132

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D                   + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD-----------------GDSHSDWVSCVRFSPNNLQPTIVSGSWDRT  175

Query  216  IRVWGI  199
            +++W +
Sbjct  176  VKIWNL  181


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 86/205 (42%), Gaps = 31/205 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH  +V  V  S   +    +SGSWD  +++W+L          GHT  V +VA S D  
Sbjct  62   GHGHFVQDVVLSSDGMFA--LSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNR  119

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  394
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      +  + + ++K
Sbjct  120  QIVSASRDKSIRLWNTLGECK--YTIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVK  177

Query  393  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  214
            IW+L +      LR  L   +       NTAA            + DGS   SG  DGVI
Sbjct  178  IWNLTN----CKLRATLAGHTGYV----NTAAV-----------SPDGSLCASGGKDGVI  218

Query  213  RVWGIGRY*MEEFRRSHMIIGHVCY  139
             +W +          S  II  +C+
Sbjct  219  LLWDLAEGKKLYSLESGSIIHSLCF  243



>ref|XP_006353816.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Solanum tuberosum]
Length=329

 Score =   349 bits (896),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 181/193 (94%), Gaps = 2/193 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNLSNCKLR+TLAGH GY
Sbjct  137  GECKYTIQDQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLSNCKLRATLAGHAGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSLD+GSIIHALCFSPNRYWLCAATE+
Sbjct  197  VNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDSGSIIHALCFSPNRYWLCAATES  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA--AKNKIIFCTSLSWNADGSTLFSGY  229
            SIKIWDLESKSIVVDLRVDLKQE+EMS    +T+  +K K+I+CTSLSW+ADGSTLFSGY
Sbjct  257  SIKIWDLESKSIVVDLRVDLKQETEMSGNATSTSGNSKTKVIYCTSLSWSADGSTLFSGY  316

Query  228  TDGVIRVWGIGRY  190
            TDG+IRVWGIGRY
Sbjct  317  TDGLIRVWGIGRY  329


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 82/186 (44%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  565
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKEGSQYGVPRRRLTGHGHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D      Q+S            +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD------QDSH-----------SDWVSCVRFSPNNLQPTIVSGSWDRT  175

Query  216  IRVWGI  199
            +++W +
Sbjct  176  VKIWNL  181



>gb|EYU40229.1| hypothetical protein MIMGU_mgv1a008949mg [Erythranthe guttata]
Length=357

 Score =   350 bits (897),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 183/193 (95%), Gaps = 2/193 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H++WVSCVRFSP+TLQPTIVS SWD+TVK+WNL+NCKLRSTLAGH+GY
Sbjct  165  GECKYTIQDQDAHSDWVSCVRFSPNTLQPTIVSASWDKTVKIWNLTNCKLRSTLAGHSGY  224

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNT AVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSII+ALCFSPNRYWLCAATEA
Sbjct  225  VNTSAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIINALCFSPNRYWLCAATEA  284

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEG--NNTAAKNKIIFCTSLSWNADGSTLFSGY  229
            SIKIWDLESKS+VVDL+VDLK ESE++ EG   + AAKNK+I+CTSLSW+ADGSTLFSGY
Sbjct  285  SIKIWDLESKSVVVDLKVDLKHESEIAPEGATQSAAAKNKVIYCTSLSWSADGSTLFSGY  344

Query  228  TDGVIRVWGIGRY  190
            TDGV+RVWGIGRY
Sbjct  345  TDGVVRVWGIGRY  357


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H +WV+ +  +P      IV+ S D+++ +W+L+         R  L GH+ +V  V +
Sbjct  42   AHTDWVTAIA-TPIDNSDMIVTASRDKSIILWSLTKEDRTYGVARRRLTGHSHFVEDVVL  100

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  101  SSDGQFALSGSWDGELRLWDLQTGNTARRFVGHTKDVLSVAFSIDNRQIVSASRDKTIKL  160

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D                   A +  + C   S N    T+ S   D  
Sbjct  161  WNTLGECKYTIQD-----------------QDAHSDWVSCVRFSPNTLQPTIVSASWDKT  203

Query  216  IRVWGI  199
            +++W +
Sbjct  204  VKIWNL  209



>ref|XP_009778426.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana sylvestris]
Length=326

 Score =   347 bits (891),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 181/191 (95%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKY IQDGD H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLR+TLAGHTGY
Sbjct  137  GECKYIIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRATLAGHTGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSL++GSIIH+LCFSPNRYWLCAATE+
Sbjct  197  VNTTAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLESGSIIHSLCFSPNRYWLCAATES  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESK+IV DL+VDLKQESEMSAEG   + KNK+I+CTSL W+ADGSTLFSGYTD
Sbjct  257  SIKIWDLESKTIVDDLKVDLKQESEMSAEG-TASGKNKVIYCTSLGWSADGSTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            G+IRVWGIGRY
Sbjct  316  GLIRVWGIGRY  326


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  565
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPVDNSDMIVTSSRDKSIIVWSLTKDGPQYGVPRRRLTGHGHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G   + +      ++     + NR  + A+ + SI++
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSADNRQIVSASRDKSIRL  132

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K I+ D                   + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYIIQD-----------------GDSHSDWVSCVRFSPNNLQPTIVSGSWDRT  175

Query  216  IRVWGI  199
            +++W +
Sbjct  176  VKIWNL  181



>ref|XP_011072970.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Sesamum indicum]
Length=329

 Score =   347 bits (890),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 183/193 (95%), Gaps = 2/193 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H++WVSCVRFSP+TLQPTIVSGSWD+TVKVWNL+NCKLRSTL+GH+GY
Sbjct  137  GECKYTIQDQDAHSDWVSCVRFSPNTLQPTIVSGSWDKTVKVWNLTNCKLRSTLSGHSGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATEA
Sbjct  197  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATEA  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNN--TAAKNKIIFCTSLSWNADGSTLFSGY  229
            SIKIWDLESKS+VVDL+VDLKQES+++ +G +   A K K+I+CT L+W+ADGSTLFSGY
Sbjct  257  SIKIWDLESKSVVVDLKVDLKQESDLAKDGTDQTAAVKTKVIYCTCLNWSADGSTLFSGY  316

Query  228  TDGVIRVWGIGRY  190
            TDGV+RVWGIGRY
Sbjct  317  TDGVVRVWGIGRY  329


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 78/186 (42%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H +WV+ +  +P      IV+ S D+++ +W L+  +      R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIILWALTKEEKSYGVARRRLTGHGHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G   + +      +I       NR  + A+ + +IK+
Sbjct  73   SSDGQFALSGSWDGELRLWDLQTGVTARRFVGHTKDVISVAFSVDNRQIVSASRDKTIKL  132

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D                   A +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD-----------------QDAHSDWVSCVRFSPNTLQPTIVSGSWDKT  175

Query  216  IRVWGI  199
            ++VW +
Sbjct  176  VKVWNL  181



>sp|P49026.1|GBLP_TOBAC RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tabacum]
 dbj|BAA04478.1| G protein beta subunit-like protein [Nicotiana tabacum]
Length=326

 Score =   346 bits (887),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 181/191 (95%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQDGD H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLR TLAGHTGY
Sbjct  137  GECKYTIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRLTLAGHTGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSL++GSIIH+LCFSPNRYWLCAATE+
Sbjct  197  VNTPAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLESGSIIHSLCFSPNRYWLCAATES  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIV DL+VDLKQESEMS+EG   + KNK+I+CTSLSW+ADGSTLFSGYTD
Sbjct  257  SIKIWDLESKSIVDDLKVDLKQESEMSSEG-TASGKNKVIYCTSLSWSADGSTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            G+IRVWGI RY
Sbjct  316  GLIRVWGIDRY  326



>sp|P93340.1|GBLP_NICPL RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana plumbaginifolia]
 emb|CAA70705.1| G protein beta subunit [Nicotiana plumbaginifolia]
Length=326

 Score =   346 bits (887),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 181/191 (95%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKY IQDGD H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLR+TLAGHTGY
Sbjct  137  GECKYIIQDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRATLAGHTGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSL++GSIIH+LCFSPNRYWLCAATE+
Sbjct  197  VNTTAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLESGSIIHSLCFSPNRYWLCAATES  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESK+IV DL+VDLKQESEMSAEG   + KNK+I+CTSL W+ADGSTLFSGYTD
Sbjct  257  SIKIWDLESKTIVDDLKVDLKQESEMSAEG-TASGKNKVIYCTSLGWSADGSTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            G+IRVWGIGR+
Sbjct  316  GLIRVWGIGRF  326


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  565
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPVDNSDMIVTSSRDKSIIVWSLTKDGPQYGVPRRRLTGHGHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G   + +      ++     + NR  + A+ + SI++
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSADNRQIVSASRDKSIRL  132

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K I+ D                   + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYIIQD-----------------GDSHSDWVSCVRFSPNNLQPTIVSGSWDRT  175

Query  216  IRVWGI  199
            +++W +
Sbjct  176  VKIWNL  181



>ref|XP_003631071.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Medicago truncatula]
 gb|AET05547.1| guanine nucleotide-binding protein beta subunit-like protein 
[Medicago truncatula]
Length=325

 Score =   345 bits (885),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 181/191 (95%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+TLAGH+GY
Sbjct  136  GECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE+
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATES  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIV DL+VDLK E++ +A G +T  K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  256  SIKIWDLESKSIVEDLKVDLKTEAD-AAIGGDTTTKKKVIYCTSLNWSADGSTLFSGYTD  314

Query  222  GVIRVWGIGRY  190
            GV+RVWGIGRY
Sbjct  315  GVVRVWGIGRY  325



>gb|EYU17645.1| hypothetical protein MIMGU_mgv1a009858mg [Erythranthe guttata]
Length=329

 Score =   345 bits (886),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 182/193 (94%), Gaps = 2/193 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD DGH++WVSCVRFSP+ LQPTIVSGS D+TVK+WNL+NCKL+STLAGH+GY
Sbjct  137  GECKYTIQDQDGHSDWVSCVRFSPNNLQPTIVSGSCDKTVKIWNLTNCKLKSTLAGHSGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSLDAGSI+HA+CFSPNRYWLCAATEA
Sbjct  197  VNTVAVSPDGSLCASGGKDGFILLWDLAEGKKLYSLDAGSIVHAVCFSPNRYWLCAATEA  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGN--NTAAKNKIIFCTSLSWNADGSTLFSGY  229
             IKIWDLESKS+VVDL+VDLKQESEM +EGN    A+KNKII+CT L+W+ADGSTLFSGY
Sbjct  257  GIKIWDLESKSVVVDLKVDLKQESEMISEGNGQTAASKNKIIYCTCLNWSADGSTLFSGY  316

Query  228  TDGVIRVWGIGRY  190
            TDGV+RVWGIGRY
Sbjct  317  TDGVVRVWGIGRY  329


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 79/186 (42%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H +WV+ +  +P      IV+ S D+++ +WNL+         R  L GH+ +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSLILWNLTKEDKNYGVARRRLTGHSHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  +  + + +IK+
Sbjct  73   SSDGQFALSGSWDGELRLWDLQTGATTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKL  132

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D                     +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD-----------------QDGHSDWVSCVRFSPNNLQPTIVSGSCDKT  175

Query  216  IRVWGI  199
            +++W +
Sbjct  176  VKIWNL  181


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 77/185 (42%), Gaps = 27/185 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L          GHT  V +VA S D  
Sbjct  62   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLQTGATTRRFVGHTKDVLSVAFSVDNR  119

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHALC--FSPNRYW---LCAATEASIKIW  388
               SG +D  I LW+ L E K       G      C  FSPN      +  + + ++KIW
Sbjct  120  QIVSGSRDKTIKLWNTLGECKYTIQDQDGHSDWVSCVRFSPNNLQPTIVSGSCDKTVKIW  179

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  208
            +L           + K +S ++             +  +++ + DGS   SG  DG I +
Sbjct  180  NL----------TNCKLKSTLAGHSG---------YVNTVAVSPDGSLCASGGKDGFILL  220

Query  207  WGIGR  193
            W +  
Sbjct  221  WDLAE  225



>ref|XP_006365404.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Solanum tuberosum]
Length=326

 Score =   344 bits (883),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 179/191 (94%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+ D H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH+GY
Sbjct  137  GECKYTIQEQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHSGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIH LCFSPNRYWLCAATE+
Sbjct  197  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHTLCFSPNRYWLCAATES  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKS+VVDL+VDLKQESEM      T +K K+I+CTSLSW+ADGSTLFSGYTD
Sbjct  257  SIKIWDLESKSVVVDLKVDLKQESEMFGTA-ATDSKTKVIYCTSLSWSADGSTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            G+IRVWGIGRY
Sbjct  316  GLIRVWGIGRY  326


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  565
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGSHYGVPRRRLTGHGHFVEDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  132

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  +        QE +         + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTI--------QEQD---------SHSDWVSCVRFSPNNLQPTIVSGSWDRT  175

Query  216  IRVWGI  199
            +++W +
Sbjct  176  VKIWNL  181



>ref|NP_001233876.1| ArcA1 protein [Solanum lycopersicum]
 dbj|BAA76895.1| LeArcA1 protein [Solanum lycopersicum]
Length=326

 Score =   344 bits (882),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 178/191 (93%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+ D H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH+GY
Sbjct  137  GECKYTIQEQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHSGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIH  CFSPNRYWLCAATE+
Sbjct  197  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHTFCFSPNRYWLCAATES  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIVVDL+VDLKQESEM      T +K K+I+CTSLSW+ADGSTLFSGYTD
Sbjct  257  SIKIWDLESKSIVVDLKVDLKQESEMFGTA-ATDSKTKVIYCTSLSWSADGSTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            G+IRVWGIGRY
Sbjct  316  GLIRVWGIGRY  326


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  565
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKDGSQYGVPRRRLTGHGHFVEDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKTIKL  132

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  +        QE +         + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTI--------QEQD---------SHSDWVSCVRFSPNNLQPTIVSGSWDRT  175

Query  216  IRVWGI  199
            +++W +
Sbjct  176  VKIWNL  181



>gb|KHN21658.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Glycine soja]
Length=223

 Score =   340 bits (872),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 178/191 (93%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+TLAGH GY
Sbjct  34   GECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAGHNGY  93

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE 
Sbjct  94   VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATEQ  153

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIV DL+VDLK E++ ++ G N A K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  154  SIKIWDLESKSIVEDLKVDLKTEADATSGGGN-ANKKKVIYCTSLNWSADGSTLFSGYTD  212

Query  222  GVIRVWGIGRY  190
            GV+RVW IGRY
Sbjct  213  GVVRVWAIGRY  223



>gb|EPS70887.1| hypothetical protein M569_03871 [Genlisea aurea]
Length=326

 Score =   343 bits (879),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 179/191 (94%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H++WVSCVRFSP+T QPTIVSGSWD TVK+WNLSNCKLRSTLAGHTGY
Sbjct  137  GECKYTIQDQDSHSDWVSCVRFSPNTQQPTIVSGSWDSTVKIWNLSNCKLRSTLAGHTGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VN V+VSPDGSLCAS G+DGVILLWDLAEGK+LYSL+AGSI HALCFSPNRYWLCAATEA
Sbjct  197  VNAVSVSPDGSLCASAGRDGVILLWDLAEGKRLYSLEAGSITHALCFSPNRYWLCAATEA  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKS+VVDL+VDLKQESE++AE    + K+K+IFCTSL+W+ADGSTLFSGYTD
Sbjct  257  SIKIWDLESKSVVVDLKVDLKQESELAAE-ETASRKHKVIFCTSLNWSADGSTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            GVIRVWGIGRY
Sbjct  316  GVIRVWGIGRY  326


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 82/186 (44%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H  WV+ +  +P      IV+ S D+++ +W L+         R  L GH+ YV  V +
Sbjct  14   AHTNWVTAI-ATPIDNSDMIVTASRDKSIILWALTKEDRTYGVPRRRLTGHSNYVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G+  + ++     ++     S NR  + A+ + +IK+
Sbjct  73   SSDGQFALSGSWDGDLRLWDLQTGRSARRFAGHTKDVLSVAFSSDNRQIVSASRDKTIKL  132

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D      Q+S            +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD------QDSH-----------SDWVSCVRFSPNTQQPTIVSGSWDST  175

Query  216  IRVWGI  199
            +++W +
Sbjct  176  VKIWNL  181


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 82/184 (45%), Gaps = 27/184 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L   +     AGHT  V +VA S D  
Sbjct  62   GHSNYVQDVVLSSDG--QFALSGSWDGDLRLWDLQTGRSARRFAGHTKDVLSVAFSSDNR  119

Query  549  LCASGGKDGVILLWD-LAEGK-KLYSLDAGSI-IHALCFSPNRYW---LCAATEASIKIW  388
               S  +D  I LW+ L E K  +   D+ S  +  + FSPN      +  + ++++KIW
Sbjct  120  QIVSASRDKTIKLWNTLGECKYTIQDQDSHSDWVSCVRFSPNTQQPTIVSGSWDSTVKIW  179

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  208
            +L           + K  S ++             +  ++S + DGS   S   DGVI +
Sbjct  180  NLS----------NCKLRSTLAGHTG---------YVNAVSVSPDGSLCASAGRDGVILL  220

Query  207  WGIG  196
            W + 
Sbjct  221  WDLA  224



>gb|AFK36580.1| unknown [Medicago truncatula]
Length=325

 Score =   343 bits (879),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 180/191 (94%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+TLAGH+GY
Sbjct  136  GECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG IIHALCFSPNRYWLCAATE+
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGFIIHALCFSPNRYWLCAATES  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIV DL+VDLK E++ +A G +T  K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  256  SIKIWDLESKSIVEDLKVDLKTEAD-AAIGGDTTTKKKVIYCTSLNWSADGSTLFSGYTD  314

Query  222  GVIRVWGIGRY  190
            GV+RVWGIGRY
Sbjct  315  GVVRVWGIGRY  325



>gb|ACR77528.1| heterotrimeric G protein beta 1 subunit [Nicotiana benthamiana]
Length=326

 Score =   342 bits (878),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 181/191 (95%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECK+ IQDGD H++WVSCVRFSP+ +QPTIVSGSWDRTVK+WNL+NCKLR+TLAGHTGY
Sbjct  137  GECKFIIQDGDSHSDWVSCVRFSPNNIQPTIVSGSWDRTVKIWNLTNCKLRATLAGHTGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNT AVSP+GSLCASGGKDGVILLWDLAEGKKLYSL++GSIIH+LCFSPNRYWLCAATE+
Sbjct  197  VNTTAVSPEGSLCASGGKDGVILLWDLAEGKKLYSLESGSIIHSLCFSPNRYWLCAATES  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESK+IV DL+VDLKQE+EMSAEG   + KNK+I+CTSL W+ADGSTLFSGYTD
Sbjct  257  SIKIWDLESKTIVDDLKVDLKQETEMSAEG-TASGKNKVIYCTSLGWSADGSTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            G+IRVWGIGRY
Sbjct  316  GLIRVWGIGRY  326


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  565
             H +WV+ +  +P      IV+ S D+++ VW+++         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPVDNSDMIVTSSRDKSIIVWSITKDGPLYGVPRRRLTGHGHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G   + +      ++     + NR  + A+ + SI++
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSADNRQIVSASRDKSIRL  132

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K I+ D                   + +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKFIIQD-----------------GDSHSDWVSCVRFSPNNIQPTIVSGSWDRT  175

Query  216  IRVWGI  199
            +++W +
Sbjct  176  VKIWNL  181



>sp|O24076.1|GBLP_MEDSA RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Medicago sativa]
 emb|CAA69934.1| G protein beta subunit-like [Medicago sativa subsp. x varia]
Length=325

 Score =   342 bits (878),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 180/191 (94%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQDGD H++WVSCVRFSPST QPTIVS SWDRTVKVWNL+NCKLR+TLAGH+GY
Sbjct  136  GECKYTIQDGDAHSDWVSCVRFSPSTPQPTIVSASWDRTVKVWNLTNCKLRNTLAGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE+
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATES  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIV DL+VDLK E++ +A G +T  K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  256  SIKIWDLESKSIVEDLKVDLKTEAD-AAIGGDTTTKKKVIYCTSLNWSADGSTLFSGYTD  314

Query  222  GVIRVWGIGRY  190
            GV+RVWGIGRY
Sbjct  315  GVVRVWGIGRY  325



>gb|KHN00175.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Glycine soja]
Length=223

 Score =   338 bits (867),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 177/191 (93%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+TLAGH GY
Sbjct  34   GECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAGHNGY  93

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE 
Sbjct  94   VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATEQ  153

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIV DL+VDLK E++ +  G N   K K+I+CTSL+W++DGSTLFSGYTD
Sbjct  154  SIKIWDLESKSIVEDLKVDLKTEADATTGGGN-PNKKKVIYCTSLNWSSDGSTLFSGYTD  212

Query  222  GVIRVWGIGRY  190
            GV+RVWGIGRY
Sbjct  213  GVVRVWGIGRY  223



>emb|CDO98381.1| unnamed protein product [Coffea canephora]
Length=1395

 Score =   367 bits (942),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 183/194 (94%), Gaps = 3/194 (2%)
 Frame = -2

Query  762   GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
             GECKYTIQD DGH +WVSCVRFSP+ LQPTIVSGSWDRTVK+WNLSNCK+R+TLAGHTGY
Sbjct  1202  GECKYTIQDADGHTDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLSNCKMRATLAGHTGY  1261

Query  582   VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
             VNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA
Sbjct  1262  VNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  1321

Query  402   SIKIWDLESKSIVVDLRVDLKQESEMSAEG---NNTAAKNKIIFCTSLSWNADGSTLFSG  232
             SIKIWDLESKSIVVDLRVDLKQESEM+AEG     T AKNK+I+CTSL+W+ADGSTLFSG
Sbjct  1322  SIKIWDLESKSIVVDLRVDLKQESEMAAEGTTVQTTGAKNKVIYCTSLNWSADGSTLFSG  1381

Query  231   YTDGVIRVWGIGRY  190
             YTDGVIRVWGI RY
Sbjct  1382  YTDGVIRVWGIMRY  1395


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 90/208 (43%), Gaps = 32/208 (15%)
 Frame = -2

Query  729   GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
              H +WV+ +  +P      IV+ S D+++ +W+L+         R  L GH+ +V  V +
Sbjct  1079  AHTDWVTAI-ATPIDNTDMIVTSSRDKSIILWSLTKEDKTYGVPRRRLTGHSHFVQDVVL  1137

Query  564   SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
             S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  1138  SSDGQFALSGSWDGELRLWDLQSGTTARRFVGHTKDVLSVAFSIDNRQIVSASRDKTIKL  1197

Query  390   WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
             W+   E K  + D            A+G+        + C   S N    T+ SG  D  
Sbjct  1198  WNTLGECKYTIQD------------ADGH-----TDWVSCVRFSPNNLQPTIVSGSWDRT  1240

Query  216   IRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
             +++W +    M        + GH  Y++
Sbjct  1241  VKIWNLSNCKMRA-----TLAGHTGYVN  1263



>gb|KJB37175.1| hypothetical protein B456_006G192600 [Gossypium raimondii]
Length=327

 Score =   342 bits (876),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 179/191 (94%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+GD H +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCK+R+TLAGHTGY
Sbjct  138  GECKYTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKIRNTLAGHTGY  197

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG++IH+LCFSPNRYWLCAATE 
Sbjct  198  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGAVIHSLCFSPNRYWLCAATEQ  257

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIV DL+VDLK E+E SA  +N A K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  258  SIKIWDLESKSIVEDLKVDLKAEAETSAATDN-ANKKKVIYCTSLNWSADGSTLFSGYTD  316

Query  222  GVIRVWGIGRY  190
            GVIRVWGIGRY
Sbjct  317  GVIRVWGIGRY  327


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S  +     +SGSWD  +++W+LS         GHT  V +VA S D  
Sbjct  63   GHSHFVQDVVLSSDS--QFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNR  120

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  394
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  121  QIVSASRDRTIKLWNTLGECK--YTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  393  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  214
            +W+L +  I                   NT A +   +  +++ + DGS   SG  DGVI
Sbjct  179  VWNLTNCKI------------------RNTLAGH-TGYVNTVAVSPDGSLCASGGKDGVI  219

Query  213  RVWGIGR  193
             +W +  
Sbjct  220  LLWDLAE  226


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 80/184 (43%), Gaps = 23/184 (13%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  15   AHTDMVTAIA-TPIDNSDMIVTSSRDKSIILWHLTKDEKTYGVARRRLTGHSHFVQDVVL  73

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S D     SG  DG + LWDL+ G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  74   SSDSQFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  133

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+             L +      EG+   A    + C   S N    T+ S   D  ++
Sbjct  134  WNT------------LGECKYTIQEGD---AHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  210  VWGI  199
            VW +
Sbjct  179  VWNL  182



>gb|KHG00880.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Gossypium arboreum]
Length=327

 Score =   341 bits (874),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 179/191 (94%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+GD H +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCK+R+TLAGHTGY
Sbjct  138  GECKYTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKIRNTLAGHTGY  197

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG++IH+LCFSPNRYWLCAATE 
Sbjct  198  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGAVIHSLCFSPNRYWLCAATEQ  257

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKS+V DL+VDLK E+E SA  +N A K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  258  SIKIWDLESKSVVEDLKVDLKAEAETSAATDN-ANKKKVIYCTSLNWSADGSTLFSGYTD  316

Query  222  GVIRVWGIGRY  190
            GVIRVWGIGRY
Sbjct  317  GVIRVWGIGRY  327


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S  +     +SGSWD  +++W+LS         GHT  V +VA S D  
Sbjct  63   GHSHFVQDVVLSSDS--QFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNR  120

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  394
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  121  QIVSASRDRTIKLWNTLGECK--YTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  393  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  214
            +W+L +  I                   NT A +   +  +++ + DGS   SG  DGVI
Sbjct  179  VWNLTNCKI------------------RNTLAGH-TGYVNTVAVSPDGSLCASGGKDGVI  219

Query  213  RVWGIGR  193
             +W +  
Sbjct  220  LLWDLAE  226


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 80/184 (43%), Gaps = 23/184 (13%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  15   AHTDMVTAIA-TPIDNSDMIVTSSRDKSIILWHLTKDEKTYGVARRRLTGHSHFVQDVVL  73

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S D     SG  DG + LWDL+ G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  74   SSDSQFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  133

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+             L +      EG+   A    + C   S N    T+ S   D  ++
Sbjct  134  WNT------------LGECKYTIQEGD---AHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  210  VWGI  199
            VW +
Sbjct  179  VWNL  182



>gb|KJB53022.1| hypothetical protein B456_008G288800 [Gossypium raimondii]
Length=326

 Score =   340 bits (873),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 178/191 (93%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQDGD H +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCK+R+TLAGH+GY
Sbjct  137  GECKYTIQDGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKIRNTLAGHSGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGS+IH+LCFSPNRYWLCAATE 
Sbjct  197  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSVIHSLCFSPNRYWLCAATEQ  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIV DL+VDLK E+E S   +N A K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  257  SIKIWDLESKSIVEDLKVDLKAEAEKSDVTDN-ANKKKVIYCTSLNWSADGSTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            GVIRVWGIGRY
Sbjct  316  GVIRVWGIGRY  326


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S  +     +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  62   GHSHFVQDVVLSFDS--QFALSGSWDGELRLWDLNAGTSARRFVGHTKDVLSVAFSIDNR  119

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  394
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  120  QIVSASRDRSIKLWNTLGECK--YTIQDGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVK  177

Query  393  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  214
            +W+L +  I                   NT A +   +  +++ + DGS   SG  DGVI
Sbjct  178  VWNLTNCKI------------------RNTLAGHS-GYVNTVAVSPDGSLCASGGKDGVI  218

Query  213  RVWGIGR  193
             +W +  
Sbjct  219  LLWDLAE  225



>ref|XP_004299548.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Fragaria vesca subsp. vesca]
Length=326

 Score =   340 bits (872),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 177/191 (93%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+ DGHN+WVSCVRFSP+TLQPTIVS SWDRTVKVWNL+NCKLR+TL GH GY
Sbjct  137  GECKYTIQEQDGHNDWVSCVRFSPNTLQPTIVSASWDRTVKVWNLTNCKLRNTLEGHNGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG+IIHALCFSPNRYWLCAATE 
Sbjct  197  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAIIHALCFSPNRYWLCAATEQ  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIV DL+VDLK E+E + E   TA K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  257  SIKIWDLESKSIVEDLKVDLKTEAEKTKE-TGTANKKKVIYCTSLNWSADGSTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            GVIRVWGIGR+
Sbjct  316  GVIRVWGIGRF  326


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 79/186 (42%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +   P      IVS S D+++ +W L+  +      R  L GH+ +V  V +
Sbjct  14   AHTDMVTAIAI-PIDNSEMIVSASRDKSIILWQLNKDENSYGVPRRRLTGHSHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA+G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDGQFALSGSWDGELRLWDLAQGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  132

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  +        QE +           N  + C   S N    T+ S   D  
Sbjct  133  WNTLGECKYTI--------QEQD---------GHNDWVSCVRFSPNTLQPTIVSASWDRT  175

Query  216  IRVWGI  199
            ++VW +
Sbjct  176  VKVWNL  181



>ref|NP_001241455.1| uncharacterized protein LOC100778205 [Glycine max]
 gb|ACU23023.1| unknown [Glycine max]
Length=325

 Score =   340 bits (872),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 177/191 (93%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+TLAGH GY
Sbjct  136  GECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAGHNGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE 
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATEQ  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIV DL+VDLK E++ +  G N   K K+I+CTSL+W++DGSTLFSGYTD
Sbjct  256  SIKIWDLESKSIVEDLKVDLKTEADATTGGGN-PNKKKVIYCTSLNWSSDGSTLFSGYTD  314

Query  222  GVIRVWGIGRY  190
            GV+RVWGIGRY
Sbjct  315  GVVRVWGIGRY  325


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 92/212 (43%), Gaps = 35/212 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W+L+         R  L GH+ +V  V +
Sbjct  13   AHTDVVTAIA-TPIDNSDMIVTASRDKSIILWHLTKEDKTYGVPRRRLTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  283
            W+   E K  + D                  Q + +SA  + T           +N +  
Sbjct  132  WNTLGECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAG  191

Query  282  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIG  196
               +  +++ + DGS   SG  DGVI +W + 
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLA  223



>ref|XP_002529557.1| receptor for activated protein kinase C, putative [Ricinus communis]
 gb|EEF32826.1| receptor for activated protein kinase C, putative [Ricinus communis]
Length=328

 Score =   339 bits (870),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 177/193 (92%), Gaps = 2/193 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQDGD HN+WVSCVRFSP+TLQPTIVS SWDRTVKVWNL+NCKLR TLAGH GY
Sbjct  136  GECKYTIQDGDAHNDWVSCVRFSPNTLQPTIVSASWDRTVKVWNLTNCKLRCTLAGHGGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY+LDAG++IHALCFSPNRYWLCAATE 
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYNLDAGAVIHALCFSPNRYWLCAATEN  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMS--AEGNNTAAKNKIIFCTSLSWNADGSTLFSGY  229
            SIKIWDLESKSIV DL+VDLK E+E S  +   +T AK K I+CTSLSWNADGSTLFSGY
Sbjct  256  SIKIWDLESKSIVEDLKVDLKAEAEKSDGSTVASTGAKKKNIYCTSLSWNADGSTLFSGY  315

Query  228  TDGVIRVWGIGRY  190
            TDGVIRVWGIGR+
Sbjct  316  TDGVIRVWGIGRF  328


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 76/186 (41%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L   +         L GH+ +V  V +
Sbjct  13   AHTDQVTAIA-TPIDNSDMIVTASRDKSIILWKLIKDEKTYGVAHRRLTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D                   A N  + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTIQD-----------------GDAHNDWVSCVRFSPNTLQPTIVSASWDRT  174

Query  216  IRVWGI  199
            ++VW +
Sbjct  175  VKVWNL  180



>gb|KHG17882.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Gossypium arboreum]
Length=326

 Score =   339 bits (869),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 177/191 (93%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQDGD H +WVSCVRFSP+ LQPTIVS SWD+TVKVWNL+NCK+R+TLAGH+GY
Sbjct  137  GECKYTIQDGDAHTDWVSCVRFSPNNLQPTIVSASWDKTVKVWNLTNCKIRNTLAGHSGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGS+IH+LCFSPNRYWLCAATE 
Sbjct  197  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSVIHSLCFSPNRYWLCAATEQ  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIV DL+VDLK E+E S   +N A K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  257  SIKIWDLESKSIVEDLKVDLKAEAEKSDVTDN-ANKKKVIYCTSLNWSADGSTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            GVIRVWGIGRY
Sbjct  316  GVIRVWGIGRY  326


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S  +     +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  62   GHSHFVQDVVLSSDS--QFALSGSWDGELRLWDLNAGTSARRFVGHTKDVLSVAFSIDNR  119

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  394
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  120  QIVSASRDRSIKLWNTLGECK--YTIQDGDAHTDWVSCVRFSPNNLQPTIVSASWDKTVK  177

Query  393  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  214
            +W+L +  I                   NT A +   +  +++ + DGS   SG  DGVI
Sbjct  178  VWNLTNCKI------------------RNTLAGHS-GYVNTVAVSPDGSLCASGGKDGVI  218

Query  213  RVWGIGR  193
             +W +  
Sbjct  219  LLWDLAE  225



>ref|NP_001235369.1| guanine nucleotide-binding protein subunit beta-like protein 
[Glycine max]
 sp|Q39836.1|GBLP_SOYBN RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Glycine max]
 gb|AAB05941.1| G beta-like protein [Glycine max]
Length=325

 Score =   338 bits (868),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 177/191 (93%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+TLAGH GY
Sbjct  136  GECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAGHNGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSP+RYWLCAATE 
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPSRYWLCAATEQ  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIV DL+VDLK E++ ++ G N A K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  256  SIKIWDLESKSIVEDLKVDLKTEADATSGGGN-ANKKKVIYCTSLNWSADGSTLFSGYTD  314

Query  222  GVIRVWGIGRY  190
            GV RVW IGRY
Sbjct  315  GVARVWAIGRY  325


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 55/212 (26%), Positives = 92/212 (43%), Gaps = 35/212 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S DR++ +W+L+         R  L GH+ +V  V +
Sbjct  13   AHTDVVTAIA-TPIDNSDMIVTASRDRSIILWHLTKEDKTYGVPRRRLTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  283
            W+   E K  + D                  Q + +SA  + T           +N +  
Sbjct  132  WNTLGECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAG  191

Query  282  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIG  196
               +  +++ + DGS   SG  DGVI +W + 
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLA  223



>ref|XP_008453452.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Cucumis melo]
Length=327

 Score =   338 bits (868),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 178/192 (93%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQDGD H++WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCKLR TLAGH GY
Sbjct  136  GECKYTIQDGDAHSDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRVTLAGHAGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE+
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATES  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYT  226
            SIKIWDLESKSIV DL+VDLK E+E + + +  TA K K+I+CTSLSW+ADGSTLF GYT
Sbjct  256  SIKIWDLESKSIVEDLKVDLKTEAEKTDDTHAATANKIKVIYCTSLSWSADGSTLFGGYT  315

Query  225  DGVIRVWGIGRY  190
            DGV+RVWGIGRY
Sbjct  316  DGVVRVWGIGRY  327


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 81/186 (44%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+  +      +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDMIVTSSRDKSIILWRLTKEEKTYGVPQRRLNGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +   +  ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGLTSRRFVGHSKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D              G+   A +  + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTIQD--------------GD---AHSDWVSCVRFSPNTLQPTIVSASWDKT  174

Query  216  IRVWGI  199
            ++VW +
Sbjct  175  VKVWNL  180



>ref|XP_004137327.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Cucumis sativus]
 ref|XP_004160431.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Cucumis sativus]
 gb|KGN63851.1| hypothetical protein Csa_1G024830 [Cucumis sativus]
Length=327

 Score =   338 bits (868),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 178/192 (93%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQDGD H++WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCKLR TLAGH GY
Sbjct  136  GECKYTIQDGDAHSDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRVTLAGHAGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE+
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATES  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYT  226
            SIKIWDLESKSIV DL+VDLK E+E + + +  TA K K+I+CTSLSW+ADGSTLF GYT
Sbjct  256  SIKIWDLESKSIVEDLKVDLKTEAEKTDDTHAATANKIKVIYCTSLSWSADGSTLFGGYT  315

Query  225  DGVIRVWGIGRY  190
            DGV+RVWGIGRY
Sbjct  316  DGVVRVWGIGRY  327


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -2

Query  732  DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDG  553
            +GH+ +V  V  S        +SGSWD  +++W+L+         GH+  V +VA S D 
Sbjct  60   NGHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGNTSRRFVGHSKDVLSVAFSIDN  117

Query  552  SLCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASI  397
                S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++
Sbjct  118  RQIVSASRDRTIKLWNTLGECK--YTIQDGDAHSDWVSCVRFSPNTLQPTIVSASWDKTV  175

Query  396  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            K+W+L +      LRV L   +                +  +++ + DGS   SG  DGV
Sbjct  176  KVWNLTN----CKLRVTLAGHAG---------------YVNTVAVSPDGSLCASGGKDGV  216

Query  216  IRVWGIG  196
            I +W + 
Sbjct  217  ILLWDLA  223



>gb|KDO62873.1| hypothetical protein CISIN_1g048118mg [Citrus sinensis]
Length=303

 Score =   338 bits (866),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 174/192 (91%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+GD H EWVSCVRFSP+TLQPTIVS SWDRTVKVWNLSNCKLR+TLAGHTGY
Sbjct  112  GECKYTIQEGDAHTEWVSCVRFSPNTLQPTIVSASWDRTVKVWNLSNCKLRATLAGHTGY  171

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG++IHALCFSPNRYWLCAATE 
Sbjct  172  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAVIHALCFSPNRYWLCAATEQ  231

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAA-KNKIIFCTSLSWNADGSTLFSGYT  226
            SIKIWDLESKSIV DL+VDLK E+E S     T   K K I+CTSL+W+ DGSTLFSGYT
Sbjct  232  SIKIWDLESKSIVEDLKVDLKTEAEKSEATTATTTIKKKNIYCTSLNWSVDGSTLFSGYT  291

Query  225  DGVIRVWGIGRY  190
            DGVIRVWGIGRY
Sbjct  292  DGVIRVWGIGRY  303



>ref|XP_006451669.1| hypothetical protein CICLE_v10008909mg [Citrus clementina]
 ref|XP_006490737.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Citrus sinensis]
 gb|ESR64909.1| hypothetical protein CICLE_v10008909mg [Citrus clementina]
Length=327

 Score =   338 bits (868),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 175/192 (91%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+GD H EWVSCVRFSP+TLQPTIVS SWDRTVKVWNLSNCKLR+TLAGHTGY
Sbjct  136  GECKYTIQEGDAHTEWVSCVRFSPNTLQPTIVSASWDRTVKVWNLSNCKLRATLAGHTGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG++IHALCFSPNRYWLCAATE 
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAVIHALCFSPNRYWLCAATEQ  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAA-KNKIIFCTSLSWNADGSTLFSGYT  226
            SIKIWDLESKSIV DL+VDLK E+E S     T   K K I+CTSL+W+ADGSTLFSGYT
Sbjct  256  SIKIWDLESKSIVEDLKVDLKTEAEKSEATTATTTIKKKNIYCTSLNWSADGSTLFSGYT  315

Query  225  DGVIRVWGIGRY  190
            DGVIRVWGIGRY
Sbjct  316  DGVIRVWGIGRY  327


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 84/184 (46%), Gaps = 23/184 (13%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ VW+L+  +      R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDMIVTASRDKSIIVWHLTKEEKTYGVARRRLTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLAEGK        +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAEGKSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+             L +      EG+   A  + + C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTIQEGD---AHTEWVSCVRFSPNTLQPTIVSASWDRTVK  176

Query  210  VWGI  199
            VW +
Sbjct  177  VWNL  180



>gb|ACJ24167.1| Rack [Phaseolus vulgaris]
Length=324

 Score =   338 bits (867),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 176/191 (92%), Gaps = 2/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+TLAGH+GY
Sbjct  136  GECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE 
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATEQ  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIV DL+VDLK E++ +  GN    K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  256  SIKIWDLESKSIVEDLKVDLKTEADGTTGGNTN--KKKVIYCTSLNWSADGSTLFSGYTD  313

Query  222  GVIRVWGIGRY  190
            GV+RVW IGRY
Sbjct  314  GVVRVWAIGRY  324


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 91/212 (43%), Gaps = 35/212 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+         R  L GH+ +V  V +
Sbjct  13   AHTDVVTAIA-TPIDNSDMIVTASRDKSIILWQLTKEDKTYGVPRRRLTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  283
            W+   E K  + D                  Q + +SA  + T           +N +  
Sbjct  132  WNTLGECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAG  191

Query  282  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIG  196
               +  +++ + DGS   SG  DGVI +W + 
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLA  223



>ref|XP_007160506.1| hypothetical protein PHAVU_002G327500g [Phaseolus vulgaris]
 gb|ACV72060.1| RACK1 [Phaseolus vulgaris]
 gb|ESW32500.1| hypothetical protein PHAVU_002G327500g [Phaseolus vulgaris]
Length=324

 Score =   338 bits (867),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 176/191 (92%), Gaps = 2/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+TLAGH+GY
Sbjct  136  GECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE 
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATEQ  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIV DL+VDLK E++ +  GN    K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  256  SIKIWDLESKSIVEDLKVDLKTEADGTTGGNTN--KKKVIYCTSLNWSADGSTLFSGYTD  313

Query  222  GVIRVWGIGRY  190
            GV+RVW IGRY
Sbjct  314  GVVRVWAIGRY  324


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 91/212 (43%), Gaps = 35/212 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+         R  L GH+ +V  V +
Sbjct  13   AHTDVVTAIA-TPIDNSDMIVTASRDKSIILWQLTKEDKTYGVPRRRLTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  283
            W+   E K  + D                  Q + +SA  + T           +N +  
Sbjct  132  WNTLGECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAG  191

Query  282  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIG  196
               +  +++ + DGS   SG  DGVI +W + 
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLA  223



>ref|XP_007036696.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOY21197.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=327

 Score =   337 bits (863),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 178/191 (93%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQDG+ H +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCK+R+TL GH+GY
Sbjct  138  GECKYTIQDGEAHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKIRNTLTGHSGY  197

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG++IH+LCFSPNRYWLCAATE 
Sbjct  198  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVIHSLCFSPNRYWLCAATEQ  257

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIV DL+VDLK E+E S +  +TA K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  258  SIKIWDLESKSIVEDLKVDLKAEAEKS-DVTDTANKKKVIYCTSLNWSADGSTLFSGYTD  316

Query  222  GVIRVWGIGRY  190
            GVIRVWGIGR+
Sbjct  317  GVIRVWGIGRF  327


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 83/187 (44%), Gaps = 31/187 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S  +     +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  63   GHSHFVQDVVLSSDS--QFALSGSWDGELRLWDLNAGTSARRFVGHTKDVLSVAFSIDNR  120

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  394
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  121  QIVSASRDRTIKLWNTLGECK--YTIQDGEAHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  393  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  214
            +W+L +  I    R  L   S                +  +++ + DGS   SG  DGVI
Sbjct  179  VWNLTNCKI----RNTLTGHSG---------------YVNTVAVSPDGSLCASGGKDGVI  219

Query  213  RVWGIGR  193
             +W +  
Sbjct  220  LLWDLAE  226



>gb|KFK43977.1| guanine nucleotide-binding protein subunit beta-like protein 
[Arabis alpina]
Length=327

 Score =   335 bits (858),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 175/192 (91%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  586
            GECKYTIQ+G +GH EWVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHTG
Sbjct  136  GECKYTIQEGGEGHTEWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHTG  195

Query  585  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  406
            YV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE
Sbjct  196  YVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATE  255

Query  405  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
              IKIWDLESKSIV DL+VDLK E+E S      A K K+I+CTSL+W+ADGSTLFSGYT
Sbjct  256  QGIKIWDLESKSIVEDLKVDLKAEAEKSDGSGTAATKKKVIYCTSLNWSADGSTLFSGYT  315

Query  225  DGVIRVWGIGRY  190
            DGVIRVWGIGR+
Sbjct  316  DGVIRVWGIGRF  327


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 52/209 (25%), Positives = 88/209 (42%), Gaps = 33/209 (16%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  400
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  399  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  220
            IK+W+            + K   +   EG+      + + C   S N    T+ S   D 
Sbjct  129  IKLWNTLG---------ECKYTIQEGGEGH-----TEWVSCVRFSPNTLQPTIVSASWDK  174

Query  219  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
             ++VW      +   +    + GH  Y+S
Sbjct  175  TVKVWN-----LSNCKLRSTLAGHTGYVS  198



>ref|XP_010032559.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Eucalyptus grandis]
 gb|KCW83972.1| hypothetical protein EUGRSUZ_B00856 [Eucalyptus grandis]
Length=327

 Score =   334 bits (857),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 176/192 (92%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+G+ HN+WVSCVRFSP+TLQPTIVS SWDRTVKVWNL+NCKLR+TL GH+GY
Sbjct  136  GECKYTIQEGEAHNDWVSCVRFSPNTLQPTIVSASWDRTVKVWNLTNCKLRNTLQGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG+IIH+LCFSPNRYWLCAATE 
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGAIIHSLCFSPNRYWLCAATEN  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKN-KIIFCTSLSWNADGSTLFSGYT  226
            SIKIWDLESKSIV DLRVDLK E++MS       + N K+I+CTSL+W+ADGSTLFSGY 
Sbjct  256  SIKIWDLESKSIVEDLRVDLKNEADMSDGTTGAMSSNKKVIYCTSLNWSADGSTLFSGYN  315

Query  225  DGVIRVWGIGRY  190
            DGVIRVWGIGRY
Sbjct  316  DGVIRVWGIGRY  327


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 79/186 (42%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H + V+ +   P      IV+ S D+++ +W+L+         R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIAV-PIDNADMIVTSSRDKSIILWHLTKEDKVYGVPRRRLTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  +        QE E         A N  + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTI--------QEGE---------AHNDWVSCVRFSPNTLQPTIVSASWDRT  174

Query  216  IRVWGI  199
            ++VW +
Sbjct  175  VKVWNL  180



>gb|KHG29145.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Gossypium arboreum]
Length=327

 Score =   334 bits (856),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 176/191 (92%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+GD H +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCK+R+TLAGH+GY
Sbjct  138  GECKYTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKIRNTLAGHSGY  197

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGS+IH+LCFSPNRYWLCAATE 
Sbjct  198  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSVIHSLCFSPNRYWLCAATEQ  257

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLESKSIV DL+VDLK E+E S +  +   K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  258  GIKIWDLESKSIVEDLKVDLKAEAEKS-DVTDIGNKKKVIYCTSLNWSADGSTLFSGYTD  316

Query  222  GVIRVWGIGRY  190
            GVIRVWGIGRY
Sbjct  317  GVIRVWGIGRY  327


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S  +     +SGSWD  +++W+LS         GHT  V +VA S D  
Sbjct  63   GHSHFVQDVVLSSDS--QFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNR  120

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  394
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  121  QIVSASRDRTIKLWNTLGECK--YTIQEGDAHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  393  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  214
            +W+L +  I                   NT A +   +  +++ + DGS   SG  DGVI
Sbjct  179  VWNLTNCKI------------------RNTLAGHS-GYVNTVAVSPDGSLCASGGKDGVI  219

Query  213  RVWGIGR  193
             +W +  
Sbjct  220  LLWDLAE  226


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 80/184 (43%), Gaps = 23/184 (13%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  15   AHTDMVTAIA-TPIDNSDMIVTSSRDKSIILWHLTKDEKTYGVPRRRLTGHSHFVQDVVL  73

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S D     SG  DG + LWDL+ G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  74   SSDSQFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  133

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+             L +      EG+   A    + C   S N    T+ S   D  ++
Sbjct  134  WNT------------LGECKYTIQEGD---AHTDWVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  210  VWGI  199
            VW +
Sbjct  179  VWNL  182



>ref|XP_009110365.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Brassica rapa]
Length=327

 Score =   333 bits (855),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 173/192 (90%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  586
            GECKYTI +G +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHTG
Sbjct  136  GECKYTIAEGGEGHGDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHTG  195

Query  585  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  406
            YVNTVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE
Sbjct  196  YVNTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATE  255

Query  405  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
              IKIWDLESKS+V DL+VDLK E+E S        K K+I+CTSLSWNADGSTLFSGYT
Sbjct  256  QGIKIWDLESKSVVEDLKVDLKAEAEKSDGSGTAGNKKKVIYCTSLSWNADGSTLFSGYT  315

Query  225  DGVIRVWGIGRY  190
            DGVIRVWGIGRY
Sbjct  316  DGVIRVWGIGRY  327


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 86/208 (41%), Gaps = 33/208 (16%)
 Frame = -2

Query  726  HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAVS  562
            H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +S
Sbjct  14   HTDQVTAIA-TPIDNSDIIVSASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVLS  72

Query  561  PDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEASI  397
             DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +I
Sbjct  73   SDGQFALSGSWDGKLRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRTI  129

Query  396  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            K+W+             L +     AEG         + C   S N    T+ S   D  
Sbjct  130  KLWNT------------LGECKYTIAEGGE--GHGDWVSCVRFSPNTLQPTIVSASWDKT  175

Query  216  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            ++VW      +   +    + GH  Y++
Sbjct  176  VKVWN-----LSNCKLRSTLAGHTGYVN  198



>ref|XP_006416642.1| hypothetical protein EUTSA_v10008183mg [Eutrema salsugineum]
 gb|ESQ34995.1| hypothetical protein EUTSA_v10008183mg [Eutrema salsugineum]
Length=328

 Score =   333 bits (855),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 175/193 (91%), Gaps = 2/193 (1%)
 Frame = -2

Query  762  GECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHT  589
            GECKYTI +G  +GHN+WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHT
Sbjct  136  GECKYTISEGGSEGHNDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHT  195

Query  588  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAAT  409
            GYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAAT
Sbjct  196  GYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAAT  255

Query  408  EASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGY  229
            E  IKIWDLESKSIV DL+VDLK E+E S      A K K+I+CTSL+W+ADGSTLFSGY
Sbjct  256  EQGIKIWDLESKSIVEDLKVDLKAEAEKSDGSGTAATKKKVIYCTSLNWSADGSTLFSGY  315

Query  228  TDGVIRVWGIGRY  190
            TDGVIRVWGIGRY
Sbjct  316  TDGVIRVWGIGRY  328


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 56/211 (27%), Positives = 91/211 (43%), Gaps = 36/211 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  400
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGISTRRFVGHNKDVLSVAFSL---DNRQIVSASRDRT  128

Query  399  IKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
            IK+W+   E K  +          SE  +EG+     N  + C   S N    T+ S   
Sbjct  129  IKLWNTLGECKYTI----------SEGGSEGH-----NDWVSCVRFSPNTLQPTIVSASW  173

Query  225  DGVIRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            D  ++VW      +   +    + GH  Y+S
Sbjct  174  DKTVKVWN-----LSNCKLRSTLAGHTGYVS  199



>ref|XP_002894122.1| hypothetical protein ARALYDRAFT_474002 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70381.1| hypothetical protein ARALYDRAFT_474002 [Arabidopsis lyrata subsp. 
lyrata]
Length=326

 Score =   333 bits (854),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + DGH EWVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR+TLAGH+GY
Sbjct  136  GECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRNTLAGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE 
Sbjct  196  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATEN  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SI+IWDLESKS+V DL+VDLK E+E S     T  K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  256  SIRIWDLESKSVVEDLKVDLKTEAEKSDVSTGTGNKTKVIYCTSLNWSADGSTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            GVIRVWGIGRY
Sbjct  316  GVIRVWGIGRY  326


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 91/208 (44%), Gaps = 32/208 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+         +  + GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPVDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + +            A+G+      + + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISE------------ADGH-----KEWVSCVRFSPNTLVPTIVSASWDKT  174

Query  216  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            ++VW      ++  +  + + GH  YL+
Sbjct  175  VKVWN-----LQNCKLRNTLAGHSGYLN  197


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 81/185 (44%), Gaps = 27/185 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNR  118

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHALC--FSPNRY---WLCAATEASIKIW  388
               S  +D  I LW+ L E K   S   G      C  FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  208
            +L++      LR  L   S                +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  207  WGIGR  193
            W +  
Sbjct  220  WDLAE  224



>ref|XP_009117627.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Brassica rapa]
Length=327

 Score =   333 bits (854),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 174/192 (91%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  586
            GECKYTI +G +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHTG
Sbjct  136  GECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHTG  195

Query  585  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  406
            YV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE
Sbjct  196  YVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATE  255

Query  405  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
              IKIWDLESKS+V DL+VDLK E+E S      A K K+I+CTSLSW+ADGSTLFSGYT
Sbjct  256  QGIKIWDLESKSVVEDLKVDLKAEAEKSDGSGTAATKRKVIYCTSLSWSADGSTLFSGYT  315

Query  225  DGVIRVWGIGRY  190
            DGVIRVWGIGRY
Sbjct  316  DGVIRVWGIGRY  327


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 54/209 (26%), Positives = 87/209 (42%), Gaps = 33/209 (16%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P     TIVS S D+++ VW L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDTIVSASRDKSIIVWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  400
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  399  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  220
            IK+W+             L +     +EG         + C   S N    T+ S   D 
Sbjct  129  IKLWNT------------LGECKYTISEGGE--GHRDWVSCVRFSPNTLQPTIVSASWDK  174

Query  219  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
             ++VW      +   +    + GH  Y+S
Sbjct  175  TVKVWN-----LSNCKLRSTLAGHTGYVS  198



>gb|KJB08186.1| hypothetical protein B456_001G069800 [Gossypium raimondii]
Length=327

 Score =   333 bits (853),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 176/191 (92%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+GD H +WVSCVRFSP+T+QPTIVS SWD+TVKVWNL+NCK+R+TLAGH+GY
Sbjct  138  GECKYTIQEGDAHTDWVSCVRFSPNTVQPTIVSASWDKTVKVWNLTNCKIRNTLAGHSGY  197

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGS+IH+LCFSPNRYWLCAATE 
Sbjct  198  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSVIHSLCFSPNRYWLCAATEQ  257

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLESKSIV DL+VDLK E+E S +  +   K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  258  GIKIWDLESKSIVEDLKVDLKAEAEKS-DVTDIGNKKKVIYCTSLNWSADGSTLFSGYTD  316

Query  222  GVIRVWGIGRY  190
            GVIRVWGIGRY
Sbjct  317  GVIRVWGIGRY  327


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 84/186 (45%), Gaps = 31/186 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S  +     +SGSWD  +++W+LS         GHT  V +VA S D  
Sbjct  63   GHSHFVQDVVLSSDS--QFALSGSWDGELRLWDLSAGTSARRFVGHTKDVLSVAFSIDNR  120

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  394
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  121  QIVSASRDRTIRLWNTLGECK--YTIQEGDAHTDWVSCVRFSPNTVQPTIVSASWDKTVK  178

Query  393  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  214
            +W+L +  I                   NT A +   +  +++ + DGS   SG  DGVI
Sbjct  179  VWNLTNCKI------------------RNTLAGHS-GYVNTVAVSPDGSLCASGGKDGVI  219

Query  213  RVWGIG  196
             +W + 
Sbjct  220  LLWDLA  225



>ref|XP_010678120.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Beta vulgaris subsp. vulgaris]
Length=326

 Score =   332 bits (852),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD DGH +WVSCVRFSP+T+QPTIVS SWD+TVK+WNLSNCKLR+TLAGH GY
Sbjct  136  GECKYTIQDSDGHTDWVSCVRFSPNTMQPTIVSASWDKTVKIWNLSNCKLRATLAGHNGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKD VILLWDLAEGK+LYSLDAG+IIHALCFSPNRYWLCAATE+
Sbjct  196  VNTVAVSPDGSLCASGGKDSVILLWDLAEGKRLYSLDAGTIIHALCFSPNRYWLCAATES  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLESKS+V DL+VDLK E++       TA+K K+I+CTSLSW+ADG TLFSGYTD
Sbjct  256  GIKIWDLESKSVVEDLKVDLKTEADHLEGSGTTASKKKVIYCTSLSWSADGQTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            GV+RV+GI RY
Sbjct  316  GVVRVYGIARY  326


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 61/122 (50%), Gaps = 8/122 (7%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ VWNL+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDMIVTASRDKSIIVWNLTKEDKIYGVPKRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGTTARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  390  WD  385
            W+
Sbjct  132  WN  133



>ref|XP_009149259.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Brassica rapa]
Length=328

 Score =   332 bits (852),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 174/193 (90%), Gaps = 2/193 (1%)
 Frame = -2

Query  762  GECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHT  589
            GECKYTI +G  +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHT
Sbjct  136  GECKYTIAEGGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHT  195

Query  588  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAAT  409
            GYVNTVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAAT
Sbjct  196  GYVNTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAAT  255

Query  408  EASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGY  229
            E  IKIWDLESKS+V DL+VDLK E+E S      A K K+I+CTSL+W+ADGSTLFSGY
Sbjct  256  EQGIKIWDLESKSVVEDLKVDLKAEAEKSDGSGTAATKRKVIYCTSLNWSADGSTLFSGY  315

Query  228  TDGVIRVWGIGRY  190
            TDGVIRVWGIGRY
Sbjct  316  TDGVIRVWGIGRY  328


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 87/209 (42%), Gaps = 32/209 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +        P IVS S D+++ VW L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIATPIDNSDP-IVSASRDKSIIVWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  400
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  399  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  220
            IK+W+             L +     AEG     ++  + C   S N    T+ S   D 
Sbjct  129  IKLWNT------------LGECKYTIAEGGGEGHRD-WVSCVRFSPNTLQPTIVSASWDK  175

Query  219  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
             ++VW      +   +    + GH  Y++
Sbjct  176  TVKVWN-----LSNCKLRSTLAGHTGYVN  199



>gb|KDP37901.1| hypothetical protein JCGZ_05340 [Jatropha curcas]
Length=329

 Score =   332 bits (852),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 175/193 (91%), Gaps = 2/193 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQDGD H++WVSCVRFSP+T QPTIVS SWDRTVKVWNL+NCKLR TLAGH GY
Sbjct  137  GECKYTIQDGDAHSDWVSCVRFSPNTHQPTIVSASWDRTVKVWNLTNCKLRCTLAGHNGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY+LDAG++IHALCFSPNRYWLCAATE 
Sbjct  197  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYNLDAGAVIHALCFSPNRYWLCAATEH  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMS--AEGNNTAAKNKIIFCTSLSWNADGSTLFSGY  229
            SIKIWDLESKSIV DL+VDLK E+E S  +    T+ K K I+CTSL+W+ADGSTLFSGY
Sbjct  257  SIKIWDLESKSIVEDLKVDLKAEAEKSEGSTATGTSIKKKNIYCTSLNWSADGSTLFSGY  316

Query  228  TDGVIRVWGIGRY  190
            TDGV+RVWGIGRY
Sbjct  317  TDGVVRVWGIGRY  329


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 92/212 (43%), Gaps = 35/212 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  14   AHTDQVTAIA-TPIDNSDMIVTSSRDKSIILWHLTKEEKTYGVPRRRLTGHSHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDGQFALSGSWDGELRLWDLAAGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  132

Query  390  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA----KNKIIFCT---  274
            W+   E K  + D               +  Q + +SA  + T       N  + CT   
Sbjct  133  WNTLGECKYTIQDGDAHSDWVSCVRFSPNTHQPTIVSASWDRTVKVWNLTNCKLRCTLAG  192

Query  273  ------SLSWNADGSTLFSGYTDGVIRVWGIG  196
                  +++ + DGS   SG  DGVI +W + 
Sbjct  193  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLA  224



>ref|XP_002890259.1| hypothetical protein ARALYDRAFT_889221 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66518.1| hypothetical protein ARALYDRAFT_889221 [Arabidopsis lyrata subsp. 
lyrata]
Length=327

 Score =   332 bits (851),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 174/192 (91%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  586
            GECKYTI +G +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHTG
Sbjct  136  GECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHTG  195

Query  585  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  406
            YV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE
Sbjct  196  YVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATE  255

Query  405  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
              IKIWDLESKSIV DL+VDLK E+E S      A K K+I+CTSL+W+ADGSTLFSGYT
Sbjct  256  QGIKIWDLESKSIVEDLKVDLKAEAEKSDNSGPAATKRKVIYCTSLNWSADGSTLFSGYT  315

Query  225  DGVIRVWGIGRY  190
            DGVIRVWGIGRY
Sbjct  316  DGVIRVWGIGRY  327


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/209 (25%), Positives = 86/209 (41%), Gaps = 33/209 (16%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  400
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  399  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  220
            IK+W+             L +     +EG         + C   S N    T+ S   D 
Sbjct  129  IKLWNT------------LGECKYTISEGGE--GHRDWVSCVRFSPNTLQPTIVSASWDK  174

Query  219  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
             ++VW      +   +    + GH  Y+S
Sbjct  175  TVKVWN-----LSNCKLRSTLAGHTGYVS  198



>ref|XP_002281279.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Vitis vinifera]
 emb|CAN61810.1| hypothetical protein VITISV_026180 [Vitis vinifera]
Length=327

 Score =   331 bits (849),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 174/192 (91%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H++WVSCVRFSP+ LQPTIVS SWDRTVKVWNL+NCKLR+TLAGH GY
Sbjct  136  GECKYTIQDADAHSDWVSCVRFSPNNLQPTIVSASWDRTVKVWNLTNCKLRATLAGHGGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG+IIHALCFSPNRYWLCAATE 
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAIIHALCFSPNRYWLCAATEQ  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAE-GNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
            SIKIWDLESKSIV DL+VDLK E+E S +       K KII+CTSLSW+ADGSTLFSGYT
Sbjct  256  SIKIWDLESKSIVEDLKVDLKTEAEKSEDTTTTAKKKGKIIYCTSLSWSADGSTLFSGYT  315

Query  225  DGVIRVWGIGRY  190
            DGV+RVWGIGRY
Sbjct  316  DGVVRVWGIGRY  327


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 80/186 (43%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W+L+         R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDMIVTSSRDKSIILWHLTKDDKTYGVPRRRLTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D                   A +  + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTIQD-----------------ADAHSDWVSCVRFSPNNLQPTIVSASWDRT  174

Query  216  IRVWGI  199
            ++VW +
Sbjct  175  VKVWNL  180



>emb|CAA06154.1| arcA 3 [Nicotiana tabacum]
Length=290

 Score =   329 bits (844),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 177/191 (93%), Gaps = 2/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI DGD H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH+GY
Sbjct  102  GECKYTITDGDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHSGY  161

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE+
Sbjct  162  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATES  221

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIVVDL+VDLKQESEMSAEG   AAKNKII+CT LSW+ADGSTLF G T 
Sbjct  222  SIKIWDLESKSIVVDLKVDLKQESEMSAEG-TAAAKNKIIYCTCLSWSADGSTLFGG-TQ  279

Query  222  GVIRVWGIGRY  190
             V+  +G GRY
Sbjct  280  MVLIEYGDGRY  290



>ref|XP_010540016.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Tarenaya hassleriana]
Length=328

 Score =   331 bits (848),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 176/193 (91%), Gaps = 2/193 (1%)
 Frame = -2

Query  762  GECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHT  589
            GECKYTI +G  +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTL GHT
Sbjct  136  GECKYTIAEGAGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLVGHT  195

Query  588  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAAT  409
            GYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+AG++IH+LCFSPNRYWLCAAT
Sbjct  196  GYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEAGAVIHSLCFSPNRYWLCAAT  255

Query  408  EASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGY  229
            E SIKIWDLESKSIV DL+VDLK E+E S    + A K K+I+CTSL+W+ADG+TLFSGY
Sbjct  256  EQSIKIWDLESKSIVEDLKVDLKAEAEKSDGAGSAATKTKVIYCTSLNWSADGNTLFSGY  315

Query  228  TDGVIRVWGIGRY  190
            TDGVIRVWGIGRY
Sbjct  316  TDGVIRVWGIGRY  328


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 90/209 (43%), Gaps = 32/209 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H + V+ +  +P     TIVS S D++V +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADTIVSSSRDKSVILWKLTKDDKAYGVPQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  400
            S DG    SG  DG + LWDLA G        +S D  S+  +L    NR  + A+ + S
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGTSTRRFVGHSKDVLSVAFSL---DNRQIVSASRDRS  128

Query  399  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  220
            IK+W+             L +     AEG     ++  + C   S N    T+ S   D 
Sbjct  129  IKLWNT------------LGECKYTIAEGAGEGHRD-WVSCVRFSPNTLQPTIVSASWDK  175

Query  219  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
             ++VW      +   +    ++GH  Y+S
Sbjct  176  TVKVWN-----LSNCKLRSTLVGHTGYVS  199



>ref|XP_010036939.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Eucalyptus grandis]
 gb|KCW48591.1| hypothetical protein EUGRSUZ_K02261 [Eucalyptus grandis]
Length=326

 Score =   330 bits (847),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 177/192 (92%), Gaps = 2/192 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+G+ H +WVSCVRFSP+TLQPTIVS SWDRT+KVWNL+NCKLR+TLAGH GY
Sbjct  136  GECKYTIQEGEAHTDWVSCVRFSPNTLQPTIVSASWDRTIKVWNLTNCKLRNTLAGHNGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY+L+AG+IIH+LCFSPNRYWLCAATE 
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYNLEAGAIIHSLCFSPNRYWLCAATEN  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKN-KIIFCTSLSWNADGSTLFSGYT  226
            SIKIWDLESKSIV DLRVDLK E++ + +G  TAA N K+I+CTSL+W+ADGSTLFSGY 
Sbjct  256  SIKIWDLESKSIVEDLRVDLKNEADKT-DGTTTAASNKKVIYCTSLNWSADGSTLFSGYN  314

Query  225  DGVIRVWGIGRY  190
            DGVIRVWG GRY
Sbjct  315  DGVIRVWGTGRY  326


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 79/186 (42%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H + V+ +   P      +V+ S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIAI-PIDNSDMVVTSSRDKSIILWHLTKEEKVYGVPRRRLTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  +        QE E         A    + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTI--------QEGE---------AHTDWVSCVRFSPNTLQPTIVSASWDRT  174

Query  216  IRVWGI  199
            I+VW +
Sbjct  175  IKVWNL  180



>ref|XP_010537487.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Tarenaya hassleriana]
Length=328

 Score =   330 bits (847),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 175/193 (91%), Gaps = 2/193 (1%)
 Frame = -2

Query  762  GECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHT  589
            GECKYTI +G  +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL NCKLRSTL GHT
Sbjct  136  GECKYTIAEGAGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLLNCKLRSTLVGHT  195

Query  588  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAAT  409
            GYV+TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG++IHALCFSPNRYWLCAAT
Sbjct  196  GYVSTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGAVIHALCFSPNRYWLCAAT  255

Query  408  EASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGY  229
            E SIKIWDLESKSIV DL+VDLK E+E S     TA K K+I+CTSL+W+ADG+TLFSGY
Sbjct  256  EQSIKIWDLESKSIVEDLKVDLKAEAEKSDGAGATANKKKVIYCTSLNWSADGNTLFSGY  315

Query  228  TDGVIRVWGIGRY  190
            TDGVIRVWGIGRY
Sbjct  316  TDGVIRVWGIGRY  328


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 87/206 (42%), Gaps = 26/206 (13%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IVS S D+++ +W L+  +      +  L GH+ +V  V +
Sbjct  13   AHTDEVTAIA-TPIDNADIIVSSSRDKSIVLWKLTKDEKAYGVPQRRLTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      +I       NR  + A+ + SIK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGTSTRRFVGHTKDVISVAFSIDNRQIVSASRDRSIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+             L +     AEG     ++  + C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTIAEGAGEGHRD-WVSCVRFSPNTLQPTIVSASWDKTVK  178

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW      +   +    ++GH  Y+S
Sbjct  179  VWN-----LLNCKLRSTLVGHTGYVS  199



>ref|XP_006305354.1| hypothetical protein CARUB_v10009733mg [Capsella rubella]
 gb|EOA38252.1| hypothetical protein CARUB_v10009733mg [Capsella rubella]
Length=326

 Score =   330 bits (847),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI +GDGH++WVSCVRFSP+T +PTIVS SWDRTVKVWNL NCKLR+TLAGH+GY
Sbjct  136  GECKYTISEGDGHSDWVSCVRFSPNTHEPTIVSASWDRTVKVWNLQNCKLRNTLAGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE 
Sbjct  196  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATEN  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SI+IWDLESKS+V DL+VDLK E+E S     T  K K+I+CTSL+W+ADG+TLFSGYTD
Sbjct  256  SIRIWDLESKSVVEDLKVDLKVEAEKSDGAVGTGNKTKVIYCTSLNWSADGNTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            G+IRVWGIGRY
Sbjct  316  GIIRVWGIGRY  326


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/206 (23%), Positives = 89/206 (43%), Gaps = 28/206 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+         +  + GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPVDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGESTRRFVGHKKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+             L +     +EG+     +  + C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTISEGD---GHSDWVSCVRFSPNTHEPTIVSASWDRTVK  176

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW      ++  +  + + GH  YL+
Sbjct  177  VWN-----LQNCKLRNTLAGHSGYLN  197


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 81/185 (44%), Gaps = 27/185 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GH   V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGESTRRFVGHKKDVLSVAFSTDNR  118

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHALC--FSPNRY---WLCAATEASIKIW  388
               S  +D  I LW+ L E K   S   G      C  FSPN +    + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEGDGHSDWVSCVRFSPNTHEPTIVSASWDRTVKVW  178

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  208
            +L++      LR  L   S                +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  207  WGIGR  193
            W +  
Sbjct  220  WDLAE  224



>ref|NP_173248.1| guanine nucleotide-binding protein subunit beta-like protein 
A [Arabidopsis thaliana]
 sp|O24456.2|GBLPA_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein A; AltName: Full=Receptor for activated C kinase 
1A; AltName: Full=WD-40 repeat auxin-dependent protein ARCA 
[Arabidopsis thaliana]
 gb|AAF78369.1|AC069551_2 T10O22.6 [Arabidopsis thaliana]
 gb|AAF97825.1|AC034107_8 Identical to WD-40 repeat protein (AtArcA) from Arabidopsis thaliana 
gb|U77381 and contains multiple WD (G-beta repeat) PF|00400 
domains. ESTs gb|Z17972, gb|AI099926, gb|T42961, gb|R30131, 
gb|AV541608, gb|AV532234, gb|AV543299, gb|AV440652 come 
from this gene [Arabidopsis thaliana]
 gb|AAK59512.1| putative WD-40 repeat protein [Arabidopsis thaliana]
 gb|AAL34190.1| putative WD-40 repeat protein [Arabidopsis thaliana]
 gb|AAM66016.1| WD-40 repeat protein [Arabidopsis thaliana]
 gb|AEE29673.1| WD-40 repeat ArcA-like protein [Arabidopsis thaliana]
Length=327

 Score =   330 bits (847),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 174/192 (91%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  586
            GECKYTI +G +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHTG
Sbjct  136  GECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHTG  195

Query  585  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  406
            YV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE
Sbjct  196  YVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATE  255

Query  405  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
              IKIWDLESKSIV DL+VDLK E+E +      A K K+I+CTSL+W+ADGSTLFSGYT
Sbjct  256  HGIKIWDLESKSIVEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSADGSTLFSGYT  315

Query  225  DGVIRVWGIGRY  190
            DGVIRVWGIGRY
Sbjct  316  DGVIRVWGIGRY  327


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 52/209 (25%), Positives = 86/209 (41%), Gaps = 33/209 (16%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  400
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  399  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  220
            IK+W+             L +     +EG         + C   S N    T+ S   D 
Sbjct  129  IKLWNT------------LGECKYTISEGGE--GHRDWVSCVRFSPNTLQPTIVSASWDK  174

Query  219  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
             ++VW      +   +    + GH  Y+S
Sbjct  175  TVKVWN-----LSNCKLRSTLAGHTGYVS  198



>ref|NP_188441.1| receptor for activated C kinase 1C [Arabidopsis thaliana]
 sp|Q9LV28.1|GPLPC_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein C; AltName: Full=Receptor for activated C kinase 
1C [Arabidopsis thaliana]
 dbj|BAB02025.1| guanine nucleotide-binding protein; activated protein kinase 
C receptor; RACK1 [Arabidopsis thaliana]
 gb|AAK91355.1| AT3g18130/MRC8_11 [Arabidopsis thaliana]
 gb|AAM26650.1| AT3g18130/MRC8_11 [Arabidopsis thaliana]
 gb|AEE76051.1| receptor for activated C kinase 1C [Arabidopsis thaliana]
Length=326

 Score =   330 bits (846),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI +GDGH EWVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR++L GH+GY
Sbjct  136  GECKYTISEGDGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRNSLVGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE 
Sbjct  196  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATEN  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SI+IWDLESKS+V DL+VDLK E+E +  G  T  + K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  256  SIRIWDLESKSVVEDLKVDLKSEAEKNEGGVGTGNQKKVIYCTSLNWSADGSTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            GV+RVWGIGRY
Sbjct  316  GVVRVWGIGRY  326


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 90/206 (44%), Gaps = 28/206 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDIVTAIA-TPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGETTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+             L +     +EG+      + + C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTISEGD---GHKEWVSCVRFSPNTLVPTIVSASWDKTVK  176

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW      ++  +  + ++GH  YL+
Sbjct  177  VWN-----LQNCKLRNSLVGHSGYLN  197


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/189 (27%), Positives = 81/189 (43%), Gaps = 35/189 (19%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGETTRRFVGHTKDVLSVAFSTDNR  118

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHALC--FSPNRY---WLCAATEASIKIW  388
               S  +D  I LW+ L E K   S   G      C  FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEGDGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKII----FCTSLSWNADGSTLFSGYTDG  220
            +L+                       N   +N ++    +  +++ + DGS   SG  DG
Sbjct  179  NLQ-----------------------NCKLRNSLVGHSGYLNTVAVSPDGSLCASGGKDG  215

Query  219  VIRVWGIGR  193
            VI +W +  
Sbjct  216  VILLWDLAE  224



>ref|XP_009360100.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Pyrus x bretschneideri]
Length=326

 Score =   330 bits (846),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECK+TIQD DGH +WVSCVRFSPST+QPTIVS SWD+TVKVWNLSNCKLR+TL GH GY
Sbjct  136  GECKFTIQDQDGHGDWVSCVRFSPSTMQPTIVSASWDKTVKVWNLSNCKLRNTLEGHNGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY L+AGSIIHALCFSPNRYWLCAATE 
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYHLEAGSIIHALCFSPNRYWLCAATEQ  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYT  226
            SIKIWDLESKSIV +L+VDLK E+E + + +  T+ K K+I+CTSL+W+ADGSTLFSGYT
Sbjct  256  SIKIWDLESKSIVEELKVDLKTEAEKTEDTHAATSYKKKVIYCTSLNWSADGSTLFSGYT  315

Query  225  DGVIRVWGIGR  193
            DGVIRVWGIGR
Sbjct  316  DGVIRVWGIGR  326


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 57/231 (25%), Positives = 97/231 (42%), Gaps = 39/231 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H + V+ +   P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIAI-PIDNSEMIVSASRDKSIILWHLNKDEKTYGVPRRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLALGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  283
            W+   E K  + D                  Q + +SA  + T           +N +  
Sbjct  132  WNTLGECKFTIQDQDGHGDWVSCVRFSPSTMQPTIVSASWDKTVKVWNLSNCKLRNTLEG  191

Query  282  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCY  139
               +  +++ + DGS   SG  DGVI +W +     E  R  H+  G + +
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLA----EGKRLYHLEAGSIIH  238



>gb|AAB82647.1| WD-40 repeat protein [Arabidopsis thaliana]
Length=327

 Score =   329 bits (844),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 174/192 (91%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  586
            GECKYTI +G +GH +WVSCVRFSP+TLQPTIVS SWD+TVK+WNLSNCKLRSTLAGHTG
Sbjct  136  GECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKMWNLSNCKLRSTLAGHTG  195

Query  585  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  406
            YV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE
Sbjct  196  YVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATE  255

Query  405  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
              IKIWDLESKSIV DL+VDLK E+E +      A K K+I+CTSL+W+ADGSTLFSGYT
Sbjct  256  HGIKIWDLESKSIVEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSADGSTLFSGYT  315

Query  225  DGVIRVWGIGRY  190
            DGVIRVWGIGRY
Sbjct  316  DGVIRVWGIGRY  327


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 86/209 (41%), Gaps = 33/209 (16%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  400
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  399  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  220
            IK+W+             L +     +EG         + C   S N    T+ S   D 
Sbjct  129  IKLWNT------------LGECKYTISEGGE--GHRDWVSCVRFSPNTLQPTIVSASWDK  174

Query  219  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
             +++W      +   +    + GH  Y+S
Sbjct  175  TVKMWN-----LSNCKLRSTLAGHTGYVS  198



>gb|AGV54321.1| RACK1 [Phaseolus vulgaris]
Length=324

 Score =   329 bits (843),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 174/191 (91%), Gaps = 2/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H++WVSCVRFSPSTLQPTIVS SWDRT KVWNL+NCKL++TLAG++GY
Sbjct  136  GECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTGKVWNLTNCKLKNTLAGNSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VN VAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE 
Sbjct  196  VNNVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATEQ  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIV DL+VDLK E++ +  GN    K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  256  SIKIWDLESKSIVEDLKVDLKTEADGTTGGNTN--KKKVIYCTSLNWSADGSTLFSGYTD  313

Query  222  GVIRVWGIGRY  190
            GV+RVW IGRY
Sbjct  314  GVVRVWAIGRY  324


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 55/212 (26%), Positives = 91/212 (43%), Gaps = 35/212 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+         R  L GH+ +V  V +
Sbjct  13   AHTDVVTAIA-TPIDNSDMIVTASRDKSIILWQLTKEDKTYGVPRRRLTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGTSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  283
            W+   E K  + D                  Q + +SA  + T           KN +  
Sbjct  132  WNTLGECKYTIQDSDAHSDWVSCVRFSPSTLQPTIVSASWDRTGKVWNLTNCKLKNTLAG  191

Query  282  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIG  196
               +  +++ + DGS   SG  DGVI +W + 
Sbjct  192  NSGYVNNVAVSPDGSLCASGGKDGVILLWDLA  223



>ref|XP_010097592.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Morus notabilis]
 gb|EXB69124.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Morus notabilis]
Length=330

 Score =   329 bits (843),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 176/194 (91%), Gaps = 3/194 (2%)
 Frame = -2

Query  762  GECKYTI--QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHT  589
            GECKYTI    G+ H++WVSCVRFSPS LQPTIVS SWDRTVKVWNLSNCKLR+TL+GH 
Sbjct  137  GECKYTISGDGGEAHSDWVSCVRFSPSNLQPTIVSASWDRTVKVWNLSNCKLRNTLSGHG  196

Query  588  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAAT  409
            GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG+IIHALCFSPNRYWLCAAT
Sbjct  197  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAIIHALCFSPNRYWLCAAT  256

Query  408  EASIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSG  232
            E SIKIWDLESKSIV DL+VDLK E+E + + +  TA K K+I+CTSLSW+ADGSTLFSG
Sbjct  257  ENSIKIWDLESKSIVEDLKVDLKTEAEKTEDTHAATANKKKVIYCTSLSWSADGSTLFSG  316

Query  231  YTDGVIRVWGIGRY  190
            YTDGVIRVWGIGRY
Sbjct  317  YTDGVIRVWGIGRY  330


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 83/186 (45%), Gaps = 29/186 (16%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S  +     +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  62   GHSHFVEDVVLSSDS--QFALSGSWDGELRLWDLAAGVSARRFVGHTKDVLSVAFSIDNR  119

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI----IHALCFSPNRYW---LCAATEASIK  394
               S  +D  I LW+ L E K   S D G      +  + FSP+      + A+ + ++K
Sbjct  120  QIVSASRDRTIKLWNTLGECKYTISGDGGEAHSDWVSCVRFSPSNLQPTIVSASWDRTVK  179

Query  393  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  214
            +W+L           + K  + +S  G          +  +++ + DGS   SG  DGVI
Sbjct  180  VWNLS----------NCKLRNTLSGHGG---------YVNTVAVSPDGSLCASGGKDGVI  220

Query  213  RVWGIG  196
             +W + 
Sbjct  221  LLWDLA  226


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 78/184 (42%), Gaps = 21/184 (11%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W+L+         R  L GH+ +V  V +
Sbjct  14   AHTDMVTAIA-TPIDNSDIIVTASRDKSIILWHLTKEDKAYGVPRRRLTGHSHFVEDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S D     SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDSQFALSGSWDGELRLWDLAAGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  132

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+                E + +  G+   A +  + C   S +    T+ S   D  ++
Sbjct  133  WNTLG-------------ECKYTISGDGGEAHSDWVSCVRFSPSNLQPTIVSASWDRTVK  179

Query  210  VWGI  199
            VW +
Sbjct  180  VWNL  183



>ref|XP_008393404.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Malus domestica]
Length=326

 Score =   328 bits (842),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECK+TIQD DGH +WVSCVRFSP+T+QPTIVS SWD+TVKVWNLSNCKLR+TL GH GY
Sbjct  136  GECKFTIQDQDGHGDWVSCVRFSPNTMQPTIVSASWDKTVKVWNLSNCKLRNTLEGHNGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY L+AGSIIHALCFSPNRYWLCAATE 
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYHLEAGSIIHALCFSPNRYWLCAATEQ  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYT  226
            SIKIWDLESKSIV +L+VDLK E+E + + +  T+ K K+I+CTSL+W+ADGSTLFSGYT
Sbjct  256  SIKIWDLESKSIVEELKVDLKTEAEKTEDTHAATSYKKKVIYCTSLNWSADGSTLFSGYT  315

Query  225  DGVIRVWGIGR  193
            DGVIRVWGIGR
Sbjct  316  DGVIRVWGIGR  326


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 57/231 (25%), Positives = 98/231 (42%), Gaps = 39/231 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H + V+ +   P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIAI-PIDNSEMIVSASRDKSIILWHLNKDEKTYGVPRRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLALGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  283
            W+   E K  + D               +  Q + +SA  + T           +N +  
Sbjct  132  WNTLGECKFTIQDQDGHGDWVSCVRFSPNTMQPTIVSASWDKTVKVWNLSNCKLRNTLEG  191

Query  282  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCY  139
               +  +++ + DGS   SG  DGVI +W +     E  R  H+  G + +
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLA----EGKRLYHLEAGSIIH  238



>ref|XP_008374821.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein [Malus domestica]
 ref|XP_008364648.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Malus domestica]
 ref|XP_009347770.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Pyrus x bretschneideri]
Length=326

 Score =   328 bits (842),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECK+TIQD DGH +WVSCVRFSP+T+QPTIVS SWD+TVKVWNLSNCKLR+TL GH GY
Sbjct  136  GECKFTIQDQDGHGDWVSCVRFSPNTMQPTIVSASWDKTVKVWNLSNCKLRNTLEGHNGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY L+AGSIIHALCFSPNRYWLCAATE 
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYHLEAGSIIHALCFSPNRYWLCAATEQ  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYT  226
            SIKIWDLESKSIV +L+VDLK E+E + + +  T+ K K+I+CTSL+W+ADGSTLFSGYT
Sbjct  256  SIKIWDLESKSIVEELKVDLKTEAEKTEDTHAATSYKKKVIYCTSLNWSADGSTLFSGYT  315

Query  225  DGVIRVWGIGR  193
            DGVIRVWGIGR
Sbjct  316  DGVIRVWGIGR  326


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 57/231 (25%), Positives = 98/231 (42%), Gaps = 39/231 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H + V+ +   P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIAI-PIDNSEMIVSASRDKSIILWHLNKDEKTYGVPRRRLTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLALGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA---------KNKII-  283
            W+   E K  + D               +  Q + +SA  + T           +N +  
Sbjct  132  WNTLGECKFTIQDQDGHGDWVSCVRFSPNTMQPTIVSASWDKTVKVWNLSNCKLRNTLEG  191

Query  282  ---FCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCY  139
               +  +++ + DGS   SG  DGVI +W +     E  R  H+  G + +
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLA----EGKRLYHLEAGSIIH  238



>ref|XP_002318528.1| GTP-binding protein beta chain [Populus trichocarpa]
 gb|EEE96748.1| GTP-binding protein beta chain [Populus trichocarpa]
Length=328

 Score =   328 bits (842),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 174/192 (91%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+ + H +WVSCVRFSPSTLQPTIVS SWD+TVKVWNL+NCKLRSTLAGH+GY
Sbjct  137  GECKYTIQEAESHTDWVSCVRFSPSTLQPTIVSASWDKTVKVWNLTNCKLRSTLAGHSGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG++I+ALCFSPNRYWLCAATE 
Sbjct  197  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVINALCFSPNRYWLCAATEN  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA-AKNKIIFCTSLSWNADGSTLFSGYT  226
            SIKIWDLESK +V DL+VDLK E+E S     TA +  K I+CTSL+W+ADGSTLFSGYT
Sbjct  257  SIKIWDLESKMVVDDLKVDLKAEAEKSEGTTATAVSTKKKIYCTSLNWSADGSTLFSGYT  316

Query  225  DGVIRVWGIGRY  190
            DGVIRVWG+GRY
Sbjct  317  DGVIRVWGVGRY  328


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 61/123 (50%), Gaps = 10/123 (8%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  14   AHTDQVTAIA-TPIDNTDMIVSASRDKSIILWHLTKDEKTYGVARRRLTGHSHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEG---KKLYSLDAGSIIHALCFSPNRYWLCAATEASIK  394
            S DG    SG  DG + LWDLA G   ++        +  A  F  NR  + A+ + +IK
Sbjct  73   SSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSFD-NRQIVSASRDKTIK  131

Query  393  IWD  385
            +W+
Sbjct  132  LWN  134



>ref|XP_010506450.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Camelina sativa]
Length=326

 Score =   328 bits (842),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI +GDGH EW+SCVRFSP+TL PTIVS SWD TVKVWNL NCKL+++L GHTGY
Sbjct  136  GECKYTISEGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKVWNLQNCKLKNSLVGHTGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE 
Sbjct  196  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATEN  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESK++V DL+VDLK E+E +  G  T  + K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  256  SIKIWDLESKTVVEDLKVDLKAEAEKADGGVGTGNQKKVIYCTSLNWSADGSTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            GV+RVWGIGRY
Sbjct  316  GVVRVWGIGRY  326


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 88/206 (43%), Gaps = 28/206 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+             L +     +EG+      + I C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTISEGD---GHKEWISCVRFSPNTLVPTIVSASWDHTVK  176

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW      ++  +  + ++GH  YL+
Sbjct  177  VWN-----LQNCKLKNSLVGHTGYLN  197


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/189 (28%), Positives = 81/189 (43%), Gaps = 35/189 (19%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  118

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  388
               S  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKVW  178

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKII----FCTSLSWNADGSTLFSGYTDG  220
            +L+                       N   KN ++    +  +++ + DGS   SG  DG
Sbjct  179  NLQ-----------------------NCKLKNSLVGHTGYLNTVAVSPDGSLCASGGKDG  215

Query  219  VIRVWGIGR  193
            VI +W +  
Sbjct  216  VILLWDLAE  224



>ref|XP_011039103.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Populus euphratica]
Length=328

 Score =   328 bits (842),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 174/192 (91%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+ + H +WVSCVRFSPSTLQPTIVS SWD+TVKVWNL+NCKLRSTLAGH+GY
Sbjct  137  GECKYTIQEAESHTDWVSCVRFSPSTLQPTIVSASWDKTVKVWNLTNCKLRSTLAGHSGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG++I+ALCFSPNRYWLCAATE 
Sbjct  197  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVINALCFSPNRYWLCAATEN  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA-AKNKIIFCTSLSWNADGSTLFSGYT  226
            SIKIWDLESK +V DL+VDLK E+E S     TA +  K I+CTSL+W+ADGSTLFSGYT
Sbjct  257  SIKIWDLESKMVVDDLKVDLKAEAEKSEGTTATAVSTKKKIYCTSLNWSADGSTLFSGYT  316

Query  225  DGVIRVWGIGRY  190
            DGVIRVWG+GRY
Sbjct  317  DGVIRVWGVGRY  328


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 61/123 (50%), Gaps = 10/123 (8%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  14   AHTDQVTAIA-TPIDNTDMIVSSSRDKSIILWHLTKDEKTYGVARRRLTGHSHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEG---KKLYSLDAGSIIHALCFSPNRYWLCAATEASIK  394
            S DG    SG  DG + LWDLA G   ++        +  A  F  NR  + A+ + +IK
Sbjct  73   SSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSFD-NRQIVSASRDKTIK  131

Query  393  IWD  385
            +W+
Sbjct  132  LWN  134



>ref|XP_010498185.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Camelina sativa]
Length=328

 Score =   328 bits (842),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 174/193 (90%), Gaps = 2/193 (1%)
 Frame = -2

Query  762  GECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHT  589
            GECKYTI +G  +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHT
Sbjct  136  GECKYTISEGGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHT  195

Query  588  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAAT  409
            GYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHA+CFSPNRYWLCAAT
Sbjct  196  GYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHAVCFSPNRYWLCAAT  255

Query  408  EASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGY  229
            E  IKIWDLESK+IV DL+VDLK E+E +      A K K+I+CTSL+W+ADGSTLFSGY
Sbjct  256  EQGIKIWDLESKTIVEDLKVDLKAEAEKADNSGPAATKKKVIYCTSLNWSADGSTLFSGY  315

Query  228  TDGVIRVWGIGRY  190
            TDGVIRVWGIGRY
Sbjct  316  TDGVIRVWGIGRY  328


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 90/211 (43%), Gaps = 36/211 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IVS S D+++ +W L+  +      +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDEKSYGVAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  400
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  399  IKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
            IK+W+   E K  +          SE   EG+        + C   S N    T+ S   
Sbjct  129  IKLWNTLGECKYTI----------SEGGGEGH-----RDWVSCVRFSPNTLQPTIVSASW  173

Query  225  DGVIRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            D  ++VW      +   +    + GH  Y+S
Sbjct  174  DKTVKVWN-----LSNCKLRSTLAGHTGYVS  199



>ref|XP_006305339.1| hypothetical protein CARUB_v10009720mg [Capsella rubella]
 gb|EOA38237.1| hypothetical protein CARUB_v10009720mg [Capsella rubella]
Length=328

 Score =   328 bits (842),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 173/193 (90%), Gaps = 2/193 (1%)
 Frame = -2

Query  762  GECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHT  589
            GECKYTI +G  +GH +WVSCVRFSP+TL PTIVS SWD+TVKVWNLSNCKLRSTLAGHT
Sbjct  136  GECKYTISEGGGEGHRDWVSCVRFSPNTLHPTIVSASWDKTVKVWNLSNCKLRSTLAGHT  195

Query  588  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAAT  409
            GYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAAT
Sbjct  196  GYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAAT  255

Query  408  EASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGY  229
            E  IKIWDLESKSIV DL+VDLK E+E +      A K K+I+CTSL+W+ADGSTLFSGY
Sbjct  256  EQGIKIWDLESKSIVEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSADGSTLFSGY  315

Query  228  TDGVIRVWGIGRY  190
            TDGVIRVWGIGRY
Sbjct  316  TDGVIRVWGIGRY  328


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 89/211 (42%), Gaps = 36/211 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  400
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  399  IKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
            IK+W+   E K  +          SE   EG+        + C   S N    T+ S   
Sbjct  129  IKLWNTLGECKYTI----------SEGGGEGH-----RDWVSCVRFSPNTLHPTIVSASW  173

Query  225  DGVIRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            D  ++VW      +   +    + GH  Y+S
Sbjct  174  DKTVKVWN-----LSNCKLRSTLAGHTGYVS  199



>ref|XP_008240184.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Prunus mume]
Length=327

 Score =   328 bits (841),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 173/192 (90%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECK+TIQD DGH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCKLR TL GH GY
Sbjct  136  GECKFTIQDQDGHGDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRCTLEGHNGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK LYSL AG+IIHALCFSPNRYWLCAATE 
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKMLYSLGAGAIIHALCFSPNRYWLCAATEQ  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYT  226
            SIKIWDLESK IV DL+VDLK E+E + + +  TA K K+I+CTSL+W+ADGSTLFSGY+
Sbjct  256  SIKIWDLESKQIVEDLKVDLKTEAEKTEDTHAATAYKKKVIYCTSLNWSADGSTLFSGYS  315

Query  225  DGVIRVWGIGRY  190
            DGVIRVWGIGRY
Sbjct  316  DGVIRVWGIGRY  327


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 59/231 (26%), Positives = 98/231 (42%), Gaps = 35/231 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H + V+ +   P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIAI-PIDNSEMIVSASRDKSIILWHLTKDEKTYGVPRRRLTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLALGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA----KNKIIFCT---  274
            W+   E K  + D               +  Q + +SA  + T       N  + CT   
Sbjct  132  WNTLGECKFTIQDQDGHGDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRCTLEG  191

Query  273  ------SLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCY  139
                  +++ + DGS   SG  DGVI +W +    M     +  II  +C+
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKMLYSLGAGAIIHALCF  242



>ref|NP_175296.1| receptor for activated C kinase 1B [Arabidopsis thaliana]
 sp|Q9C4Z6.1|GPLPB_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein B; AltName: Full=Receptor for activated C kinase 
1B [Arabidopsis thaliana]
 gb|AAG50846.1|AC074308_2 guanine nucleotide-binding protein, putative [Arabidopsis thaliana]
 gb|AAG60127.1|AC073555_11 guanine nucleotide-binding protein, putative [Arabidopsis thaliana]
 gb|AAL24080.1| putative guanine nucleotide-binding protein [Arabidopsis thaliana]
 gb|AAM14291.1| putative guanine nucleotide-binding protein [Arabidopsis thaliana]
 gb|AEE32329.1| receptor for activated C kinase 1B [Arabidopsis thaliana]
Length=326

 Score =   328 bits (841),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + DGH EWVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR+TLAGH+GY
Sbjct  136  GECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRNTLAGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE 
Sbjct  196  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATEN  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SI+IWDLESKS+V DL+VDLK E+E +        K K+I+CTSL+W+ADG+TLFSGYTD
Sbjct  256  SIRIWDLESKSVVEDLKVDLKAEAEKTDGSTGIGNKTKVIYCTSLNWSADGNTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            GVIRVWGIGRY
Sbjct  316  GVIRVWGIGRY  326


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 91/208 (44%), Gaps = 32/208 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+         +  + GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPVDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + +            A+G+      + + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISE------------ADGH-----KEWVSCVRFSPNTLVPTIVSASWDKT  174

Query  216  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            ++VW      ++  +  + + GH  YL+
Sbjct  175  VKVWN-----LQNCKLRNTLAGHSGYLN  197


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 81/185 (44%), Gaps = 27/185 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNR  118

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHALC--FSPNRY---WLCAATEASIKIW  388
               S  +D  I LW+ L E K   S   G      C  FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  208
            +L++      LR  L   S                +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  207  WGIGR  193
            W +  
Sbjct  220  WDLAE  224



>ref|XP_007209348.1| hypothetical protein PRUPE_ppa008536mg [Prunus persica]
 gb|EMJ10547.1| hypothetical protein PRUPE_ppa008536mg [Prunus persica]
Length=327

 Score =   328 bits (841),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 173/192 (90%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECK+TIQD DGH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCKLR TL GH GY
Sbjct  136  GECKFTIQDQDGHGDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRCTLEGHNGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK LYSL AG+IIHALCFSPNRYWLCAATE 
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKMLYSLGAGAIIHALCFSPNRYWLCAATEQ  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYT  226
            SIKIWDLESK IV DL+VDLK E+E + + +  TA K K+I+CTSL+W+ADGSTLFSGY+
Sbjct  256  SIKIWDLESKQIVEDLKVDLKTEAEKTEDTHAATAYKKKVIYCTSLNWSADGSTLFSGYS  315

Query  225  DGVIRVWGIGRY  190
            DGVIRVWGIGRY
Sbjct  316  DGVIRVWGIGRY  327


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 59/231 (26%), Positives = 98/231 (42%), Gaps = 35/231 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H + V+ +   P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  13   AHTDMVTAIAI-PIDNSEMIVSASRDKSIILWHLTKDEKTYGVPRRRLTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLALGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVD------------LRVDLKQESEMSAEGNNTAA----KNKIIFCT---  274
            W+   E K  + D               +  Q + +SA  + T       N  + CT   
Sbjct  132  WNTLGECKFTIQDQDGHGDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRCTLEG  191

Query  273  ------SLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCY  139
                  +++ + DGS   SG  DGVI +W +    M     +  II  +C+
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKMLYSLGAGAIIHALCF  242



>ref|XP_010476972.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Camelina sativa]
Length=328

 Score =   328 bits (841),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 173/193 (90%), Gaps = 2/193 (1%)
 Frame = -2

Query  762  GECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHT  589
            GECKYTI +G  +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHT
Sbjct  136  GECKYTISEGGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHT  195

Query  588  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAAT  409
            GYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYS +A S+IHALCFSPNRYWLCAAT
Sbjct  196  GYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSFEANSVIHALCFSPNRYWLCAAT  255

Query  408  EASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGY  229
            E  IKIWDLESK+IV DL+VDLK E+E +      A K K+I+CTSL+W+ADGSTLFSGY
Sbjct  256  EQGIKIWDLESKTIVEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSADGSTLFSGY  315

Query  228  TDGVIRVWGIGRY  190
            TDGVIRVWGIGRY
Sbjct  316  TDGVIRVWGIGRY  328


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 89/211 (42%), Gaps = 36/211 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  400
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  399  IKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
            IK+W+   E K  +          SE   EG+        + C   S N    T+ S   
Sbjct  129  IKLWNTLGECKYTI----------SEGGGEGH-----RDWVSCVRFSPNTLQPTIVSASW  173

Query  225  DGVIRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            D  ++VW      +   +    + GH  Y+S
Sbjct  174  DKTVKVWN-----LSNCKLRSTLAGHTGYVS  199



>ref|XP_011039104.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Populus euphratica]
Length=328

 Score =   328 bits (840),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 174/192 (91%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+ + H +WVSCVRFSPSTLQPTIVS SWD+TVKVWNL+NCKLRSTLAGH+GY
Sbjct  137  GECKYTIQEAESHTDWVSCVRFSPSTLQPTIVSASWDKTVKVWNLTNCKLRSTLAGHSGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG++I+ALCFSPNRYWLCAATE 
Sbjct  197  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVINALCFSPNRYWLCAATEN  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA-AKNKIIFCTSLSWNADGSTLFSGYT  226
            SIKIWDLESK +V DL+VDLK E+E S     TA +  K I+CTSL+W+ADGSTLFSGYT
Sbjct  257  SIKIWDLESKLVVDDLKVDLKAEAEKSEGTTATAVSTKKKIYCTSLNWSADGSTLFSGYT  316

Query  225  DGVIRVWGIGRY  190
            DGVIRVWG+GRY
Sbjct  317  DGVIRVWGVGRY  328


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 61/123 (50%), Gaps = 10/123 (8%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  14   AHTDQVTAIA-TPIDNTDMIVSSSRDKSIILWHLTKDEKTYGVARRRLTGHSHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEG---KKLYSLDAGSIIHALCFSPNRYWLCAATEASIK  394
            S DG    SG  DG + LWDLA G   ++        +  A  F  NR  + A+ + +IK
Sbjct  73   SSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSFD-NRQIVSASRDKTIK  131

Query  393  IWD  385
            +W+
Sbjct  132  LWN  134



>ref|XP_010487724.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Camelina sativa]
Length=326

 Score =   327 bits (838),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI +GDGH EW+SCVRFSP+TL PTIVS SWD TVKVWNL NCKL+++L GHTGY
Sbjct  136  GECKYTISEGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKVWNLQNCKLKNSLVGHTGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE 
Sbjct  196  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATEN  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESK +V DL+VDLK E+E +  G  T  + K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  256  SIKIWDLESKLVVEDLKVDLKAEAEKADGGVGTGNQKKVIYCTSLNWSADGSTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            GV+RVWGIGRY
Sbjct  316  GVVRVWGIGRY  326


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 88/206 (43%), Gaps = 28/206 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+             L +     +EG+      + I C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTISEGD---GHKEWISCVRFSPNTLVPTIVSASWDHTVK  176

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW      ++  +  + ++GH  YL+
Sbjct  177  VWN-----LQNCKLKNSLVGHTGYLN  197


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/189 (28%), Positives = 81/189 (43%), Gaps = 35/189 (19%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  118

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  388
               S  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKVW  178

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKII----FCTSLSWNADGSTLFSGYTDG  220
            +L+                       N   KN ++    +  +++ + DGS   SG  DG
Sbjct  179  NLQ-----------------------NCKLKNSLVGHTGYLNTVAVSPDGSLCASGGKDG  215

Query  219  VIRVWGIGR  193
            VI +W +  
Sbjct  216  VILLWDLAE  224



>emb|CDY64888.1| BnaC06g40840D [Brassica napus]
Length=299

 Score =   325 bits (833),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 174/194 (90%), Gaps = 3/194 (2%)
 Frame = -2

Query  762  GECKYTI---QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGH  592
            GECKYTI   Q GDGH +WVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR+TLAGH
Sbjct  106  GECKYTIGSDQGGDGHKQWVSCVRFSPNTLVPTIVSASWDQTVKVWNLQNCKLRNTLAGH  165

Query  591  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAA  412
            +GY+NTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSL+AG+IIH+LCFSPNRYWLCAA
Sbjct  166  SGYLNTVAVSPDGSLCASGGKDGAILLWDLAEGKKLYSLEAGAIIHSLCFSPNRYWLCAA  225

Query  411  TEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSG  232
            TE SI+IWDLESKS+V DL+VDLK E+EMS     T  K K+I+CTSL+W+ADGSTLFSG
Sbjct  226  TENSIRIWDLESKSVVEDLKVDLKAEAEMSDASVGTGNKTKVIYCTSLNWSADGSTLFSG  285

Query  231  YTDGVIRVWGIGRY  190
            YTDGVIRVWG+GR+
Sbjct  286  YTDGVIRVWGLGRF  299


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 87/206 (42%), Gaps = 30/206 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  31   GHSHFVEDVALSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSTDNR  88

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHA-----LCFSPNRY---WLCAATEASI  397
               S  +DG I LW+ L E K     D G   H      + FSPN      + A+ + ++
Sbjct  89   QIVSASRDGTIKLWNTLGECKYTIGSDQGGDGHKQWVSCVRFSPNTLVPTIVSASWDQTV  148

Query  396  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            K+W+L++      LR  L   S                +  +++ + DGS   SG  DG 
Sbjct  149  KVWNLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGA  189

Query  216  IRVWGIGRY*MEEFRRSHMIIGHVCY  139
            I +W +          +  II  +C+
Sbjct  190  ILLWDLAEGKKLYSLEAGAIIHSLCF  215



>ref|XP_010500401.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Camelina sativa]
Length=326

 Score =   326 bits (835),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI +GDGH++WVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR+TLAGH+GY
Sbjct  136  GECKYTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRNTLAGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGS+IH+LCFSPNRYWLCAATE 
Sbjct  196  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSVIHSLCFSPNRYWLCAATEN  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SI+IWDLESK++V DL+VDLK E+E S        K K+I+CTSL+W+ADG+TLFSGYTD
Sbjct  256  SIRIWDLESKTVVEDLKVDLKVEAEKSDGAVGIGNKTKVIYCTSLNWSADGNTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            G+IRVWGIGRY
Sbjct  316  GIIRVWGIGRY  326


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/206 (23%), Positives = 88/206 (43%), Gaps = 28/206 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+         +  + GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+             L +      EG+     +  + C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTITEGD---GHSDWVSCVRFSPNTLVPTIVSASWDKTVK  176

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW      ++  +  + + GH  YL+
Sbjct  177  VWN-----LQNCKLRNTLAGHSGYLN  197


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNR  118

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAG----SIIHALCFSPNRY---WLCAATEASIK  394
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  119  QIVSASRDRTIKLWNTLGECK--YTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVK  176

Query  393  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  214
            +W+L++      LR  L   S                +  +++ + DGS   SG  DGVI
Sbjct  177  VWNLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVI  217

Query  213  RVWGIGR  193
             +W +  
Sbjct  218  LLWDLAE  224



>gb|KFK39137.1| guanine nucleotide-binding protein subunit beta-like protein 
[Arabis alpina]
Length=327

 Score =   326 bits (835),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 173/192 (90%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTI-QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  586
            GECKYTI + GDGH EW+SCVRFSP+TL PTIVS SWD TVKVWNL NCKLR++LAGH+G
Sbjct  136  GECKYTISEQGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKVWNLQNCKLRNSLAGHSG  195

Query  585  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  406
            Y+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE
Sbjct  196  YLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATE  255

Query  405  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
             SIKIWDLESKS+V DL+VDLK E+E S  G     + K+I+CTSL+W+ADGSTLFSGYT
Sbjct  256  NSIKIWDLESKSVVEDLKVDLKAEAEKSDGGVGMGNQKKVIYCTSLNWSADGSTLFSGYT  315

Query  225  DGVIRVWGIGRY  190
            DGV+RVWGIGRY
Sbjct  316  DGVVRVWGIGRY  327


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 88/206 (43%), Gaps = 27/206 (13%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNL-----SNCKLRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L     S    +  L GH+ +V  V +
Sbjct  13   AHTDQVTAIA-TPIDNSDIIVTASRDKSIILWKLNKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGLTTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+   +            +  +S +G+      + I C   S N    T+ S   D  ++
Sbjct  132  WNTLGEC-----------KYTISEQGD---GHKEWISCVRFSPNTLVPTIVSASWDHTVK  177

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW      ++  +  + + GH  YL+
Sbjct  178  VWN-----LQNCKLRNSLAGHSGYLN  198


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 80/186 (43%), Gaps = 28/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGLTTRRFVGHTKDVLSVAFSVDNR  118

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI---IHALCFSPNRY---WLCAATEASIKI  391
               S  +D  I LW+ L E K   S         I  + FSPN      + A+ + ++K+
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEQGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKV  178

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+L++      LR  L   S                +  +++ + DGS   SG  DGVI 
Sbjct  179  WNLQN----CKLRNSLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVIL  219

Query  210  VWGIGR  193
            +W +  
Sbjct  220  LWDLAE  225



>gb|AAM65407.1| guanine nucleotide-binding protein, putative [Arabidopsis thaliana]
Length=326

 Score =   326 bits (835),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + DGH EWVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR+TLAGH+GY
Sbjct  136  GECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRNTLAGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE 
Sbjct  196  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATEN  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SI+IWDLESKS+V DL+VDLK E+E +        K K+I+CTSL+W+ADG+TLFSGYT 
Sbjct  256  SIRIWDLESKSVVEDLKVDLKAEAEKTDGSTGIGNKTKVIYCTSLNWSADGNTLFSGYTH  315

Query  222  GVIRVWGIGRY  190
            GVIRVWGIGRY
Sbjct  316  GVIRVWGIGRY  326


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 91/208 (44%), Gaps = 32/208 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+         +  + GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPVDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + +            A+G+      + + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISE------------ADGH-----KEWVSCVRFSPNTLVPTIVSASWDKT  174

Query  216  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            ++VW      ++  +  + + GH  YL+
Sbjct  175  VKVWN-----LQNCKLRNTLAGHSGYLN  197


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 81/185 (44%), Gaps = 27/185 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNR  118

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHALC--FSPNRY---WLCAATEASIKIW  388
               S  +D  I LW+ L E K   S   G      C  FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  208
            +L++      LR  L   S                +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  207  WGIGR  193
            W +  
Sbjct  220  WDLAE  224



>ref|XP_006393380.1| hypothetical protein EUTSA_v10011646mg [Eutrema salsugineum]
 gb|ESQ30666.1| hypothetical protein EUTSA_v10011646mg [Eutrema salsugineum]
Length=327

 Score =   325 bits (834),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 173/192 (90%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  586
            GECKYTI D GDGH EWVSCVRFSP+ L PTIVS SWD TVKVWNL NCKL++TLAGH+G
Sbjct  136  GECKYTISDQGDGHKEWVSCVRFSPNMLVPTIVSASWDHTVKVWNLQNCKLKNTLAGHSG  195

Query  585  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  406
            Y+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGS+IH+LCFSPNRYWLCAATE
Sbjct  196  YLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSVIHSLCFSPNRYWLCAATE  255

Query  405  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
            +SI+IWDLESKS+V DL+VDLK E+E S     T  K K+I+CTSL+W+ADG+TLFSGYT
Sbjct  256  SSIRIWDLESKSVVEDLKVDLKAEAEKSDGSAGTGNKTKVIYCTSLNWSADGNTLFSGYT  315

Query  225  DGVIRVWGIGRY  190
            DGVIRVWGIGRY
Sbjct  316  DGVIRVWGIGRY  327


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 49/208 (24%), Positives = 90/208 (43%), Gaps = 31/208 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDIIVTSSRDKSIILWKLTKEDKSYGVAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +   +  ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHSKDVLSVAFSADNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D             +G+      + + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISD-------------QGD---GHKEWVSCVRFSPNMLVPTIVSASWDHT  175

Query  216  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            ++VW      ++  +  + + GH  YL+
Sbjct  176  VKVWN-----LQNCKLKNTLAGHSGYLN  198



>ref|XP_010465892.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Camelina sativa]
Length=326

 Score =   325 bits (834),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI +GDGH EW+SCVRFSP+T  PTIVS SWD TVKVWNL NCKL+++L GHTGY
Sbjct  136  GECKYTISEGDGHKEWISCVRFSPNTHVPTIVSASWDHTVKVWNLQNCKLKNSLVGHTGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE 
Sbjct  196  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATEN  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESK++V DL+VDLK E+E +  G  T  + K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  256  SIKIWDLESKTVVEDLKVDLKAEAEKADGGVGTGNQKKVIYCTSLNWSADGSTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            GV+RVWGIGRY
Sbjct  316  GVVRVWGIGRY  326


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 88/206 (43%), Gaps = 28/206 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDCTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+             L +     +EG+      + I C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTISEGD---GHKEWISCVRFSPNTHVPTIVSASWDHTVK  176

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW      ++  +  + ++GH  YL+
Sbjct  177  VWN-----LQNCKLKNSLVGHTGYLN  197


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/189 (28%), Positives = 82/189 (43%), Gaps = 35/189 (19%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  118

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  388
               S  +D  I LW+ L E K   S   G    I  + FSPN +    + A+ + ++K+W
Sbjct  119  QIVSASRDCTIKLWNTLGECKYTISEGDGHKEWISCVRFSPNTHVPTIVSASWDHTVKVW  178

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKII----FCTSLSWNADGSTLFSGYTDG  220
            +L+                       N   KN ++    +  +++ + DGS   SG  DG
Sbjct  179  NLQ-----------------------NCKLKNSLVGHTGYLNTVAVSPDGSLCASGGKDG  215

Query  219  VIRVWGIGR  193
            VI +W +  
Sbjct  216  VILLWDLAE  224



>ref|XP_006297909.1| hypothetical protein CARUB_v10013951mg, partial [Capsella rubella]
 gb|EOA30807.1| hypothetical protein CARUB_v10013951mg, partial [Capsella rubella]
Length=380

 Score =   327 bits (838),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI +GDGH EW+SCVRFSP+T  PTIVS SWD TVKVWNL NCKL+++L GHTGY
Sbjct  190  GECKYTISEGDGHKEWISCVRFSPNTNVPTIVSASWDHTVKVWNLQNCKLKNSLVGHTGY  249

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE 
Sbjct  250  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATEN  309

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKS+V DL+VDLK E+E +  G  T  + K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  310  SIKIWDLESKSVVEDLKVDLKAEAEKADGGVGTGNQKKVIYCTSLNWSADGSTLFSGYTD  369

Query  222  GVIRVWGIGRY  190
            GV+RVWGIGRY
Sbjct  370  GVVRVWGIGRY  380


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 89/206 (43%), Gaps = 28/206 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +
Sbjct  67   AHTDMVTAIA-TPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  125

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  126  SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  185

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+             L +     +EG+      + I C   S N +  T+ S   D  ++
Sbjct  186  WNT------------LGECKYTISEGD---GHKEWISCVRFSPNTNVPTIVSASWDHTVK  230

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW      ++  +  + ++GH  YL+
Sbjct  231  VWN-----LQNCKLKNSLVGHTGYLN  251


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/189 (28%), Positives = 81/189 (43%), Gaps = 35/189 (19%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  115  GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  172

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNR---YWLCAATEASIKIW  388
               S  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  173  QIVSASRDRTIKLWNTLGECKYTISEGDGHKEWISCVRFSPNTNVPTIVSASWDHTVKVW  232

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKII----FCTSLSWNADGSTLFSGYTDG  220
            +L+                       N   KN ++    +  +++ + DGS   SG  DG
Sbjct  233  NLQ-----------------------NCKLKNSLVGHTGYLNTVAVSPDGSLCASGGKDG  269

Query  219  VIRVWGIGR  193
            VI +W +  
Sbjct  270  VILLWDLAE  278



>sp|Q39336.1|GBLP_BRANA RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Brassica napus]
 emb|CAA83924.1| guanine nucleotide regulatory protein [Brassica napus]
Length=327

 Score =   325 bits (833),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 173/192 (90%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  586
            GECKYTI +G +GH +WVSCVRFSP+TLQPTIVS S D+TVKVWNLSNCKLRSTLAGHTG
Sbjct  136  GECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASCDKTVKVWNLSNCKLRSTLAGHTG  195

Query  585  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  406
            YV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCF+PNRYWLCAATE
Sbjct  196  YVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFTPNRYWLCAATE  255

Query  405  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
              IKIWDLESK++V DL+VDLK E+E S      A K K+I+CTSL+W+ADGSTLFSGYT
Sbjct  256  QGIKIWDLESKTVVEDLKVDLKAEAEKSDGSGTAATKRKVIYCTSLNWSADGSTLFSGYT  315

Query  225  DGVIRVWGIGRY  190
            DGVIRVWGIGRY
Sbjct  316  DGVIRVWGIGRY  327


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/209 (26%), Positives = 87/209 (42%), Gaps = 33/209 (16%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P     TIVS S D+++ VW L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDTIVSASRDKSIIVWKLTKDDKSYGVRQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  400
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  72   SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  128

Query  399  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  220
            IK+W+             L +     +EG         + C   S N    T+ S   D 
Sbjct  129  IKLWNT------------LGECKYTISEGGE--GHRDWVSCVRFSPNTLQPTIVSASCDK  174

Query  219  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
             ++VW      +   +    + GH  Y+S
Sbjct  175  TVKVWN-----LSNCKLRSTLAGHTGYVS  198



>ref|XP_010479287.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Camelina sativa]
Length=326

 Score =   325 bits (832),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI +GDGH++WVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR+TLAGH+GY
Sbjct  136  GECKYTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRNTLAGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGS+IH+LCFSPNRYWLCAATE 
Sbjct  196  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSVIHSLCFSPNRYWLCAATEN  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SI+IWDLESK++V DL+VDLK E+E S        K K+I+CTSL+W+ADG+TLFSGYTD
Sbjct  256  SIRIWDLESKTVVEDLKVDLKVEAEKSDGAVGIGNKTKVIYCTSLNWSADGNTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            G+IRVWGIGR+
Sbjct  316  GIIRVWGIGRF  326


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/206 (23%), Positives = 88/206 (43%), Gaps = 28/206 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+         +  + GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+             L +      EG+     +  + C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTITEGD---GHSDWVSCVRFSPNTLVPTIVSASWDKTVK  176

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW      ++  +  + + GH  YL+
Sbjct  177  VWN-----LQNCKLRNTLAGHSGYLN  197


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNR  118

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAG----SIIHALCFSPNRY---WLCAATEASIK  394
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  119  QIVSASRDRTIKLWNTLGECK--YTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVK  176

Query  393  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  214
            +W+L++      LR  L   S                +  +++ + DGS   SG  DGVI
Sbjct  177  VWNLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVI  217

Query  213  RVWGIGR  193
             +W +  
Sbjct  218  LLWDLAE  224



>ref|XP_010461692.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Camelina sativa]
Length=326

 Score =   325 bits (832),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI +GDGH++WVSCVRFSP+TL PTIVS SWD+TVKVWNL NCKLR+TLAGH+GY
Sbjct  136  GECKYTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRNTLAGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGS+IH+LCFSPNRYWLCAATE 
Sbjct  196  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSVIHSLCFSPNRYWLCAATEN  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SI+IWDLESK +V DL+VDLK E+E S        K K+I+CTSL+W+ADG+TLFSGYTD
Sbjct  256  SIRIWDLESKIVVEDLKVDLKVEAEKSDGAVGIGNKTKVIYCTSLNWSADGNTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            G+IRVWGIGRY
Sbjct  316  GIIRVWGIGRY  326


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/206 (23%), Positives = 88/206 (43%), Gaps = 28/206 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+         +  + GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G+  + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+             L +      EG+     +  + C   S N    T+ S   D  ++
Sbjct  132  WNT------------LGECKYTITEGD---GHSDWVSCVRFSPNTLVPTIVSASWDKTVK  176

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW      ++  +  + + GH  YL+
Sbjct  177  VWN-----LQNCKLRNTLAGHSGYLN  197


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNR  118

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAG----SIIHALCFSPNRY---WLCAATEASIK  394
               S  +D  I LW+ L E K  Y++  G      +  + FSPN      + A+ + ++K
Sbjct  119  QIVSASRDRTIKLWNTLGECK--YTITEGDGHSDWVSCVRFSPNTLVPTIVSASWDKTVK  176

Query  393  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  214
            +W+L++      LR  L   S                +  +++ + DGS   SG  DGVI
Sbjct  177  VWNLQN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGVI  217

Query  213  RVWGIGR  193
             +W +  
Sbjct  218  LLWDLAE  224



>ref|XP_010549078.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Tarenaya hassleriana]
Length=327

 Score =   324 bits (831),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 170/192 (89%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  586
            GECKYTI D  +GH EWVSCVRFSP+TL PTIVS SWD TVKVWNL NCKLR+TL GH+G
Sbjct  136  GECKYTISDQSEGHREWVSCVRFSPNTLVPTIVSASWDHTVKVWNLQNCKLRNTLVGHSG  195

Query  585  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  406
            Y+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG++IH+LCFSPNRYWLCAATE
Sbjct  196  YLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVIHSLCFSPNRYWLCAATE  255

Query  405  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
              IKIWDLESKSIV DL+VDLK E+E S      A K K+I+CTSLSW+ADG+TLFSGYT
Sbjct  256  HGIKIWDLESKSIVEDLKVDLKAEAEKSDGDTGAANKQKVIYCTSLSWSADGNTLFSGYT  315

Query  225  DGVIRVWGIGRY  190
            DG+IRVWGIGRY
Sbjct  316  DGIIRVWGIGRY  327


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/208 (25%), Positives = 90/208 (43%), Gaps = 31/208 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDAVTAIA-TPVDNADFIVSSSRDKSIVLWKLTKDDKSYGVPQRRLTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D            +EG+      + + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISD-----------QSEGH-----REWVSCVRFSPNTLVPTIVSASWDHT  175

Query  216  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            ++VW      ++  +  + ++GH  YL+
Sbjct  176  VKVWN-----LQNCKLRNTLVGHSGYLN  198



>ref|XP_006406649.1| hypothetical protein EUTSA_v10021128mg [Eutrema salsugineum]
 gb|ESQ48102.1| hypothetical protein EUTSA_v10021128mg [Eutrema salsugineum]
Length=327

 Score =   323 bits (829),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 173/192 (90%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTI-QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  586
            GECKYTI + GDGH EW+SCVRFSP+TL PTIVS SWD TVKVWNL NCKL+++LAGH+G
Sbjct  136  GECKYTISEQGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKVWNLQNCKLKNSLAGHSG  195

Query  585  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  406
            Y+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE
Sbjct  196  YLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATE  255

Query  405  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
             SIKIWDLESKS+V DL+VDLK E+E S  G  T  + K+ +CTSL+W+ADGSTLFSGYT
Sbjct  256  NSIKIWDLESKSVVEDLKVDLKAEAEKSDGGVGTGNQKKVNYCTSLNWSADGSTLFSGYT  315

Query  225  DGVIRVWGIGRY  190
            DGV+RVWGIGRY
Sbjct  316  DGVVRVWGIGRY  327


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 89/206 (43%), Gaps = 27/206 (13%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+  +      +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDIIVTASRDKSIILWKLTKDEKSYGYAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+   +            +  +S +G+      + I C   S N    T+ S   D  ++
Sbjct  132  WNTLGEC-----------KYTISEQGD---GHKEWISCVRFSPNTLVPTIVSASWDHTVK  177

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW      ++  +  + + GH  YL+
Sbjct  178  VWN-----LQNCKLKNSLAGHSGYLN  198



>ref|XP_010549077.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Tarenaya hassleriana]
Length=327

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 169/192 (88%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  586
            GECKYTI D  +GH EWVSCVRFSP+ L PTIVS SWD TVKVWNL NCKLR+TL GH+G
Sbjct  136  GECKYTISDQSEGHREWVSCVRFSPNMLVPTIVSASWDHTVKVWNLHNCKLRNTLVGHSG  195

Query  585  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  406
            YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG++IH+LCFSPNRYWLCAATE
Sbjct  196  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVIHSLCFSPNRYWLCAATE  255

Query  405  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
              IKIWDLESKSIV DL+VDLK E+E S      A K K+I+CTSLSW+ADG+TLFSGYT
Sbjct  256  HGIKIWDLESKSIVEDLKVDLKTEAEKSDGDTGAANKQKVIYCTSLSWSADGNTLFSGYT  315

Query  225  DGVIRVWGIGRY  190
            DG+IRVWGIGRY
Sbjct  316  DGIIRVWGIGRY  327


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 84/197 (43%), Gaps = 30/197 (15%)
 Frame = -2

Query  696  SPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGG  532
            +P      IVS S D+++ VW LS         +  L GH+ +V  V +S DG    SG 
Sbjct  23   TPVDNADFIVSSSRDKSIVVWKLSKDDKSYGVPQRRLTGHSHFVQDVVLSSDGQFALSGS  82

Query  531  KDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDL--ESKSIV  364
             DG + LWDLA G   + +      ++       NR  + A+ + +IK+W+   E K  +
Sbjct  83   WDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKLWNTLGECKYTI  142

Query  363  VDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*M  184
             D            +EG+      + + C   S N    T+ S   D  ++VW      +
Sbjct  143  SD-----------QSEGH-----REWVSCVRFSPNMLVPTIVSASWDHTVKVWN-----L  181

Query  183  EEFRRSHMIIGHVCYLS  133
               +  + ++GH  Y++
Sbjct  182  HNCKLRNTLVGHSGYVN  198



>ref|XP_009147950.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein B [Brassica rapa]
Length=328

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 173/193 (90%), Gaps = 2/193 (1%)
 Frame = -2

Query  762  GECKYTI--QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHT  589
            GECKYTI    GDGH +WVSCVRFSP+TL PTIVSGSWD+TVKVWNL NCK+R+TLAGH+
Sbjct  136  GECKYTIGSDHGDGHKQWVSCVRFSPNTLVPTIVSGSWDQTVKVWNLQNCKIRNTLAGHS  195

Query  588  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAAT  409
            GY+NTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSL+AG+IIH+LCFSPNRYWLCAAT
Sbjct  196  GYLNTVAVSPDGSLCASGGKDGAILLWDLAEGKKLYSLEAGAIIHSLCFSPNRYWLCAAT  255

Query  408  EASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGY  229
            E SI+IWDLESKS+V DL+VDLK E+E S     T  K K+I+CTSL+W+ADGSTLFSGY
Sbjct  256  ENSIRIWDLESKSVVEDLKVDLKAEAEKSDASVGTGNKTKVIYCTSLNWSADGSTLFSGY  315

Query  228  TDGVIRVWGIGRY  190
            TDGVIRVWG+GR+
Sbjct  316  TDGVIRVWGLGRF  328


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 87/205 (42%), Gaps = 29/205 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVALSSD--GQFALSGSWDDELRLWDLATGVSTRRFVGHTKDVLSVAFSTDNR  118

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAG----SIIHALCFSPNRY---WLCAATEASIK  394
               S  +DG I LW+ L E K     D G      +  + FSPN      +  + + ++K
Sbjct  119  QIVSASRDGTIKLWNTLGECKYTIGSDHGDGHKQWVSCVRFSPNTLVPTIVSGSWDQTVK  178

Query  393  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  214
            +W+L++  I                   NT A +   +  +++ + DGS   SG  DG I
Sbjct  179  VWNLQNCKI------------------RNTLAGHS-GYLNTVAVSPDGSLCASGGKDGAI  219

Query  213  RVWGIGRY*MEEFRRSHMIIGHVCY  139
             +W +          +  II  +C+
Sbjct  220  LLWDLAEGKKLYSLEAGAIIHSLCF  244


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/206 (23%), Positives = 88/206 (43%), Gaps = 26/206 (13%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P     TIV+ S D+++ +  L+         +  L GH+ +V  VA+
Sbjct  13   AHTDMVTAIA-TPIDSSDTIVTSSRDKSIILXKLTKDDKSYGVAQRRLTGHSHFVEDVAL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  D  + LWDLA G   + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDDELRLWDLATGVSTRRFVGHTKDVLSVAFSTDNRQIVSASRDGTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+                E + +   ++     + + C   S N    T+ SG  D  ++
Sbjct  132  WNTLG-------------ECKYTIGSDHGDGHKQWVSCVRFSPNTLVPTIVSGSWDQTVK  178

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW      ++  +  + + GH  YL+
Sbjct  179  VWN-----LQNCKIRNTLAGHSGYLN  199



>ref|XP_009145001.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Brassica rapa]
Length=327

 Score =   322 bits (826),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 172/192 (90%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  586
            GECKYTI D G+GH +WVSCVRFSP+TL PTIVS SWD TVKVWNL+NCKLR+TLAGH+G
Sbjct  136  GECKYTISDQGEGHKQWVSCVRFSPNTLVPTIVSASWDHTVKVWNLANCKLRNTLAGHSG  195

Query  585  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  406
            Y+NTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE
Sbjct  196  YLNTVAVSPDGSLCASGGKDGAILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATE  255

Query  405  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
             SI+IWDLESKS+V DL+VDLK E+E S     T  K K+I+CTSL+W+ADG+TLFSGYT
Sbjct  256  NSIRIWDLESKSVVEDLKVDLKAEAEKSDVSAATGNKTKVIYCTSLNWSADGNTLFSGYT  315

Query  225  DGVIRVWGIGRY  190
            DGVIRVWGIG Y
Sbjct  316  DGVIRVWGIGHY  327


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 89/208 (43%), Gaps = 31/208 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+  +      +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPVDNSDMIVTSSRDKSIILWKLNRDEKSYGVAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGASTRRFVGHTKDVLSVAFSTDNRQIVSASRDGTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D             EG+      + + C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISD-----------QGEGH-----KQWVSCVRFSPNTLVPTIVSASWDHT  175

Query  216  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            ++VW +        +  + + GH  YL+
Sbjct  176  VKVWNLA-----NCKLRNTLAGHSGYLN  198


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 81/187 (43%), Gaps = 30/187 (16%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGASTRRFVGHTKDVLSVAFSTDNR  118

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAG----SIIHALCFSPNRY---WLCAATEASIK  394
               S  +DG I LW+ L E K   S D G      +  + FSPN      + A+ + ++K
Sbjct  119  QIVSASRDGTIKLWNTLGECKYTIS-DQGEGHKQWVSCVRFSPNTLVPTIVSASWDHTVK  177

Query  393  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  214
            +W+L +      LR  L   S                +  +++ + DGS   SG  DG I
Sbjct  178  VWNLAN----CKLRNTLAGHSG---------------YLNTVAVSPDGSLCASGGKDGAI  218

Query  213  RVWGIGR  193
             +W +  
Sbjct  219  LLWDLAE  225



>ref|XP_004503304.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Cicer arietinum]
Length=317

 Score =   322 bits (825),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 170/191 (89%), Gaps = 9/191 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+TLAGH+GY
Sbjct  136  GECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEG       AGSIIHALCFSPNRYWLCAATE 
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGNY-----AGSIIHALCFSPNRYWLCAATET  250

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIV DL+VDLK E+E  +E      K K+I+CTSL+W+ADGSTLFSGYTD
Sbjct  251  SIKIWDLESKSIVEDLKVDLKAEAESGSE----TTKKKVIYCTSLNWSADGSTLFSGYTD  306

Query  222  GVIRVWGIGRY  190
            GV+RVWGIGRY
Sbjct  307  GVVRVWGIGRY  317



>ref|XP_002885240.1| guanine nucleotide-binding family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH61499.1| guanine nucleotide-binding family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=327

 Score =   322 bits (826),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 172/192 (90%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTI-QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  586
            GECKYTI + GDGH EW+SCVRFSP+TL PTIVS SWD TVKVWNL NCKLR++L GH+G
Sbjct  136  GECKYTISEQGDGHKEWISCVRFSPNTLVPTIVSASWDHTVKVWNLQNCKLRNSLVGHSG  195

Query  585  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  406
            Y+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE
Sbjct  196  YLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATE  255

Query  405  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
             SIKIWDLESKS+V DL+VDLK E+E +  G  T  + K+ +CTSL+W+ADGSTLFSGYT
Sbjct  256  NSIKIWDLESKSVVEDLKVDLKAEAEKTDGGVGTGNQKKVNYCTSLNWSADGSTLFSGYT  315

Query  225  DGVIRVWGIGRY  190
            DGV+RVWGIGRY
Sbjct  316  DGVVRVWGIGRY  327


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 89/206 (43%), Gaps = 27/206 (13%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+   +            +  +S +G+      + I C   S N    T+ S   D  ++
Sbjct  132  WNTLGEC-----------KYTISEQGD---GHKEWISCVRFSPNTLVPTIVSASWDHTVK  177

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW      ++  +  + ++GH  YL+
Sbjct  178  VWN-----LQNCKLRNSLVGHSGYLN  198



>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana
Length=694

 Score =   333 bits (854),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 174/192 (91%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDG-DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  586
            GECKYTI +G +GH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHTG
Sbjct  503  GECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHTG  562

Query  585  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  406
            YV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE
Sbjct  563  YVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATE  622

Query  405  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
              IKIWDLESKSIV DL+VDLK E+E +      A K K+I+CTSL+W+ADGSTLFSGYT
Sbjct  623  HGIKIWDLESKSIVEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSADGSTLFSGYT  682

Query  225  DGVIRVWGIGRY  190
            DGVIRVWGIGRY
Sbjct  683  DGVIRVWGIGRY  694


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 52/209 (25%), Positives = 86/209 (41%), Gaps = 33/209 (16%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IVS S D+++ +W L+         +  L GH+ +V  V +
Sbjct  380  AHTDMVTAIA-TPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLTGHSHFVEDVVL  438

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKL-----YSLDAGSIIHALCFSPNRYWLCAATEAS  400
            S DG    SG  DG + LWDLA G        ++ D  S+  +L    NR  + A+ + +
Sbjct  439  SSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSL---DNRQIVSASRDRT  495

Query  399  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  220
            IK+W+             L +     +EG         + C   S N    T+ S   D 
Sbjct  496  IKLWNT------------LGECKYTISEGGE--GHRDWVSCVRFSPNTLQPTIVSASWDK  541

Query  219  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
             ++VW      +   +    + GH  Y+S
Sbjct  542  TVKVWN-----LSNCKLRSTLAGHTGYVS  565



>ref|XP_009113515.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Brassica rapa]
Length=326

 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + DGH +W+SCVRFSP+TL PTIVS SWD+TVKVWNL NCKL+S+LAGH+GY
Sbjct  136  GECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLKSSLAGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRYWLCAATE+
Sbjct  196  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRYWLCAATES  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKS+V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGSTLFSGYTD
Sbjct  256  SIKIWDLESKSVVDELKVDLKAEAEKCDGGVGTGNQKKVNYCTSLNWSADGSTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            GV+RVWGIGRY
Sbjct  316  GVVRVWGIGRY  326


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 85/185 (46%), Gaps = 27/185 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  SP+      +SGSWD  +++W+L+         GHT YV +VA S    
Sbjct  61   GHSHFVEDVVLSPA--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKYVLSVAFSVANR  118

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  388
              AS  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  119  QIASASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  208
            +L+          + K +S ++             +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQ----------NCKLKSSLAGHSG---------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  207  WGIGR  193
            W +  
Sbjct  220  WDLAE  224


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 89/208 (43%), Gaps = 32/208 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+  +      +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDIIVTSSRDKSIILWKLTKDEKSYGVAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGS-IIHALCFS-PNRYWLCAATEASIKI  391
            SP G    SG  DG + LWDLA G         +  + ++ FS  NR    A+ + +IK+
Sbjct  72   SPAGQFALSGSWDGELRLWDLATGVSTRRFVGHTKYVLSVAFSVANRQIASASRDRTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + +            A+G+        I C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISE------------ADGH-----KDWISCVRFSPNTLVPTIVSASWDKT  174

Query  216  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            ++VW      ++  +    + GH  YL+
Sbjct  175  VKVWN-----LQNCKLKSSLAGHSGYLN  197



>emb|CDY18497.1| BnaA01g26980D [Brassica napus]
Length=326

 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + DGH +W+SCVRFSP+TL PTIVS SWD+TVKVWNL NCKL+S+LAGH+GY
Sbjct  136  GECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLKSSLAGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRYWLCAATE+
Sbjct  196  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRYWLCAATES  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKS+V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGSTLFSGYTD
Sbjct  256  SIKIWDLESKSVVDELKVDLKAEAEKCDGGVGTGNQKKVNYCTSLNWSADGSTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            GV+RVWGIGRY
Sbjct  316  GVVRVWGIGRY  326


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 82/185 (44%), Gaps = 27/185 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  118

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  388
               S  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  208
            +L+          + K +S ++             +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQ----------NCKLKSSLAGHSG---------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  207  WGIGR  193
            W +  
Sbjct  220  WDLAE  224


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 88/208 (42%), Gaps = 32/208 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+  +      +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDIIVTSSRDKSIILWKLTKDEKSYGVAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + +            A+G+        I C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISE------------ADGH-----KDWISCVRFSPNTLVPTIVSASWDKT  174

Query  216  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            ++VW      ++  +    + GH  YL+
Sbjct  175  VKVWN-----LQNCKLKSSLAGHSGYLN  197



>ref|XP_010551145.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Tarenaya hassleriana]
Length=327

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 170/192 (89%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQD-GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  586
            GECKYTI D  +GH EWVSCVRFSP+TL PTIVS SWD TVKVWNL NCKLR+TL GH+G
Sbjct  136  GECKYTISDQSEGHREWVSCVRFSPNTLVPTIVSASWDHTVKVWNLQNCKLRNTLVGHSG  195

Query  585  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  406
            Y+NTVAVSPDGSLCASGGKDG+ILLWDLAEGKKLYSLDAG +IH+LCFSPNRYWLCAATE
Sbjct  196  YLNTVAVSPDGSLCASGGKDGMILLWDLAEGKKLYSLDAGDVIHSLCFSPNRYWLCAATE  255

Query  405  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
             SIKIWDLESKS+V DL+VDLK E+E S      A K K+I+CTSL+W+ADG+TLFSGY+
Sbjct  256  QSIKIWDLESKSVVEDLKVDLKAEAEKSDGDTGAANKQKVIYCTSLNWSADGNTLFSGYS  315

Query  225  DGVIRVWGIGRY  190
            DG+IRVWGIGR+
Sbjct  316  DGIIRVWGIGRF  327


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 49/189 (26%), Positives = 84/189 (44%), Gaps = 30/189 (16%)
 Frame = -2

Query  672  IVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLW  508
            IVS S D+++ +W L+         +  L GH+ +V  VA+S DG    SG  DG + LW
Sbjct  31   IVSSSRDKSIVLWKLTKEDKSYGVPQRRLTGHSHFVQDVALSSDGQFALSGSWDGELRLW  90

Query  507  DLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDL--ESKSIVVDLRVDLK  340
            DLA G   + +      ++       NR  + A+ + +IK+W+   E K  + D      
Sbjct  91   DLATGVSSRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKLWNTLGECKYTISD------  144

Query  339  QESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHM  160
                  +EG+      + + C   S N    T+ S   D  ++VW      ++  +  + 
Sbjct  145  -----QSEGH-----REWVSCVRFSPNTLVPTIVSASWDHTVKVWN-----LQNCKLRNT  189

Query  159  IIGHVCYLS  133
            ++GH  YL+
Sbjct  190  LVGHSGYLN  198



>ref|XP_011000479.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Populus euphratica]
Length=328

 Score =   320 bits (820),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 174/193 (90%), Gaps = 3/193 (2%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+ + H +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCKLRSTLAGH GY
Sbjct  137  GECKYTIQEAESHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRSTLAGHGGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG++I+ALCFSPNRYWLCAATE 
Sbjct  197  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAVINALCFSPNRYWLCAATEN  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEG--NNTAAKNKIIFCTSLSWNADGSTLFSGY  229
            SIKIWDLESK +V DL+VDLK E+E S EG     A+  K I+CTSL+W+ADGSTLFSGY
Sbjct  257  SIKIWDLESKLVVDDLKVDLKAEAEKS-EGTTATAASTTKKIYCTSLNWSADGSTLFSGY  315

Query  228  TDGVIRVWGIGRY  190
            TDGVIRVWGIGRY
Sbjct  316  TDGVIRVWGIGRY  328


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 81/186 (44%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  14   AHTDQVTAIA-TPIDNSDMIVSSSRDKSIILWSLTKDEKTYGVARRRLTGHSHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDKTIKL  132

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  +        QE+E         +    + C   S N    T+ S   D  
Sbjct  133  WNTLGECKYTI--------QEAE---------SHTDWVSCVRFSPNTLQPTIVSASWDKT  175

Query  216  IRVWGI  199
            ++VW +
Sbjct  176  VKVWNL  181



>emb|CDX95554.1| BnaC01g34460D [Brassica napus]
Length=326

 Score =   320 bits (820),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + DGH +W+SCVRFSP+T+ PTIVS SWD+TVKVWNL NCKL+S+LAGH+GY
Sbjct  136  GECKYTISEADGHKDWISCVRFSPNTVVPTIVSASWDKTVKVWNLQNCKLKSSLAGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRYWLCAATE+
Sbjct  196  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRYWLCAATES  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKS+V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGSTLFSGYTD
Sbjct  256  SIKIWDLESKSVVDELKVDLKAEAEKCDGGVGTGNQKKVNYCTSLNWSADGSTLFSGYTD  315

Query  222  GVIRVWGIGRY  190
            GV+RVWGIGRY
Sbjct  316  GVVRVWGIGRY  326


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 82/185 (44%), Gaps = 27/185 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  118

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  388
               S  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPNTVVPTIVSASWDKTVKVW  178

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  208
            +L+          + K +S ++             +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQ----------NCKLKSSLAGHSG---------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  207  WGIGR  193
            W +  
Sbjct  220  WDLAE  224


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 88/208 (42%), Gaps = 32/208 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+  +      +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDIIVTSSRDKSIILWKLTKDEKSYGVAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + +            A+G+        I C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISE------------ADGH-----KDWISCVRFSPNTVVPTIVSASWDKT  174

Query  216  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            ++VW      ++  +    + GH  YL+
Sbjct  175  VKVWN-----LQNCKLKSSLAGHSGYLN  197



>emb|CDY44104.1| BnaA01g13120D [Brassica napus]
 emb|CDX93686.1| BnaA06g03620D [Brassica napus]
 emb|CDX86074.1| BnaC03g55890D [Brassica napus]
Length=298

 Score =   319 bits (817),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 172/193 (89%), Gaps = 2/193 (1%)
 Frame = -2

Query  762  GECKYTI--QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHT  589
            GECKYTI    GDGH +WVSCVRFSP+TL PTIVSGSWD+TVKVWNL NCK+R+TLAGH+
Sbjct  106  GECKYTIGSDHGDGHKQWVSCVRFSPNTLVPTIVSGSWDQTVKVWNLQNCKIRNTLAGHS  165

Query  588  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAAT  409
            GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG+IIH+LCFSPNRYWLCAAT
Sbjct  166  GYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGAIIHSLCFSPNRYWLCAAT  225

Query  408  EASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGY  229
            E SI+IWDLESKS+V DL+VDLK E+E S     T  K K+I CTSL+W+ADGSTLF GY
Sbjct  226  ENSIRIWDLESKSVVEDLKVDLKAEAEKSDASVGTGNKTKVICCTSLNWSADGSTLFGGY  285

Query  228  TDGVIRVWGIGRY  190
            TDGVIRVWG+GR+
Sbjct  286  TDGVIRVWGLGRF  298



>ref|XP_009145932.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Brassica rapa]
Length=325

 Score =   319 bits (817),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + DGH +W+SCVRFSP+TL PTIVS SWD+TVKVWNL NCKL+S+LAGH+GY
Sbjct  136  GECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLKSSLAGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRYWLCAATE+
Sbjct  196  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRYWLCAATES  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESK++V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGSTLFSGYTD
Sbjct  256  SIKIWDLESKTVVDELKVDLKAEAEKDG-GAGTGNQKKVNYCTSLNWSADGSTLFSGYTD  314

Query  222  GVIRVWGIGRY  190
            GV+RVWGIGRY
Sbjct  315  GVVRVWGIGRY  325



>emb|CDX92200.1| BnaA05g22070D [Brassica napus]
Length=325

 Score =   318 bits (816),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + DGH +W+SCVRFSP+TL PTIVS SWD+TVKVWNL NCKL+S+LAGH+GY
Sbjct  136  GECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLKSSLAGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRYWLCAATE+
Sbjct  196  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRYWLCAATES  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESK++V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGSTLFSGYTD
Sbjct  256  SIKIWDLESKTVVDELKVDLKAEAEKDG-GAGTGNQKKVNYCTSLNWSADGSTLFSGYTD  314

Query  222  GVIRVWGIGRY  190
            GV+RVWGIGRY
Sbjct  315  GVVRVWGIGRY  325


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 82/185 (44%), Gaps = 27/185 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  118

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  388
               S  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  208
            +L+          + K +S ++             +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQ----------NCKLKSSLAGHSG---------YLNTVAVSPDGSLCASGGKDGVILL  219

Query  207  WGIGR  193
            W +  
Sbjct  220  WDLAE  224



>emb|CDX95784.1| BnaC05g35350D [Brassica napus]
Length=325

 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + DGH +W+SCVRFSP+TL PTIVS SWD+TVKVWNL NCKL+S+LAGH GY
Sbjct  136  GECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLKSSLAGHLGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRYWLCAATE+
Sbjct  196  LNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRYWLCAATES  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESK++V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGSTLFSGYTD
Sbjct  256  SIKIWDLESKTVVDELKVDLKAEAEKDG-GAGTGNQKKVNYCTSLNWSADGSTLFSGYTD  314

Query  222  GVIRVWGIGRY  190
            GV+RVWGIGRY
Sbjct  315  GVVRVWGIGRY  325


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 83/185 (45%), Gaps = 27/185 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNR  118

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI--IHALCFSPNRY---WLCAATEASIKIW  388
               S  +D  I LW+ L E K   S   G    I  + FSPN      + A+ + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPNTLVPTIVSASWDKTVKVW  178

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  208
            +L+          + K +S ++           + +  +++ + DGS   SG  DGVI +
Sbjct  179  NLQ----------NCKLKSSLAGH---------LGYLNTVAVSPDGSLCASGGKDGVILL  219

Query  207  WGIGR  193
            W +  
Sbjct  220  WDLAE  224


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 88/208 (42%), Gaps = 32/208 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IV+ S D+++ +W L+         +  L GH+ +V  V +
Sbjct  13   AHTDMVTAIA-TPIDNSDIIVTSSRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + +            A+G+        I C   S N    T+ S   D  
Sbjct  132  WNTLGECKYTISE------------ADGH-----KDWISCVRFSPNTLVPTIVSASWDKT  174

Query  216  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            ++VW      ++  +    + GH+ YL+
Sbjct  175  VKVWN-----LQNCKLKSSLAGHLGYLN  197



>ref|XP_002321505.1| GTP-binding protein beta chain [Populus trichocarpa]
 gb|ABK92879.1| unknown [Populus trichocarpa]
 gb|EEF05632.1| GTP-binding protein beta chain [Populus trichocarpa]
Length=328

 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 171/192 (89%), Gaps = 1/192 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+ + H +WVSCVRFSP+TLQPTIVS SWD+TVKVWNL+NCKLRSTLAGH GY
Sbjct  137  GECKYTIQEAESHTDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLTNCKLRSTLAGHGGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG++I+ALCFSPNRYWLCAATE 
Sbjct  197  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAVINALCFSPNRYWLCAATEN  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMS-AEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
            SIKIWDLESK +V DL+VDLK E+E S       A+  K I+CT L+W+ADGSTLFSGYT
Sbjct  257  SIKIWDLESKLVVDDLKVDLKAEAEKSEGTTGTAASTTKKIYCTCLNWSADGSTLFSGYT  316

Query  225  DGVIRVWGIGRY  190
            DGVIRVWGIGRY
Sbjct  317  DGVIRVWGIGRY  328


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 81/186 (44%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H + V+ +  +P      IVS S D+++ +W+L+  +      R  L GH+ +V  V +
Sbjct  14   AHTDQVTAIA-TPIDNSDMIVSSSRDKSIILWSLTKDEKTYGVARRRLTGHSHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDLA G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDGQFALSGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSIDNRQIVSASRDKTIKL  132

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  +        QE+E         +    + C   S N    T+ S   D  
Sbjct  133  WNTLGECKYTI--------QEAE---------SHTDWVSCVRFSPNTLQPTIVSASWDKT  175

Query  216  IRVWGI  199
            ++VW +
Sbjct  176  VKVWNL  181



>ref|XP_011084467.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein [Sesamum indicum]
Length=318

 Score =   316 bits (810),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 171/192 (89%), Gaps = 11/192 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H++WVSCVRFSP+TLQPTIVSGSWDRTVK+WNL+NCKLRSTLAGH+GY
Sbjct  137  GECKYTIQDQDAHSDWVSCVRFSPNTLQPTIVSGSWDRTVKIWNLTNCKLRSTLAGHSGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVI              DAGSII+ALCFSPNRYWLCAATE+
Sbjct  197  VNTVAVSPDGSLCASGGKDGVI----------XXXXDAGSIINALCFSPNRYWLCAATES  246

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYT  226
            SIKIWDLESKS+VVDL+VDLKQESE++ EG   T+ KNK+I+CTSL+W+ADGSTLFSGYT
Sbjct  247  SIKIWDLESKSVVVDLKVDLKQESELATEGTAPTSGKNKVIYCTSLNWSADGSTLFSGYT  306

Query  225  DGVIRVWGIGRY  190
            DGV+RVWGIGRY
Sbjct  307  DGVVRVWGIGRY  318


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 78/186 (42%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
             H +WV+ +  +P      IV+ S D+++ +W L+         R  L GH+ +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIILWALTKEDKTYGVARRRLNGHSHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G   + +      ++       NR  + A+ + +IK+
Sbjct  73   SSDGQFALSGSWDGELRLWDLQTGVTARRFVGHTKDVLSVAFSVDNRQIVSASRDKTIKL  132

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D                   A +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD-----------------QDAHSDWVSCVRFSPNTLQPTIVSGSWDRT  175

Query  216  IRVWGI  199
            +++W +
Sbjct  176  VKIWNL  181



>ref|XP_010256121.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nelumbo nucifera]
Length=314

 Score =   312 bits (800),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 164/191 (86%), Gaps = 12/191 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H  WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLR TLAGH GY
Sbjct  136  GECKYTIQDADSHTNWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNCKLRCTLAGHGGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+IIHALCFSPNRYWLCAAT+ 
Sbjct  196  VNTVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIHALCFSPNRYWLCAATQD  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            S+KIWDLESKSIV DL+ +  Q             KN++++CTSLSW++DGSTLF+GYTD
Sbjct  256  SVKIWDLESKSIVQDLKPEATQ------------GKNQMLYCTSLSWSSDGSTLFTGYTD  303

Query  222  GVIRVWGIGRY  190
            G IRVWGIGRY
Sbjct  304  GSIRVWGIGRY  314


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/186 (27%), Positives = 81/186 (44%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
            GH++ V+ +  +P      IVS S D++V VW+L+  +      R  L GH+ +V  V +
Sbjct  13   GHSDMVTAIA-TPIDNSDMIVSSSRDKSVLVWHLTKEEGIYGVPRRRLTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  D  + LWDL  G         +  + ++ FS  NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDSELRLWDLNTGATTRRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D                   +    + C   S N    T+ SG  D  
Sbjct  132  WNTLGECKYTIQD-----------------ADSHTNWVSCVRFSPNTFQPTIVSGSWDRT  174

Query  216  IRVWGI  199
            ++VW +
Sbjct  175  VKVWNL  180


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 78/184 (42%), Gaps = 27/184 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGSWDSELRLWDLNTGATTRRFVGHTKDVLSVAFSIDNR  118

Query  549  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYW---LCAATEASIKIW  388
               S  +D  I LW+     K    DA S    +  + FSPN +    +  + + ++K+W
Sbjct  119  QIVSASRDRTIKLWNTLGECKYTIQDADSHTNWVSCVRFSPNTFQPTIVSGSWDRTVKVW  178

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  208
            +L           + K    ++  G          +  +++ + DGS   SG  DGV  +
Sbjct  179  NL----------TNCKLRCTLAGHGG---------YVNTVAVSPDGSLCASGGKDGVTLL  219

Query  207  WGIG  196
            W + 
Sbjct  220  WDLA  223



>ref|XP_010243791.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nelumbo nucifera]
Length=314

 Score =   310 bits (794),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 163/191 (85%), Gaps = 12/191 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H  WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLR TL GH GY
Sbjct  136  GECKYTIQDADSHTNWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNCKLRCTLTGHGGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRYWLCAAT+ 
Sbjct  196  VNTVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRYWLCAATQD  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            S+KIWDLESKSIV DL+ +  Q             KN++++CTSLSW++DGSTLF+GYTD
Sbjct  256  SVKIWDLESKSIVQDLKPEATQ------------GKNQMLYCTSLSWSSDGSTLFTGYTD  303

Query  222  GVIRVWGIGRY  190
            G IRVWGIGRY
Sbjct  304  GAIRVWGIGRY  314


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 79/186 (42%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
            GH++ V+ +  +P      IVS S D++V VW+L+  +      R  L GH+ +V  V +
Sbjct  13   GHSDMVTAIA-TPIDNSDMIVSSSRDKSVLVWHLTKEEGTYGVPRRRLTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  D  + LWDL  G   + +      ++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDSELRLWDLNTGVTTRRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D                   +    + C   S N    T+ SG  D  
Sbjct  132  WNTLGECKYTIQD-----------------ADSHTNWVSCVRFSPNTFQPTIVSGSWDRT  174

Query  216  IRVWGI  199
            ++VW +
Sbjct  175  VKVWNL  180



>ref|XP_010916329.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=324

 Score =   309 bits (792),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 164/191 (86%), Gaps = 12/191 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H  WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLRSTL GH GY
Sbjct  146  GECKYTIQDADAHTNWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNCKLRSTLTGHGGY  205

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+II+ALCFSPNRYWLCAAT+ 
Sbjct  206  VNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIYALCFSPNRYWLCAATQD  265

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            S+KIWDLESKSIV     DLK E+  S        KN+I++CTSL+W+ADGSTLF+GYTD
Sbjct  266  SVKIWDLESKSIV----QDLKPETPTS--------KNQILYCTSLNWSADGSTLFTGYTD  313

Query  222  GVIRVWGIGRY  190
            GVIRVWGI RY
Sbjct  314  GVIRVWGISRY  324


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 81/196 (41%), Gaps = 37/196 (19%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL---------------RSTLAG  595
            GH+  V+ +  +P      +VS S D++V VW+L+                   R  L G
Sbjct  13   GHSGAVTAIA-APLDNSDMVVSSSRDKSVLVWHLTKDSPAAAAGEPGGSAYGVPRRRLTG  71

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWL  421
            H+ +V  V +S DG    SG  DG + LWDLA G         +  + ++ FS  NR  +
Sbjct  72   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGATTRRFVGHTKDVLSVAFSVDNRQIV  131

Query  420  CAATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  247
             A+ + +IK+W+   E K  + D                   A    + C   S N    
Sbjct  132  SASRDRTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNTFQP  174

Query  246  TLFSGYTDGVIRVWGI  199
            T+ SG  D  ++VW +
Sbjct  175  TIVSGSWDRTVKVWNL  190


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 79/184 (43%), Gaps = 27/184 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+         GHT  V +VA S D  
Sbjct  71   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGATTRRFVGHTKDVLSVAFSVDNR  128

Query  549  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYW---LCAATEASIKIW  388
               S  +D  I LW+     K    DA +    +  + FSPN +    +  + + ++K+W
Sbjct  129  QIVSASRDRTIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNTFQPTIVSGSWDRTVKVW  188

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  208
            +L           + K  S ++  G          +  +++ + DGS   SG  DGV  +
Sbjct  189  NL----------TNCKLRSTLTGHGG---------YVNAVAVSPDGSLCASGGKDGVTLL  229

Query  207  WGIG  196
            W + 
Sbjct  230  WDLA  233



>ref|XP_006837182.1| hypothetical protein AMTR_s00105p00058690 [Amborella trichopoda]
 gb|ERN00036.1| hypothetical protein AMTR_s00105p00058690 [Amborella trichopoda]
Length=314

 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 159/191 (83%), Gaps = 12/191 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H  WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLR TL GH GY
Sbjct  136  GECKYTIQDQDSHTNWVSCVRFSPNTYQPTIVSGSWDRTVKVWNLTNCKLRCTLTGHAGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VN+VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSL+AG IIHALCFSPNRYWLCAATE 
Sbjct  196  VNSVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLEAGGIIHALCFSPNRYWLCAATEE  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            S+KIWDLESKSIV DL+ D                KN++++CTSLSW+ DGSTLF+GYTD
Sbjct  256  SVKIWDLESKSIVQDLKTDAPTN------------KNQMLYCTSLSWSTDGSTLFTGYTD  303

Query  222  GVIRVWGIGRY  190
            G IRVW +GRY
Sbjct  304  GAIRVWVVGRY  314


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/186 (27%), Positives = 83/186 (45%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
            GH++ V+ +  +P      IVS S D++V +W+L+  +      R  L GH+ +V  V +
Sbjct  13   GHSDMVTAIA-TPVDNSDVIVSSSRDKSVLLWHLTKEEGTYGVPRRRLTGHSHFVQDVVM  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G   + +     +++       NR  + A+ + +IK+
Sbjct  72   SSDGQFALSGSWDGELRLWDLNTGMTTRRFVGHTKNVLSVAFSIDNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D      Q+S               + C   S N    T+ SG  D  
Sbjct  132  WNTLGECKYTIQD------QDSH-----------TNWVSCVRFSPNTYQPTIVSGSWDRT  174

Query  216  IRVWGI  199
            ++VW +
Sbjct  175  VKVWNL  180



>ref|XP_010924141.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=323

 Score =   305 bits (781),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 161/191 (84%), Gaps = 12/191 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H  WVSCVRFSP+  QPTIVS SWDRTVKVWNL+NCKLRSTL GH+GY
Sbjct  145  GECKYTIQDADAHTNWVSCVRFSPNAFQPTIVSASWDRTVKVWNLTNCKLRSTLTGHSGY  204

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRYWLCAAT+ 
Sbjct  205  VNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRYWLCAATQE  264

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            S+KIWDLESKSIV     DLK E+  S        KN++++CTSLSW+ADGSTLF+GYTD
Sbjct  265  SVKIWDLESKSIV----QDLKPETPTS--------KNQMLYCTSLSWSADGSTLFTGYTD  312

Query  222  GVIRVWGIGRY  190
            G IRVW I RY
Sbjct  313  GTIRVWEISRY  323


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/195 (27%), Positives = 83/195 (43%), Gaps = 36/195 (18%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLS-NCKL-------------RSTLAGH  592
            GH++ V+ +  +P      IVS S D+++ VW+L+ +  L             R  L GH
Sbjct  13   GHSDMVTAIA-TPIDNSDMIVSSSRDKSILVWHLTKDAPLSAEGAAASSYGVPRRRLTGH  71

Query  591  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLC  418
            + +V  V +S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + 
Sbjct  72   SHFVEDVVLSSDGQFALSGSWDGELRLWDLNTGTTTRRFVGHTKDVLSVAFSIDNRQIVS  131

Query  417  AATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGST  244
            A+ + +IK+W+   E K  + D                   A    + C   S NA   T
Sbjct  132  ASRDRTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNAFQPT  174

Query  243  LFSGYTDGVIRVWGI  199
            + S   D  ++VW +
Sbjct  175  IVSASWDRTVKVWNL  189



>ref|XP_010430893.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A, partial [Camelina sativa]
Length=284

 Score =   303 bits (777),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 162/182 (89%), Gaps = 2/182 (1%)
 Frame = -2

Query  762  GECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHT  589
            GECKYTI +G  DGH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHT
Sbjct  69   GECKYTISEGGGDGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHT  128

Query  588  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAAT  409
            GYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYS +A S+IHALCFSPNRYWLCAAT
Sbjct  129  GYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSFEANSVIHALCFSPNRYWLCAAT  188

Query  408  EASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGY  229
            E  IKIWDLESK+IV DL+VDLK E+E +      A K K+I+CTSL+W+ADGSTLFSGY
Sbjct  189  EQGIKIWDLESKTIVEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSADGSTLFSGY  248

Query  228  TD  223
            T+
Sbjct  249  TE  250



>ref|XP_009405003.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Musa acuminata subsp. malaccensis]
Length=324

 Score =   304 bits (779),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 163/191 (85%), Gaps = 13/191 (7%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H  WVSCVRFSP+  QPTIVSGSWDRT+KVWNL+NCKLRSTLAGH+GY
Sbjct  147  GECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSGSWDRTIKVWNLTNCKLRSTLAGHSGY  206

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRYWLCAAT+ 
Sbjct  207  VNTVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRYWLCAATQE  266

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            S+KIWDLESK+IV DL+ +             T  KN++++CTSL+W+ADGSTLF+GYTD
Sbjct  267  SVKIWDLESKTIVQDLKPE------------TTTTKNQMLYCTSLTWSADGSTLFTGYTD  314

Query  222  GVIRVWGIGRY  190
            G IRVW I RY
Sbjct  315  GTIRVWEI-RY  324


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/197 (27%), Positives = 82/197 (42%), Gaps = 38/197 (19%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL----------------RSTLA  598
            GH++ V+ +  +P      IVS S D++V VW+L+                    R  L 
Sbjct  13   GHSDMVTAIA-APVDNSDMIVSSSRDKSVLVWHLTKDAPAALADGSGAGSAYGVPRRRLT  71

Query  597  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYW  424
            GH+ +V  V +S DG    SG  DG + LWDL+ G   + +S     ++       NR  
Sbjct  72   GHSHFVEDVVLSSDGQFALSGSWDGDLRLWDLSTGATTRRFSGHTKDVLSVSFSVDNRQI  131

Query  423  LCAATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  250
            + A+ + +IK+W+   E K  + D                   A    + C   S NA  
Sbjct  132  VSASRDRTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNAYQ  174

Query  249  STLFSGYTDGVIRVWGI  199
             T+ SG  D  I+VW +
Sbjct  175  PTIVSGSWDRTIKVWNL  191


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 79/184 (43%), Gaps = 27/184 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+LS        +GHT  V +V+ S D  
Sbjct  72   GHSHFVEDVVLSSD--GQFALSGSWDGDLRLWDLSTGATTRRFSGHTKDVLSVSFSVDNR  129

Query  549  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYW---LCAATEASIKIW  388
               S  +D  I LW+     K    DA +    +  + FSPN Y    +  + + +IK+W
Sbjct  130  QIVSASRDRTIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSGSWDRTIKVW  189

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  208
            +L           + K  S ++             +  +++ + DGS   SG  DGV  +
Sbjct  190  NL----------TNCKLRSTLAGHSG---------YVNTVAVSPDGSLCASGGKDGVTLL  230

Query  207  WGIG  196
            W + 
Sbjct  231  WDLA  234



>emb|CAC09579.1| gbf1 protein [Fagus sylvatica]
Length=267

 Score =   302 bits (773),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 164/183 (90%), Gaps = 1/183 (1%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECK+TIQ+ D H +WVSCVRFSP+T QPTIVS SWD+T+KVW+L+NCK+++TLAGH+GY
Sbjct  83   GECKFTIQEQDAHTDWVSCVRFSPNTTQPTIVSASWDKTIKVWHLTNCKIKNTLAGHSGY  142

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG+IIHALCFSPNRYWLCAATE 
Sbjct  143  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAIIHALCFSPNRYWLCAATEQ  202

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNN-TAAKNKIIFCTSLSWNADGSTLFSGYT  226
            SIKIWDLESKSIV DL+VDLK E+    +     + K K+I+CTSL+W+ADGSTLFSGYT
Sbjct  203  SIKIWDLESKSIVEDLKVDLKTEAADKDDATTINSTKKKVIYCTSLNWSADGSTLFSGYT  262

Query  225  DGV  217
            DGV
Sbjct  263  DGV  265



>ref|XP_010495439.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Camelina sativa]
Length=308

 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 162/182 (89%), Gaps = 2/182 (1%)
 Frame = -2

Query  762  GECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHT  589
            GECKYTI +G  DGH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHT
Sbjct  93   GECKYTISEGGGDGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHT  152

Query  588  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAAT  409
            GYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYS +A S+IHALCFSPNRYWLCAAT
Sbjct  153  GYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSFEANSVIHALCFSPNRYWLCAAT  212

Query  408  EASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGY  229
            E  IKIWDLESK+IV DL+VDL+ E+E +      A K K+I+CTSL+W+ADGSTLFSGY
Sbjct  213  EQGIKIWDLESKTIVEDLKVDLEAEAEKADHRGPAATKRKVIYCTSLNWSADGSTLFSGY  272

Query  228  TD  223
            T+
Sbjct  273  TE  274



>ref|XP_008803271.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Phoenix dactylifera]
Length=323

 Score =   300 bits (768),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 160/191 (84%), Gaps = 12/191 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H  WVSCVRFSP+  QPTIVS SWDRTVKVWNL+NCKLR TL GH GY
Sbjct  145  GECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSASWDRTVKVWNLTNCKLRCTLTGHGGY  204

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRYWLCAAT+ 
Sbjct  205  VNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRYWLCAATQD  264

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            S+KIWDLESKSIV     DLK E+ +S        KN++++CTSLSW+ADGSTLF+GYTD
Sbjct  265  SVKIWDLESKSIV----QDLKPETPIS--------KNQMLYCTSLSWSADGSTLFTGYTD  312

Query  222  GVIRVWGIGRY  190
            G IRVW I RY
Sbjct  313  GTIRVWEITRY  323


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 50/195 (26%), Positives = 81/195 (42%), Gaps = 36/195 (18%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLS-NCKL-------------RSTLAGH  592
            GH++ V+ +  +P      IVS S D+++ VWNL+ +  L             R  L GH
Sbjct  13   GHSDMVTAIA-APIDNSDMIVSSSRDKSILVWNLTKDAPLSAEGAAASSYGVPRRRLTGH  71

Query  591  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLC  418
            + +V  V +S DG    SG  DG + LWDL  G   + +      ++       NR  + 
Sbjct  72   SHFVEDVVLSSDGQFALSGAWDGELRLWDLNTGITTRRFVGHTKDVLSVAFSIDNRQIVS  131

Query  417  AATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGST  244
            A+ + +I++W+   E K  + D                   A    + C   S NA   T
Sbjct  132  ASRDRTIRLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNAYQPT  174

Query  243  LFSGYTDGVIRVWGI  199
            + S   D  ++VW +
Sbjct  175  IVSASWDRTVKVWNL  189



>ref|XP_009400497.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Musa acuminata subsp. malaccensis]
Length=324

 Score =   300 bits (768),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 160/191 (84%), Gaps = 13/191 (7%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H  WVSCVRFSP+  QPTIVS SWDRT+KVWNL+NCKLR TLAGH GY
Sbjct  147  GECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSASWDRTIKVWNLTNCKLRCTLAGHAGY  206

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRYWLCAAT+ 
Sbjct  207  VNTVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRYWLCAATQE  266

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            S+KIWDLESKSIV DL+ +             T  KN++++CTSL+W+ADGSTLF+GYTD
Sbjct  267  SVKIWDLESKSIVQDLKPE------------TTGTKNQMLYCTSLTWSADGSTLFTGYTD  314

Query  222  GVIRVWGIGRY  190
            G IRVW I RY
Sbjct  315  GTIRVWEI-RY  324


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 51/197 (26%), Positives = 80/197 (41%), Gaps = 38/197 (19%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL----------------RSTLA  598
            GH + V+ +  +P      IVS S D++V VW+L+                    +  L 
Sbjct  13   GHTDMVTAIA-APIDNSDMIVSSSRDKSVLVWHLTKDAPSASGDGTATGSSYGVPKRRLT  71

Query  597  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYW  424
            GH+ +V  V +S DG    SG  DG + LWDL+ G   + +S     ++       NR  
Sbjct  72   GHSHFVQDVVLSSDGQFALSGSWDGDLRLWDLSTGVTTRRFSGHTKDVLSVAFSIDNRQI  131

Query  423  LCAATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  250
            + A+ + +IK+W+   E K  + D                   A    + C   S NA  
Sbjct  132  VSASRDRTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNAYQ  174

Query  249  STLFSGYTDGVIRVWGI  199
             T+ S   D  I+VW +
Sbjct  175  PTIVSASWDRTIKVWNL  191


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 80/184 (43%), Gaps = 27/184 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+LS        +GHT  V +VA S D  
Sbjct  72   GHSHFVQDVVLSSD--GQFALSGSWDGDLRLWDLSTGVTTRRFSGHTKDVLSVAFSIDNR  129

Query  549  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYW---LCAATEASIKIW  388
               S  +D  I LW+     K    DA +    +  + FSPN Y    + A+ + +IK+W
Sbjct  130  QIVSASRDRTIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSASWDRTIKVW  189

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  208
            +L +      LR  L   +                +  +++ + DGS   SG  DGV  +
Sbjct  190  NLTN----CKLRCTLAGHAG---------------YVNTVAVSPDGSLCASGGKDGVTLL  230

Query  207  WGIG  196
            W + 
Sbjct  231  WDLA  234



>ref|XP_010923802.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=323

 Score =   300 bits (767),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 160/191 (84%), Gaps = 12/191 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H  WVSCVRFSP+  QPTIVSGSWDRTVKVWNL+NCKLR TL GH GY
Sbjct  145  GECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSGSWDRTVKVWNLTNCKLRCTLTGHGGY  204

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VN VAVSPDGSLCASGGKDG+ LLWDLAEGK+LYSLDAG+II+ALCFSPNRYWLCAAT+ 
Sbjct  205  VNAVAVSPDGSLCASGGKDGITLLWDLAEGKRLYSLDAGAIIYALCFSPNRYWLCAATQD  264

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            S+KIWDLESKSIV     DLK E+  S        KN++++CTSLSW+ADGSTLF+GYTD
Sbjct  265  SVKIWDLESKSIV----QDLKPETPTS--------KNQMLYCTSLSWSADGSTLFTGYTD  312

Query  222  GVIRVWGIGRY  190
            G IRVW + RY
Sbjct  313  GTIRVWEVSRY  323


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/195 (27%), Positives = 80/195 (41%), Gaps = 36/195 (18%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLS-NCKL-------------RSTLAGH  592
            GH + V+ +  +P      IVS S D++V VWNL+ +  L             R  L GH
Sbjct  13   GHTDVVTAIA-TPIDNSDMIVSSSRDKSVLVWNLTKDAPLSSEGAGASSYGVPRRRLTGH  71

Query  591  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLC  418
            + +V  V +S DG    SG  D  + LWDL  G   + +      ++       NR  + 
Sbjct  72   SHFVEDVVLSSDGQFALSGSWDSELRLWDLNTGVTTRRFVGHTKDVLSVAFSVDNRQIVS  131

Query  417  AATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGST  244
            A+ + +IK+W+   E K  + D                   A    + C   S NA   T
Sbjct  132  ASRDRTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNAYQPT  174

Query  243  LFSGYTDGVIRVWGI  199
            + SG  D  ++VW +
Sbjct  175  IVSGSWDRTVKVWNL  189



>gb|AFV60006.1| heterotrimeric guanine nucleotide-binding protein subunit beta 
[Eschscholzia californica]
Length=313

 Score =   298 bits (763),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 160/190 (84%), Gaps = 12/190 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H  WVSCVRFSP+TLQPTIVSG WDRTVKVWNL+NCKLRSTLAGH GY
Sbjct  136  GECKYTIQDADSHTNWVSCVRFSPNTLQPTIVSGFWDRTVKVWNLTNCKLRSTLAGHGGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL AG IIHALCFSPNRYWLCAAT+ 
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLPAGHIIHALCFSPNRYWLCAATQG  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             I+IWDLESKS+V +L+ ++ Q             KNK+ +CTSL+W++DGSTLF+G+TD
Sbjct  256  DIQIWDLESKSLVQELKPEVTQ------------GKNKMFYCTSLNWSSDGSTLFTGFTD  303

Query  222  GVIRVWGIGR  193
            G IRV+ + R
Sbjct  304  GTIRVYAVSR  313


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 82/186 (44%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
            GH++ V+ +  +P      IVS S D+++ VW+L+         R  L GH+ +V  V +
Sbjct  13   GHDDMVTAIA-TPIDNSDMIVSSSRDKSILVWHLTKEDPTYGVPRRRLTGHSHFVQDVVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + SIK+
Sbjct  72   SSDGQFALSGAWDGELRLWDLNTGTTTRRFVGHTKDVLSVAFSIDNRQIVSASRDRSIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D                   +    + C   S N    T+ SG+ D  
Sbjct  132  WNTLGECKYTIQD-----------------ADSHTNWVSCVRFSPNTLQPTIVSGFWDRT  174

Query  216  IRVWGI  199
            ++VW +
Sbjct  175  VKVWNL  180


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 85/203 (42%), Gaps = 31/203 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SG+WD  +++W+L+         GHT  V +VA S D  
Sbjct  61   GHSHFVQDVVLSSD--GQFALSGAWDGELRLWDLNTGTTTRRFVGHTKDVLSVAFSIDNR  118

Query  549  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYWLCAAT---EASIKIW  388
               S  +D  I LW+     K    DA S    +  + FSPN       +   + ++K+W
Sbjct  119  QIVSASRDRSIKLWNTLGECKYTIQDADSHTNWVSCVRFSPNTLQPTIVSGFWDRTVKVW  178

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  208
            +L           + K  S ++  G          +  +++ + DGS   SG  DGVI +
Sbjct  179  NL----------TNCKLRSTLAGHGG---------YVNTVAVSPDGSLCASGGKDGVILL  219

Query  207  WGIGRY*MEEFRRSHMIIGHVCY  139
            W +     E  +   +  GH+ +
Sbjct  220  WDLA----EGKKLYSLPAGHIIH  238



>ref|XP_009380503.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Musa acuminata subsp. malaccensis]
Length=323

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 161/191 (84%), Gaps = 13/191 (7%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H  WVSCVRFSP+  QPTIVSGSWDRTVKVWNL+NCKLR TLAGH G 
Sbjct  146  GECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSGSWDRTVKVWNLTNCKLRCTLAGHAGS  205

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRYWLCAAT+ 
Sbjct  206  VNTVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRYWLCAATQE  265

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            S+KIWDLESKSIV DL+ ++            T  KN++++CTSL+W+A+GSTLF+GYTD
Sbjct  266  SVKIWDLESKSIVQDLKPEI------------TTTKNQMLYCTSLTWSANGSTLFTGYTD  313

Query  222  GVIRVWGIGRY  190
            G IRVW I RY
Sbjct  314  GTIRVWEI-RY  323


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/198 (27%), Positives = 84/198 (42%), Gaps = 41/198 (21%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL---------------RSTLAG  595
            GH + V+ +  +P      IVS S D++V VW+L+                   R  L G
Sbjct  13   GHTDMVTAIA-APIDNSDMIVSSSRDKSVLVWHLTKDAPAASADGSGVGSYGVPRRRLTG  71

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG---KKLYSLDAGSIIHALCFS-PNRY  427
            H+ +V  V +S DG    SG  DG + LWDL+ G   ++ +       + ++ FS  NR 
Sbjct  72   HSHFVQDVVLSSDGQFALSGSWDGDLRLWDLSTGVTTRRFFGHTKD--VLSVAFSIDNRQ  129

Query  426  WLCAATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNAD  253
             + A+ + +IK+W+   E K  + D                   A    + C   S NA 
Sbjct  130  IVSASRDGTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNAY  172

Query  252  GSTLFSGYTDGVIRVWGI  199
              T+ SG  D  ++VW +
Sbjct  173  QPTIVSGSWDRTVKVWNL  190


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 78/184 (42%), Gaps = 27/184 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+LS         GHT  V +VA S D  
Sbjct  71   GHSHFVQDVVLSSD--GQFALSGSWDGDLRLWDLSTGVTTRRFFGHTKDVLSVAFSIDNR  128

Query  549  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSPNRYW---LCAATEASIKIW  388
               S  +DG I LW+     K    DA +    +  + FSPN Y    +  + + ++K+W
Sbjct  129  QIVSASRDGTIKLWNTLGECKYTIQDADAHTNWVSCVRFSPNAYQPTIVSGSWDRTVKVW  188

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  208
            +L +      LR  L       A   NT A +            DGS   SG  DGV  +
Sbjct  189  NLTN----CKLRCTLAGH----AGSVNTVAVSP-----------DGSLCASGGKDGVTLL  229

Query  207  WGIG  196
            W + 
Sbjct  230  WDLA  233



>ref|XP_004252271.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X2 [Solanum lycopersicum]
Length=301

 Score =   295 bits (756),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H++WVSCVRFSP+ LQPTIVSGSWDRTVK+WNLSNCKLR+TLAGHTGY
Sbjct  137  GECKYTIQDQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWNLSNCKLRATLAGHTGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSLD+GSIIHALCFSPNRYWLCAATE+
Sbjct  197  VNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDSGSIIHALCFSPNRYWLCAATES  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSL  268
            SIKIWDLESKSIVVDLRVDLKQE+EMS    +T+  +K  F  S 
Sbjct  257  SIKIWDLESKSIVVDLRVDLKQETEMSGNATSTSGNSKTKFLASF  301


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 82/186 (44%), Gaps = 27/186 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLAGHTGYVNTVAV  565
             H +WV+ +  +P      IV+ S D+++ VW+L+         R  L GH  +V  V +
Sbjct  14   AHTDWVTAIA-TPIDNSDMIVTSSRDKSIIVWSLTKEGSQYGVPRRRLTGHGHFVQDVVL  72

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + A+ + SIK+
Sbjct  73   SSDGMFALSGSWDGELRLWDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKSIKL  132

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D      Q+S            +  + C   S N    T+ SG  D  
Sbjct  133  WNTLGECKYTIQD------QDSH-----------SDWVSCVRFSPNNLQPTIVSGSWDRT  175

Query  216  IRVWGI  199
            +++W +
Sbjct  176  VKIWNL  181



>gb|ABK25010.1| unknown [Picea sitchensis]
 gb|ACN41136.1| unknown [Picea sitchensis]
Length=321

 Score =   294 bits (753),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 159/190 (84%), Gaps = 11/190 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H+ WVSCVRFSPST+ P IVSGSWDRTVKVWNL+NCKLR+TL GH+GY
Sbjct  142  GECKYTIQDADAHSNWVSCVRFSPSTVNPMIVSGSWDRTVKVWNLANCKLRTTLTGHSGY  201

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NT  VSPDGSLCASGGKDGV +LWDLAEGK+LYSLD+G II++LCFSPNRYWLCAAT+ 
Sbjct  202  INTCTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDSGDIINSLCFSPNRYWLCAATQQ  261

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             +KIWDLESKS+V +LR +            N   K ++ FCTSL+W+ADGSTLFSGYTD
Sbjct  262  CVKIWDLESKSVVEELRPNF-----------NPTKKGQVPFCTSLAWSADGSTLFSGYTD  310

Query  222  GVIRVWGIGR  193
            GVIRVWG+GR
Sbjct  311  GVIRVWGVGR  320


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 82/193 (42%), Gaps = 33/193 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----------RSTLAGHTGY  583
            GH+ WV+ +  +P      I+SGS D+++ VW+L+               +  L GH+ +
Sbjct  13   GHDNWVTSIA-TPIDNSDMIISGSRDKSILVWHLTKETTGGEEGGTYGVAKRRLTGHSHF  71

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAAT  409
            ++ V +S DG    SG  D  + LWDL  G   + +   +  ++     + NR  + A+ 
Sbjct  72   IHDVVISSDGQFALSGSWDATLRLWDLNVGITTRRFVGHSKDVLSVAFSADNRQIVSASR  131

Query  408  EASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  235
            + SIK+W+   E K  + D                   A +  + C   S +     + S
Sbjct  132  DRSIKLWNTLGECKYTIQD-----------------ADAHSNWVSCVRFSPSTVNPMIVS  174

Query  234  GYTDGVIRVWGIG  196
            G  D  ++VW + 
Sbjct  175  GSWDRTVKVWNLA  187



>gb|ACN41093.1| unknown [Picea sitchensis]
Length=321

 Score =   294 bits (752),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 158/190 (83%), Gaps = 11/190 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H  WVSCVRFSPST+ P IVSGSWDRTVKVWNL+NCKLR+TL GH+GY
Sbjct  142  GECKYTIQDADAHTNWVSCVRFSPSTVNPMIVSGSWDRTVKVWNLANCKLRTTLTGHSGY  201

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NT  VSPDGSLCASGGKDGV +LWDLAEGK+LYSLD+G II++LCFSPNRYWLCAAT+ 
Sbjct  202  INTCTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDSGDIINSLCFSPNRYWLCAATQQ  261

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             +KIWDLESKS+V +LR +            N   K ++ FCTSL+W+ADGSTLFSGYTD
Sbjct  262  CVKIWDLESKSVVEELRPNF-----------NPTKKGQVPFCTSLAWSADGSTLFSGYTD  310

Query  222  GVIRVWGIGR  193
            GVIRVWG+GR
Sbjct  311  GVIRVWGVGR  320


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 81/193 (42%), Gaps = 33/193 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----------RSTLAGHTGY  583
            GH+ WV+ +  +P      I+SGS D+++ VW+L+               +  L GH+ +
Sbjct  13   GHDNWVTSIA-TPIDNSDMIISGSRDKSILVWHLTKETTGGEEGGTYGVAKRRLTGHSHF  71

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAAT  409
            ++ V +S DG    SG  D  + LWDL  G   + +   +  ++     + NR  + A+ 
Sbjct  72   IHDVVISSDGQFALSGSWDATLRLWDLNVGITTRRFVGHSKDVLSVAFSADNRQIVSASR  131

Query  408  EASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  235
            + SIK+W+   E K  + D                   A    + C   S +     + S
Sbjct  132  DRSIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPSTVNPMIVS  174

Query  234  GYTDGVIRVWGIG  196
            G  D  ++VW + 
Sbjct  175  GSWDRTVKVWNLA  187



>ref|XP_008812615.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Phoenix dactylifera]
Length=331

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 161/199 (81%), Gaps = 20/199 (10%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEW--------VSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRS  607
            GECKYTIQD DGH  W        VSCVRFSP+  QP IVSGSWDRTVKVWNL+NCKLR 
Sbjct  145  GECKYTIQDADGHTNWDADGHTNWVSCVRFSPNAFQPIIVSGSWDRTVKVWNLTNCKLRC  204

Query  606  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  427
            TLAGH GYV+ VAVSPDGSLCASGGKDG+ LLWDLAEGK+LYSLDAG+IIHALCFSPNRY
Sbjct  205  TLAGHGGYVSAVAVSPDGSLCASGGKDGITLLWDLAEGKRLYSLDAGAIIHALCFSPNRY  264

Query  426  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  247
            WLCAAT+ S+KIWDLE+KSIV     DLK E+  S        KN++++CTSLSW+ADGS
Sbjct  265  WLCAATQDSVKIWDLENKSIV----QDLKPETPTS--------KNQMLYCTSLSWSADGS  312

Query  246  TLFSGYTDGVIRVWGIGRY  190
            TLF+GYTDG IRVW + RY
Sbjct  313  TLFTGYTDGTIRVWEVSRY  331


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 86/195 (44%), Gaps = 28/195 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST--------------LAGH  592
            GH++ V+ +  +P      IVS S D+++ VW+L+     ST              L GH
Sbjct  13   GHSDVVTGIA-TPIDNSDMIVSSSRDKSILVWHLTKDAPLSTDGAAASSYGVPRRRLTGH  71

Query  591  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLC  418
            + +V  V +S DG    SG  DG + LWDL  G         +  + ++ FS  NR  + 
Sbjct  72   SHFVEDVVLSSDGQFALSGSWDGELRLWDLNTGATTRRFVGHTKDVLSVAFSVDNRQIVS  131

Query  417  AATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGST  244
            A+ + +IK+W+   E K  +     D    +   A+G+        + C   S NA    
Sbjct  132  ASRDRTIKLWNTLGECKYTI----QDADGHTNWDADGH-----TNWVSCVRFSPNAFQPI  182

Query  243  LFSGYTDGVIRVWGI  199
            + SG  D  ++VW +
Sbjct  183  IVSGSWDRTVKVWNL  197



>gb|ABK26798.1| unknown [Picea sitchensis]
 gb|ACN40746.1| unknown [Picea sitchensis]
 gb|ACN40912.1| unknown [Picea sitchensis]
Length=316

 Score =   288 bits (737),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 155/191 (81%), Gaps = 12/191 (6%)
 Frame = -2

Query  762  GECKYTIQ-DGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  586
            GECKYTIQ D +GH+ W+SCVRFSPS   PTIVS SWDRTVKVWNL+NCKLR+TL GH G
Sbjct  136  GECKYTIQPDAEGHSNWISCVRFSPSATNPTIVSCSWDRTVKVWNLTNCKLRNTLVGHGG  195

Query  585  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  406
            YVNT AVSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG II+ALCFSPNRYWLCAAT+
Sbjct  196  YVNTAAVSPDGSLCASGGKDGVTMLWDLAEGKRLYSLDAGDIIYALCFSPNRYWLCAATQ  255

Query  405  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
              +KIWDLESKSIV DLR D                K +I +CTSLSW+ADGSTLFSGYT
Sbjct  256  QCVKIWDLESKSIVADLRPDFIPNK-----------KAQIPYCTSLSWSADGSTLFSGYT  304

Query  225  DGVIRVWGIGR  193
            DG IRVWGIG 
Sbjct  305  DGKIRVWGIGH  315


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/207 (25%), Positives = 90/207 (43%), Gaps = 27/207 (13%)
 Frame = -2

Query  732  DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVA  568
            +GH + V+ +  +P      IVS S D+++ +WNL+         R  L GH+ +V  V 
Sbjct  12   EGHTDAVTAIA-TPIDNSDMIVSSSRDKSILLWNLTKEPEKYGVPRRRLTGHSHFVQDVV  70

Query  567  VSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIK  394
            +S DG    SG  D  + LWDL  G   + +      ++       NR  + A+ + +IK
Sbjct  71   ISSDGQFALSGSWDSELRLWDLNTGLTTRRFVGHTKDVLSVAFSIDNRQIVSASRDRTIK  130

Query  393  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  214
            +W+            + K   +  AEG+     +  I C   S +A   T+ S   D  +
Sbjct  131  LWNTLG---------ECKYTIQPDAEGH-----SNWISCVRFSPSATNPTIVSCSWDRTV  176

Query  213  RVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            +VW      +   +  + ++GH  Y++
Sbjct  177  KVWN-----LTNCKLRNTLVGHGGYVN  198



>ref|NP_001136800.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
 gb|ACF82664.1| unknown [Zea mays]
 gb|ACG34796.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
 gb|AFW81011.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
Length=334

 Score =   286 bits (731),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 159/195 (82%), Gaps = 16/195 (8%)
 Frame = -2

Query  762  GECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAG  595
            GECKYTI    G    HN WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLR TL G
Sbjct  148  GECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNCKLRCTLDG  207

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCA  415
            H GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFSPNRYWLCA
Sbjct  208  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFSPNRYWLCA  267

Query  414  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  235
            AT+ S+KIWDLESK +V DL+ D++             +KN+I++CTSLSW+ADGSTL++
Sbjct  268  ATQDSVKIWDLESKHVVQDLKPDIQ------------VSKNQILYCTSLSWSADGSTLYT  315

Query  234  GYTDGVIRVWGIGRY  190
            GYTDG IRVW I  Y
Sbjct  316  GYTDGSIRVWKISGY  330


 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 52/194 (27%), Positives = 83/194 (43%), Gaps = 30/194 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST---------------LAG  595
            GHN  V+ +  +P    P IVS S D++V VW+L+N  + ST               L G
Sbjct  16   GHNGEVTAIA-TPIDNSPFIVSSSRDKSVLVWDLTN-PVHSTPESGVTADYGVPFRRLTG  73

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWL  421
            H+ +V  V +S DG    SG  DG + LWDL+ G   + +      +I       NR  +
Sbjct  74   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHEKDVISVAFSVDNRQIV  133

Query  420  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTL  241
             A+ + +IK+W+   +            +  +  +       N  + C   S N    T+
Sbjct  134  SASRDKTIKLWNTLGEC-----------KYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTI  182

Query  240  FSGYTDGVIRVWGI  199
             SG  D  ++VW +
Sbjct  183  VSGSWDRTVKVWNL  196



>ref|NP_001146976.1| LOC100280585 [Zea mays]
 gb|ACG24854.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
 gb|AFW79043.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
Length=334

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 159/195 (82%), Gaps = 16/195 (8%)
 Frame = -2

Query  762  GECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAG  595
            GECKYTI    G    HN WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLR TL G
Sbjct  148  GECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNCKLRCTLDG  207

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCA  415
            H GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFSPNRYWLCA
Sbjct  208  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFSPNRYWLCA  267

Query  414  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  235
            AT+ S+KIWDLESK +V DL+ D++             +KN+I++CTSLSW+ADGSTL++
Sbjct  268  ATQDSVKIWDLESKHVVQDLKPDIQ------------ISKNQILYCTSLSWSADGSTLYT  315

Query  234  GYTDGVIRVWGIGRY  190
            GYTDG IRVW I  Y
Sbjct  316  GYTDGSIRVWKISGY  330


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 83/194 (43%), Gaps = 30/194 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST---------------LAG  595
            GHN  V+ +  +P    P IVS S D+++ VW+L+N  + ST               L G
Sbjct  16   GHNGEVTAIA-TPIDNSPFIVSSSRDKSLLVWDLTN-PVHSTPESGATADYGVPFRRLTG  73

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWL  421
            H+ +V  V +S DG    SG  DG + LWDL+ G   + +      ++       NR  +
Sbjct  74   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHEKDVLSVAFSVDNRQIV  133

Query  420  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTL  241
             A+ + +IK+W+   +            +  +  +       N  + C   S N    T+
Sbjct  134  SASRDKTIKLWNTLGEC-----------KYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTI  182

Query  240  FSGYTDGVIRVWGI  199
             SG  D  ++VW +
Sbjct  183  VSGSWDRTVKVWNL  196



>gb|ACL54313.1| unknown [Zea mays]
Length=334

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 159/195 (82%), Gaps = 16/195 (8%)
 Frame = -2

Query  762  GECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAG  595
            GECKYTI    G    HN WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLR TL G
Sbjct  148  GECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNCKLRCTLDG  207

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCA  415
            H GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFSPNRYWLCA
Sbjct  208  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFSPNRYWLCA  267

Query  414  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  235
            AT+ S+KIWDLESK +V DL+ D++             +KN+I++CTSLSW+ADGSTL++
Sbjct  268  ATQDSVKIWDLESKHVVQDLKPDIQ------------ISKNQILYCTSLSWSADGSTLYT  315

Query  234  GYTDGVIRVWGIGRY  190
            GYTDG IRVW I  Y
Sbjct  316  GYTDGSIRVWKISGY  330


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 83/194 (43%), Gaps = 30/194 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST---------------LAG  595
            GHN  V+ +  +P    P IVS S D+++ VW+L+N  + ST               L G
Sbjct  16   GHNGEVTTIA-TPIDNSPFIVSSSRDKSLLVWDLTN-PVHSTPESGATADYGVPFRRLTG  73

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWL  421
            H+ +V  V +S DG    SG  DG + LWDL+ G   + +      ++       NR  +
Sbjct  74   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHEKDVLSVAFSVDNRQIV  133

Query  420  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTL  241
             A+ + +IK+W+   +            +  +  +       N  + C   S N    T+
Sbjct  134  SASRDKTIKLWNTLGEC-----------KYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTI  182

Query  240  FSGYTDGVIRVWGI  199
             SG  D  ++VW +
Sbjct  183  VSGSWDRTVKVWNL  196



>ref|XP_002440202.1| hypothetical protein SORBIDRAFT_09g027690 [Sorghum bicolor]
 gb|EES18632.1| hypothetical protein SORBIDRAFT_09g027690 [Sorghum bicolor]
Length=334

 Score =   285 bits (728),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 159/195 (82%), Gaps = 16/195 (8%)
 Frame = -2

Query  762  GECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAG  595
            GECKYTI    G    HN WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLR TL G
Sbjct  148  GECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNCKLRCTLDG  207

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCA  415
            H GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFSPNRYWLCA
Sbjct  208  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFSPNRYWLCA  267

Query  414  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  235
            AT+ S+KIWDLESK +V DL+ D++             +KN+I++C+SLSW+ADGSTL++
Sbjct  268  ATQDSVKIWDLESKHVVQDLKPDIQ------------ISKNQILYCSSLSWSADGSTLYT  315

Query  234  GYTDGVIRVWGIGRY  190
            GYTDG IRVW I  Y
Sbjct  316  GYTDGSIRVWKISAY  330


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 83/194 (43%), Gaps = 30/194 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST---------------LAG  595
             HN  V+ +  +P    P IVS S D++V +W+L N  + ST               L G
Sbjct  16   AHNGEVTAIA-TPIDNSPFIVSASRDKSVLLWDLEN-PVHSTPESGVTADYGVPKRRLTG  73

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-DAGSIIHALCFS-PNRYWL  421
            H+ +V  V +S DG    SG  DG + LWDL+ G         G  I ++ FS  NR  +
Sbjct  74   HSHFVQDVVLSSDGMFALSGSWDGELRLWDLSTGATTRRFVGHGKDILSVAFSVDNRQII  133

Query  420  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTL  241
             A+ + +IK+W+   +            +  +  +       N  + C   S N    T+
Sbjct  134  SASRDKTIKLWNTLGEC-----------KYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTI  182

Query  240  FSGYTDGVIRVWGI  199
             SG  D  ++VW +
Sbjct  183  VSGSWDRTVKVWNL  196



>ref|XP_001780288.1| predicted protein [Physcomitrella patens]
 gb|EDQ54847.1| predicted protein [Physcomitrella patens]
Length=316

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 154/190 (81%), Gaps = 10/190 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD DGH  WVSCVRFSP T  P IVSG WD+ VKVWNL+NCK+R+ L GHTGY
Sbjct  136  GECKYTIQDVDGHTGWVSCVRFSPVTANPIIVSGGWDKVVKVWNLTNCKIRTNLVGHTGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG IIH+LCFSPNRYWLCAAT++
Sbjct  196  VNTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDIIHSLCFSPNRYWLCAATQS  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLESKS+V +LR +    S+          K ++ +C SL+W+ADGSTLFSGYTD
Sbjct  256  CIKIWDLESKSVVDELRPEFTFVSK----------KAQVPYCVSLNWSADGSTLFSGYTD  305

Query  222  GVIRVWGIGR  193
            G IRVW +GR
Sbjct  306  GHIRVWAVGR  315


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 59/122 (48%), Gaps = 8/122 (7%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
            GH+ WV+ +   P      I+S S D+++ VW L+  +      R  L GH  +V  V +
Sbjct  13   GHSNWVTAIA-CPLDNPDLILSSSRDKSIIVWTLTREEGNYGVARRRLTGHAHFVQDVVI  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLNTGTTTRRFIGHTKDVLSVAFSVDNRQIVSGSRDKTIKL  131

Query  390  WD  385
            W+
Sbjct  132  WN  133



>ref|XP_002945887.1| hypothetical protein VOLCADRAFT_78914 [Volvox carteri f. nagariensis]
 gb|EFJ52882.1| hypothetical protein VOLCADRAFT_78914 [Volvox carteri f. nagariensis]
Length=318

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 156/188 (83%), Gaps = 10/188 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + +GH EWVSCVRFSP+T+ P IVSG WD+ VKVWNL+NCKL++ L GHTGY
Sbjct  137  GECKYTIGEPEGHTEWVSCVRFSPTTVNPIIVSGGWDKMVKVWNLTNCKLKNNLVGHTGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG +IH LCFSPNRYWLCAAT++
Sbjct  197  VNTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDVIHCLCFSPNRYWLCAATQS  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            +IKIWDLESKS+V DL+V          E N T+ K ++ +C SL+W+ADGSTL+SGYTD
Sbjct  257  TIKIWDLESKSVVDDLKV----------EFNITSKKAQVPYCVSLAWSADGSTLYSGYTD  306

Query  222  GVIRVWGI  199
            G IRVW +
Sbjct  307  GQIRVWAV  314


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 58/122 (48%), Gaps = 7/122 (6%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
            GH  WV+ +         T++S S D+TV VW L   +      +  L GH+ +V  V +
Sbjct  13   GHTNWVTAIATPLDPSSNTLLSASRDKTVLVWELERSESNYGYAKKALRGHSHFVQDVVI  72

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG  C +G  DG + LWDL  G   + +      ++     + NR  +  A + +IK+
Sbjct  73   SSDGQFCLTGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFSADNRQIVSGARDKTIKL  132

Query  390  WD  385
            W+
Sbjct  133  WN  134



>ref|XP_008811978.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein A [Phoenix dactylifera]
Length=316

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 152/191 (80%), Gaps = 20/191 (10%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H  WVSCVRFSP+  QPTIVSGSWDRTVKVWNL+NCKLRSTL GH GY
Sbjct  146  GECKYTIQDADAHTNWVSCVRFSPNNFQPTIVSGSWDRTVKVWNLTNCKLRSTLTGHGGY  205

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VN VAVSPDGSLCASGGKDGV LLWDLAE K     D G   H+LCFSPNRYWLCAAT+ 
Sbjct  206  VNAVAVSPDGSLCASGGKDGVTLLWDLAEEK-----DXG---HSLCFSPNRYWLCAATQD  257

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            S+KIWDLESKSIV DLR +               +KN+I++CTSLSW+ADGSTLF+GYTD
Sbjct  258  SVKIWDLESKSIVQDLRPE------------TPTSKNQILYCTSLSWSADGSTLFTGYTD  305

Query  222  GVIRVWGIGRY  190
            GVIRVWGI RY
Sbjct  306  GVIRVWGISRY  316


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 81/196 (41%), Gaps = 37/196 (19%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL---------------RSTLAG  595
            GH+  V+ +  +P      IVS S D++V VW+L+                   R  L G
Sbjct  13   GHSGPVTAIA-APLDNSDMIVSSSRDKSVLVWHLTKDSPAAAAGEPGGAAYGIPRRRLTG  71

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWL  421
            H+ +V  V +S DG    SG  DG + LWDLA G         +  + ++ FS  NR  +
Sbjct  72   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGATTRRFVGHTKDVLSVAFSIDNRQIV  131

Query  420  CAATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  247
             A+ + +IK+W+   E K  + D                   A    + C   S N    
Sbjct  132  SASRDRTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPNNFQP  174

Query  246  TLFSGYTDGVIRVWGI  199
            T+ SG  D  ++VW +
Sbjct  175  TIVSGSWDRTVKVWNL  190



>ref|XP_001779496.1| predicted protein [Physcomitrella patens]
 gb|EDQ55672.1| predicted protein [Physcomitrella patens]
Length=316

 Score =   281 bits (719),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 153/190 (81%), Gaps = 10/190 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H  WVSCVRFSP T  P IVSG WD+ VKVWNL+NCK+RS L GHTGY
Sbjct  136  GECKYTIQDVDAHTGWVSCVRFSPVTANPIIVSGGWDKVVKVWNLTNCKIRSNLVGHTGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTV VSPDGSLCASGGKDGV +LWDL+EGK+LYSLDAG IIH+LCFSPNRYWLCAAT++
Sbjct  196  VNTVTVSPDGSLCASGGKDGVAMLWDLSEGKRLYSLDAGDIIHSLCFSPNRYWLCAATQS  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLESKSIV +LR +    S+          K +I +C SL+W+ADGSTLFSGYTD
Sbjct  256  CIKIWDLESKSIVDELRPEFTFVSK----------KAQIPYCVSLNWSADGSTLFSGYTD  305

Query  222  GVIRVWGIGR  193
            G IRVW +GR
Sbjct  306  GHIRVWAVGR  315


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 86/208 (41%), Gaps = 32/208 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
            GH+ WV+ +   P      I+S S D+++ VW L+  +      R  L GH  +V  V +
Sbjct  13   GHSNWVTAIA-CPLDNPDLILSSSRDKSIIVWTLTREEGNYGVARRRLTGHAHFVQDVVI  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLNTGTTTRRFIGHTKDVLSVAFSVDNRQIVSGSRDKTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D+                  A    + C   S       + SG  D V
Sbjct  132  WNTLGECKYTIQDVD-----------------AHTGWVSCVRFSPVTANPIIVSGGWDKV  174

Query  216  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            ++VW      +   +    ++GH  Y++
Sbjct  175  VKVWN-----LTNCKIRSNLVGHTGYVN  197



>ref|XP_001754916.1| predicted protein [Physcomitrella patens]
 gb|EDQ80370.1| predicted protein [Physcomitrella patens]
Length=316

 Score =   281 bits (718),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 152/190 (80%), Gaps = 10/190 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H  WVSCVRFSP T  P IVSG WD+ VKVWNL+NCK+R+ L GHTGY
Sbjct  136  GECKYTIQDVDAHTGWVSCVRFSPVTANPIIVSGGWDKVVKVWNLTNCKIRTNLVGHTGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG IIH+LCFSPNRYWLCAAT+ 
Sbjct  196  VNTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDIIHSLCFSPNRYWLCAATQT  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLESKS+V +LR +    S+          K +I +C SL+W+ADGSTLFSGYTD
Sbjct  256  CIKIWDLESKSVVDELRPEFTFVSK----------KAQIPYCVSLNWSADGSTLFSGYTD  305

Query  222  GVIRVWGIGR  193
            G IRVW +GR
Sbjct  306  GHIRVWAVGR  315


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 86/208 (41%), Gaps = 32/208 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
            GH  WV+ +   P      I+S S D+++ VW+LS  +      R  L GH  +V  V +
Sbjct  13   GHANWVTAIA-CPLDNPDLILSSSRDKSIIVWHLSREEGNYGVARRRLTGHAHFVQDVVI  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLNTGTTTRRFIGHTKDVLSVAFSVDNRQIVSGSRDKTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D+                  A    + C   S       + SG  D V
Sbjct  132  WNTLGECKYTIQDVD-----------------AHTGWVSCVRFSPVTANPIIVSGGWDKV  174

Query  216  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            ++VW      +   +    ++GH  Y++
Sbjct  175  VKVWN-----LTNCKIRTNLVGHTGYVN  197



>ref|XP_001698065.1| receptor of activated protein kinase C 1 [Chlamydomonas reinhardtii]
 sp|P25387.1|GBLP_CHLRE RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Chlamydomonas reinhardtii]
 emb|CAA37638.1| putative protein has homology to G protein beta subunit [Chlamydomonas 
reinhardtii]
 gb|EDO99650.1| receptor of activated protein kinase C 1 [Chlamydomonas reinhardtii]
Length=318

 Score =   281 bits (718),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 153/190 (81%), Gaps = 10/190 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + +GH EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCKL++ L GH GY
Sbjct  137  GECKYTIGEPEGHTEWVSCVRFSPMTTNPIIVSGGWDKMVKVWNLTNCKLKNNLVGHHGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTV VSPDGSLCASGGKDG+ +LWDLAEGK+LYSLDAG +IH LCFSPNRYWLCAAT++
Sbjct  197  VNTVTVSPDGSLCASGGKDGIAMLWDLAEGKRLYSLDAGDVIHCLCFSPNRYWLCAATQS  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKSIV DLR           E N T+ K ++ +C SL+W+ADGSTL+SGYTD
Sbjct  257  SIKIWDLESKSIVDDLR----------PEFNITSKKAQVPYCVSLAWSADGSTLYSGYTD  306

Query  222  GVIRVWGIGR  193
            G IRVW +G 
Sbjct  307  GQIRVWAVGH  316


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 59/122 (48%), Gaps = 7/122 (6%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
            GH  WV+ +         T++S S D++V VW L   +      R  L GH+ +V  V +
Sbjct  13   GHTNWVTAIATPLDPSSNTLLSASRDKSVLVWELERSESNYGYARKALRGHSHFVQDVVI  72

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG  C +G  DG + LWDL  G         +  + ++ FS  NR  +  + + +IK+
Sbjct  73   SSDGQFCLTGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKL  132

Query  390  WD  385
            W+
Sbjct  133  WN  134



>gb|ACJ85349.1| unknown [Medicago truncatula]
Length=285

 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQDGD H++WVSCVRFSPSTLQPTIVS SWDRTVKVWNL+NCKLR+TLAGH+GY
Sbjct  136  GECKYTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLTNCKLRNTLAGHSGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE+
Sbjct  196  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATES  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESE  328
            SIKIWDLESKSIV DL+VDLK E++
Sbjct  256  SIKIWDLESKSIVEDLKVDLKTEAD  280



>ref|XP_004969582.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A-like [Setaria italica]
Length=334

 Score =   281 bits (718),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 159/195 (82%), Gaps = 16/195 (8%)
 Frame = -2

Query  762  GECKYTIQD----GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAG  595
            GECKYTI       +GH+ WVSCVRFSP+T+QPTIVSGSWDR+VKVWNL+NCKLRS L G
Sbjct  148  GECKYTIGGDHGASEGHSGWVSCVRFSPNTIQPTIVSGSWDRSVKVWNLTNCKLRSNLQG  207

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCA  415
            H GYVN VAVSPDGSLCASGGKD V LLWDL EGK+LY+LDAGSIIH+LCFSPNRYWLCA
Sbjct  208  HGGYVNAVAVSPDGSLCASGGKDNVTLLWDLTEGKRLYALDAGSIIHSLCFSPNRYWLCA  267

Query  414  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  235
            AT+ SIKIWDLESK IV DLR ++            +A KN+I++CTSLSW+ADGSTL++
Sbjct  268  ATQDSIKIWDLESKHIVQDLRPEV------------SAGKNQILYCTSLSWSADGSTLYA  315

Query  234  GYTDGVIRVWGIGRY  190
            GYTDG IR++ I  +
Sbjct  316  GYTDGTIRIFKISGF  330


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 86/196 (44%), Gaps = 34/196 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN---------------CKLRSTLAG  595
            GHN+ V+ +  +P    P IVS S D+++ VW+L+N                  R  L G
Sbjct  16   GHNDVVTAIA-APIDNSPFIVSSSRDKSLLVWDLTNPVHVAGDGTTTADYGVPFRR-LTG  73

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWL  421
            H+ +V  V +S DG    SG  DG + LWDL+ G   + +      ++       NR  +
Sbjct  74   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHEKDVLSVAFSIDNRQIV  133

Query  420  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI--IFCTSLSWNADGS  247
             A+ + +IK+W+                E + +  G++ A++     + C   S N    
Sbjct  134  SASRDKTIKLWNTLG-------------ECKYTIGGDHGASEGHSGWVSCVRFSPNTIQP  180

Query  246  TLFSGYTDGVIRVWGI  199
            T+ SG  D  ++VW +
Sbjct  181  TIVSGSWDRSVKVWNL  196



>ref|XP_006644561.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein A-like [Oryza brachyantha]
Length=334

 Score =   278 bits (712),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 157/195 (81%), Gaps = 16/195 (8%)
 Frame = -2

Query  762  GECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAG  595
            GECKYTI    G    HN WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLR  L G
Sbjct  148  GECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNCKLRCNLEG  207

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCA  415
            H GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFSPNRYWLCA
Sbjct  208  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFSPNRYWLCA  267

Query  414  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  235
            AT+ SIKIWDLESK IV DL+ ++              +KN++++CTSL+W+ADGSTL++
Sbjct  268  ATQDSIKIWDLESKHIVQDLKPEIP------------VSKNQMLYCTSLNWSADGSTLYA  315

Query  234  GYTDGVIRVWGIGRY  190
            GYTDG IR++ I  +
Sbjct  316  GYTDGTIRIYKISGF  330


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/196 (26%), Positives = 85/196 (43%), Gaps = 34/196 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN---------------CKLRSTLAG  595
            GHN+ V+ +  +P    P IVS S D+++ VW+L+N                  R  L G
Sbjct  16   GHNDVVTAIA-TPIDNSPFIVSSSRDKSLLVWDLTNPVPVVGETASATEYGVPFRR-LTG  73

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG---KKLYSLDAGSIIHALCFS-PNRY  427
            H+ +V  V +S +     SG  DG + LWDL+ G   ++    D    + ++ FS  NR 
Sbjct  74   HSHFVQDVVLSSNDQFTLSGSXDGELRLWDLSTGATTRRFVGHDKD--VLSVAFSVDNRQ  131

Query  426  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  247
             + A+ + +IK+W+   +            +  +  +       N  + C   S N    
Sbjct  132  IVSASRDRTIKLWNTLGEC-----------KYTIGGDLGGGEGHNGWVSCVRFSPNTFQP  180

Query  246  TLFSGYTDGVIRVWGI  199
            T+ SG  D  ++VW +
Sbjct  181  TIVSGSWDRTVKVWNL  196



>ref|XP_005847990.1| hypothetical protein CHLNCDRAFT_31033 [Chlorella variabilis]
 gb|EFN55888.1| hypothetical protein CHLNCDRAFT_31033 [Chlorella variabilis]
Length=319

 Score =   277 bits (709),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 153/190 (81%), Gaps = 10/190 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + DGH EWVSCVRFSP T  P IVS  WD+ VKVWNL+NCKLR+ L GH GY
Sbjct  138  GECKYTIGEPDGHTEWVSCVRFSPVTQNPIIVSAGWDKAVKVWNLTNCKLRNNLVGHQGY  197

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTV VSPDGSLCASGGKDGV +LWDL+EGK+LYSLDA  IIH+LCFSPNRYWLCAAT+ 
Sbjct  198  VNTVTVSPDGSLCASGGKDGVAMLWDLSEGKRLYSLDATDIIHSLCFSPNRYWLCAATQG  257

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKS+V +LR +L + S+          K ++ +C  L+W+ADGSTL+SGYTD
Sbjct  258  SIKIWDLESKSLVDELRPELPERSK----------KAQVPYCVCLAWSADGSTLYSGYTD  307

Query  222  GVIRVWGIGR  193
            G+IRVW +GR
Sbjct  308  GLIRVWQVGR  317


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 60/123 (49%), Gaps = 8/123 (7%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK------LRSTLAGHTGYVNTVA  568
            GH  WV+ +         T++S S D+TV VW L N +       +  L GH+ YV  V 
Sbjct  13   GHRGWVTAIAAPLDPTSETLLSSSRDKTVLVWQLGNAEDGSLGYPKRALRGHSHYVQDVV  72

Query  567  VSPDGSLCASGGKDGVILLWDLAEGKKLYS-LDAGSIIHALCFSP-NRYWLCAATEASIK  394
            +S DG  C +G  DG + LWD+  G      L     + ++ FS  NR  +  + + +IK
Sbjct  73   ISSDGQFCLTGSWDGTLRLWDINTGATTRRFLGHTKDVLSVAFSADNRQIVSGSRDKTIK  132

Query  393  IWD  385
            +W+
Sbjct  133  LWN  135


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 81/198 (41%), Gaps = 35/198 (18%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G   Y  +   GH+ +V  V  S        ++GSWD T+++W+++         GHT  
Sbjct  52   GSLGYPKRALRGHSHYVQDVVISSD--GQFCLTGSWDGTLRLWDINTGATTRRFLGHTKD  109

Query  582  VNTVAVSPDGSLCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHALC--FSP---NRYWL  421
            V +VA S D     SG +D  I LW+ L E K       G      C  FSP   N   +
Sbjct  110  VLSVAFSADNRQIVSGSRDKTIKLWNTLGECKYTIGEPDGHTEWVSCVRFSPVTQNPIIV  169

Query  420  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKII----FCTSLSWNAD  253
             A  + ++K+W+L                        N   +N ++    +  +++ + D
Sbjct  170  SAGWDKAVKVWNL-----------------------TNCKLRNNLVGHQGYVNTVTVSPD  206

Query  252  GSTLFSGYTDGVIRVWGI  199
            GS   SG  DGV  +W +
Sbjct  207  GSLCASGGKDGVAMLWDL  224



>ref|XP_004961307.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A-like [Setaria italica]
Length=334

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 156/195 (80%), Gaps = 16/195 (8%)
 Frame = -2

Query  762  GECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAG  595
            GECKYTI    G    HN WVSCVRFSP+T  PTIVSGSWDRTVKVWNL+NCKLR TL G
Sbjct  148  GECKYTIGGDLGGGEGHNGWVSCVRFSPNTFAPTIVSGSWDRTVKVWNLTNCKLRCTLDG  207

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCA  415
            H GYVN VAVSPDGSLCASGGKDG  LLWDL EGK+LYSLDAGSIIH+LCFSPNRYWLCA
Sbjct  208  HGGYVNAVAVSPDGSLCASGGKDGYTLLWDLTEGKRLYSLDAGSIIHSLCFSPNRYWLCA  267

Query  414  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  235
            AT+ S+KIWDLESK +V DL+ D++             +KN+I++CTSLSW+ADGSTL++
Sbjct  268  ATQDSVKIWDLESKHVVQDLKPDIQ------------ISKNQILYCTSLSWSADGSTLYT  315

Query  234  GYTDGVIRVWGIGRY  190
            GYTDG IRVW I  +
Sbjct  316  GYTDGSIRVWKISGF  330


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 52/194 (27%), Positives = 83/194 (43%), Gaps = 30/194 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST---------------LAG  595
            GHN  V+ +  +P    P IVS S D++V VW+L+N  + ST               L G
Sbjct  16   GHNGEVTAIA-TPIDNSPFIVSSSRDKSVLVWDLTN-PVHSTPDSGAAADYGVPFRRLTG  73

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWL  421
            H+ +V  V +S DG    SG  DG + LWDL+ G   + +      +I       NR  +
Sbjct  74   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHEKDVISVAFSVDNRQIV  133

Query  420  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTL  241
             A+ + +IK+W+   +            +  +  +       N  + C   S N    T+
Sbjct  134  SASRDKTIKLWNTLGEC-----------KYTIGGDLGGGEGHNGWVSCVRFSPNTFAPTI  182

Query  240  FSGYTDGVIRVWGI  199
             SG  D  ++VW +
Sbjct  183  VSGSWDRTVKVWNL  196



>ref|NP_001043910.1| Os01g0686800 [Oryza sativa Japonica Group]
 sp|P49027.1|GBLPA_ORYSJ RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein A; Short=GPB-LR; AltName: Full=RWD; AltName: Full=Receptor 
for activated C kinase 1A [Oryza sativa Japonica 
Group]
 dbj|BAA07404.1| q group of receptor for activated C-kinase [Oryza sativa Japonica 
Group]
 dbj|BAF05824.1| Os01g0686800 [Oryza sativa Japonica Group]
 gb|EAY75412.1| hypothetical protein OsI_03315 [Oryza sativa Indica Group]
 gb|EAZ13132.1| hypothetical protein OsJ_03054 [Oryza sativa Japonica Group]
 dbj|BAG93799.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87442.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00562.1| unnamed protein product [Oryza sativa Japonica Group]
Length=334

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 157/195 (81%), Gaps = 16/195 (8%)
 Frame = -2

Query  762  GECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAG  595
            GECKYTI    G    HN WVSCVRFSP+T QPTIVSGSWDRTVKVWNL+NCKLR  L G
Sbjct  148  GECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNCKLRCNLEG  207

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCA  415
            H GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFSPNRYWLCA
Sbjct  208  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFSPNRYWLCA  267

Query  414  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  235
            AT+ SIKIWDLESK IV DL+ ++              +KN++++CTSL+W+ADGSTL++
Sbjct  268  ATQDSIKIWDLESKHIVQDLKPEIP------------VSKNQMLYCTSLNWSADGSTLYA  315

Query  234  GYTDGVIRVWGIGRY  190
            GYTDG IR++ I  +
Sbjct  316  GYTDGTIRIYKISGF  330


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 86/196 (44%), Gaps = 34/196 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN---------------CKLRSTLAG  595
            GHN+ V+ +  +P    P IVS S D+++ VW+L+N                  R  L G
Sbjct  16   GHNDVVTAIA-TPIDNSPFIVSSSRDKSLLVWDLTNPVQNVGEGAGASEYGVPFRR-LTG  73

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG---KKLYSLDAGSIIHALCFS-PNRY  427
            H+ +V  V +S DG    SG  DG + LWDL+ G   ++    D    + ++ FS  NR 
Sbjct  74   HSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGVTTRRFVGHDKD--VLSVAFSVDNRQ  131

Query  426  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  247
             + A+ + +IK+W+   +            +  +  +       N  + C   S N    
Sbjct  132  IVSASRDRTIKLWNTLGEC-----------KYTIGGDLGGGEGHNGWVSCVRFSPNTFQP  180

Query  246  TLFSGYTDGVIRVWGI  199
            T+ SG  D  ++VW +
Sbjct  181  TIVSGSWDRTVKVWNL  196



>emb|CEG00110.1| G-protein beta WD-40 repeat [Ostreococcus tauri]
Length=319

 Score =   276 bits (707),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 150/189 (79%), Gaps = 10/189 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H+EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCK+R+ L GHTGY
Sbjct  136  GECKYTIQDADAHSEWVSCVRFSPVTTNPIIVSGGWDKLVKVWNLTNCKIRTNLVGHTGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDGV +LWDL EGK+LYSLDAG II+ LCFSPNRYWLCAATE+
Sbjct  196  INTVTVSPDGSLCASGGKDGVAMLWDLGEGKRLYSLDAGDIIYGLCFSPNRYWLCAATES  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             +KIWDLESKSIV +LR +                K++  +CTSL W+ADGSTL++GYTD
Sbjct  256  CVKIWDLESKSIVDELRPEFPP----------VGKKSQQPYCTSLQWSADGSTLYTGYTD  305

Query  222  GVIRVWGIG  196
             VIRVW +G
Sbjct  306  NVIRVWSVG  314


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 90/208 (43%), Gaps = 32/208 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
            GH  WV+ +  +P      ++S S D+TV +WNL+  +      R +L GH+ YV  V +
Sbjct  13   GHENWVTSIA-TPLDNSDILLSSSRDKTVILWNLTREEENYGYPRRSLHGHSHYVQEVVI  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D                   A ++ + C   S       + SG  D +
Sbjct  132  WNTLGECKYTIQD-----------------ADAHSEWVSCVRFSPVTTNPIIVSGGWDKL  174

Query  216  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            ++VW      +   +    ++GH  Y++
Sbjct  175  VKVWN-----LTNCKIRTNLVGHTGYIN  197


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 84/192 (44%), Gaps = 27/192 (14%)
 Frame = -2

Query  750  YTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTV  571
            Y  +   GH+ +V  V  S        +SGSWD T+++W+L+         GHT  V +V
Sbjct  54   YPRRSLHGHSHYVQEVVISSD--GQFALSGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSV  111

Query  570  AVSPDGSLCASGGKDGVILLWD-LAEGK-KLYSLDAGSI-IHALCFSP---NRYWLCAAT  409
            A S D     SG +D  I LW+ L E K  +   DA S  +  + FSP   N   +    
Sbjct  112  AFSVDNRQIVSGSRDKTIKLWNTLGECKYTIQDADAHSEWVSCVRFSPVTTNPIIVSGGW  171

Query  408  EASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGY  229
            +  +K+W+L +  I  +L         +   G          +  +++ + DGS   SG 
Sbjct  172  DKLVKVWNLTNCKIRTNL---------VGHTG----------YINTVTVSPDGSLCASGG  212

Query  228  TDGVIRVWGIGR  193
             DGV  +W +G 
Sbjct  213  KDGVAMLWDLGE  224



>gb|EMS52917.1| Guanine nucleotide-binding protein subunit beta-like protein 
B [Triticum urartu]
Length=359

 Score =   277 bits (709),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 157/192 (82%), Gaps = 16/192 (8%)
 Frame = -2

Query  762  GECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAG  595
            GECKYTI    G    H  WVSCVRFSP+  QPTIVSGSWD+TVKVWNL+NCKLRSTLAG
Sbjct  172  GECKYTIGGDMGGGEGHTGWVSCVRFSPNIQQPTIVSGSWDKTVKVWNLTNCKLRSTLAG  231

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCA  415
            H GYVN VAVSPDGSLCASGGKDGV LLWDL+EGK+LY L+AGSIIHALCFSPNRYWLCA
Sbjct  232  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLSEGKRLYQLEAGSIIHALCFSPNRYWLCA  291

Query  414  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  235
            ATE S+KIWDLESK +V DL+ +++             +KN++++CTSLSW+ADGSTL++
Sbjct  292  ATEESVKIWDLESKHVVQDLKPEVQ------------VSKNQMLYCTSLSWSADGSTLYT  339

Query  234  GYTDGVIRVWGI  199
            GYTDG IRV+ I
Sbjct  340  GYTDGTIRVFKI  351



>dbj|BAJ90663.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06408.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=335

 Score =   276 bits (707),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 157/192 (82%), Gaps = 16/192 (8%)
 Frame = -2

Query  762  GECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAG  595
            GECKYTI    G    H  WVSCVRFSP+  QPTIVSGSWD+TVKVWNL+NCKLRSTLAG
Sbjct  148  GECKYTIGGDMGGGEGHTGWVSCVRFSPNIQQPTIVSGSWDKTVKVWNLANCKLRSTLAG  207

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCA  415
            H GYVN VAVSPDGSLCASGGKDGV LLWDL+EGK+LY L+AGSIIH+LCFSPNRYWLCA
Sbjct  208  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLSEGKRLYQLEAGSIIHSLCFSPNRYWLCA  267

Query  414  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  235
            ATE SIKIWDLESK +V DL+ +++             +KN++++CTSLSW+ADGSTL++
Sbjct  268  ATEESIKIWDLESKHVVQDLKPEVQ------------VSKNQMLYCTSLSWSADGSTLYT  315

Query  234  GYTDGVIRVWGI  199
            GYTDG IRV+ I
Sbjct  316  GYTDGTIRVFKI  327


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 81/194 (42%), Gaps = 30/194 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN---------------CKLRSTLAG  595
            GHN+ V+ +  +P    P IVSGS D+++ VW+L+N                  R  L G
Sbjct  16   GHNDVVTAIA-APIDNSPYIVSGSRDKSLLVWDLTNPVASLGDGTVGTDYAVPFRR-LTG  73

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWL  421
            H  +V  V +S DG    SG  DG + LWDL+ G   + +      +I       NR  +
Sbjct  74   HGHFVQDVVISSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHTKDVISVAFSVDNRQIV  133

Query  420  CAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTL  241
             A+ + +IK+W+   +            +  +  +          + C   S N    T+
Sbjct  134  SASRDNTIKLWNTLGEC-----------KYTIGGDMGGGEGHTGWVSCVRFSPNIQQPTI  182

Query  240  FSGYTDGVIRVWGI  199
             SG  D  ++VW +
Sbjct  183  VSGSWDKTVKVWNL  196



>ref|XP_003567944.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Brachypodium distachyon]
Length=333

 Score =   276 bits (706),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 156/192 (81%), Gaps = 16/192 (8%)
 Frame = -2

Query  762  GECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAG  595
            GECKYTI    G    H  WVSCVRFSP+T QPTIVSGSWD+TVKVWNL+NCKLR+TLAG
Sbjct  146  GECKYTIGGDLGGGEGHTGWVSCVRFSPNTFQPTIVSGSWDKTVKVWNLTNCKLRNTLAG  205

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCA  415
            H GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LY L+AGSIIH+LCFSPNRYWLCA
Sbjct  206  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYQLEAGSIIHSLCFSPNRYWLCA  265

Query  414  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  235
            ATE S+KIWDLESK +V DL+ + +             +KN++++CTSL W+ADGSTL++
Sbjct  266  ATEDSVKIWDLESKHVVQDLKPEFQ------------VSKNQMLYCTSLCWSADGSTLYT  313

Query  234  GYTDGVIRVWGI  199
            GYTDG IRV+ I
Sbjct  314  GYTDGTIRVFKI  325


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 78/193 (40%), Gaps = 28/193 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST--------------LAGH  592
            GHN+ V+ +  +P      IVS S D++V VW+L+N                    L GH
Sbjct  14   GHNDVVTAIA-APIDNTAFIVSSSRDKSVLVWDLTNPAPSPADGTVATDYGVPFRRLTGH  72

Query  591  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLC  418
              +V  V +S DG    SG  DG + LWDL+ G   + +      +I       NR  + 
Sbjct  73   GHFVQDVVISSDGQFALSGSWDGELRLWDLSTGLTTRRFVGHTKDVISVAFSVDNRQIVS  132

Query  417  AATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLF  238
            A+ + +IK+W+   +            +  +  +          + C   S N    T+ 
Sbjct  133  ASRDNTIKLWNTLGEC-----------KYTIGGDLGGGEGHTGWVSCVRFSPNTFQPTIV  181

Query  237  SGYTDGVIRVWGI  199
            SG  D  ++VW +
Sbjct  182  SGSWDKTVKVWNL  194



>gb|AEF79971.1| receptor of activated protein kinase C 1 [Dunaliella salina]
Length=318

 Score =   274 bits (701),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 153/188 (81%), Gaps = 9/188 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKY+I + +GH+EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCKL++ L GH GY
Sbjct  137  GECKYSIGEPEGHSEWVSCVRFSPMTANPIIVSGGWDKYVKVWNLTNCKLKNNLIGHMGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG IIHALCFSPNRYWLCAAT +
Sbjct  197  VNTVTVSPDGSLCASGGKDGVGMLWDLAEGKRLYSLDAGDIIHALCFSPNRYWLCAATSS  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKS+V DLR +  +E +  A          + +C SL+W+ADGSTL+SGYTD
Sbjct  257  SIKIWDLESKSVVDDLRPEWNKEFKKKAT---------VPYCVSLAWSADGSTLYSGYTD  307

Query  222  GVIRVWGI  199
            G+IRVW +
Sbjct  308  GMIRVWNV  315


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 90/206 (44%), Gaps = 27/206 (13%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNL-----SNCKLRSTLAGHTGYVNTVAV  565
            GH+ WV+ +          ++S S D++V VW L     S    + +L GH+ +V  V +
Sbjct  13   GHSGWVTALAAPLDPSSNVLLSASRDKSVIVWELERGGDSYGYPKKSLRGHSHFVQDVVI  72

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG  C SG  DG + LWDL  G         +  + ++ FS  NR  +  + + +I++
Sbjct  73   SSDGQFCLSGSWDGTLRLWDLNTGATTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIRL  132

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+   +           + S    EG+     ++ + C   S       + SG  D  ++
Sbjct  133  WNTLGEC----------KYSIGEPEGH-----SEWVSCVRFSPMTANPIIVSGGWDKYVK  177

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW      +   +  + +IGH+ Y++
Sbjct  178  VWN-----LTNCKLKNNLIGHMGYVN  198



>ref|XP_001421096.1| Receptor of activated protein kinase C 1A, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
 ref|XP_001422858.1| Receptor of activated protein kinase C 1B, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO99389.1| Receptor of activated protein kinase C 1A, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABP01217.1| Receptor of activated protein kinase C 1B, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
Length=321

 Score =   274 bits (701),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 149/189 (79%), Gaps = 10/189 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H+EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCK+R+ L GHTGY
Sbjct  136  GECKYTIQDADAHSEWVSCVRFSPVTSNPIIVSGGWDKLVKVWNLTNCKIRTNLVGHTGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +N V VSPDGSLCASGGKDGV +LWDL EGK+LYSLDAG II+ LCFSPNRYWLCAATE+
Sbjct  196  INAVTVSPDGSLCASGGKDGVAMLWDLGEGKRLYSLDAGDIIYGLCFSPNRYWLCAATES  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             +KIWDLESKSIV +LR +                K++  +CTSL W+ADGSTL++GYTD
Sbjct  256  CVKIWDLESKSIVDELRPEFPP----------VGKKSQQPYCTSLQWSADGSTLYTGYTD  305

Query  222  GVIRVWGIG  196
             VIRVW +G
Sbjct  306  NVIRVWSVG  314


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 90/208 (43%), Gaps = 32/208 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
            GH  WV+ +  +P      ++S S D+TV +WNL+  +      R +L GH+ +V  V +
Sbjct  13   GHENWVTSIA-TPLDNSDILLSSSRDKTVILWNLTREEENYGYPRRSLHGHSHFVQDVVI  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G         +  + ++ FS  NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  + D                   A ++ + C   S       + SG  D +
Sbjct  132  WNTLGECKYTIQD-----------------ADAHSEWVSCVRFSPVTSNPIIVSGGWDKL  174

Query  216  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            ++VW      +   +    ++GH  Y++
Sbjct  175  VKVWN-----LTNCKIRTNLVGHTGYIN  197


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 84/192 (44%), Gaps = 27/192 (14%)
 Frame = -2

Query  750  YTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTV  571
            Y  +   GH+ +V  V  S        +SGSWD T+++W+L+         GHT  V +V
Sbjct  54   YPRRSLHGHSHFVQDVVISSD--GQFALSGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSV  111

Query  570  AVSPDGSLCASGGKDGVILLWD-LAEGK-KLYSLDAGSI-IHALCFSP---NRYWLCAAT  409
            A S D     SG +D  I LW+ L E K  +   DA S  +  + FSP   N   +    
Sbjct  112  AFSVDNRQIVSGSRDKTIKLWNTLGECKYTIQDADAHSEWVSCVRFSPVTSNPIIVSGGW  171

Query  408  EASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGY  229
            +  +K+W+L +  I  +L         +   G          +  +++ + DGS   SG 
Sbjct  172  DKLVKVWNLTNCKIRTNL---------VGHTG----------YINAVTVSPDGSLCASGG  212

Query  228  TDGVIRVWGIGR  193
             DGV  +W +G 
Sbjct  213  KDGVAMLWDLGE  224



>ref|XP_003082627.1| GTP-binding regulatory protein beta chain homolog-Ch (ISS) [Ostreococcus 
tauri]
Length=483

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 150/189 (79%), Gaps = 10/189 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H+EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCK+R+ L GHTGY
Sbjct  300  GECKYTIQDADAHSEWVSCVRFSPVTTNPIIVSGGWDKLVKVWNLTNCKIRTNLVGHTGY  359

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDGV +LWDL EGK+LYSLDAG II+ LCFSPNRYWLCAATE+
Sbjct  360  INTVTVSPDGSLCASGGKDGVAMLWDLGEGKRLYSLDAGDIIYGLCFSPNRYWLCAATES  419

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             +KIWDLESKSIV +LR +                K++  +CTSL W+ADGSTL++GYTD
Sbjct  420  CVKIWDLESKSIVDELRPEFPP----------VGKKSQQPYCTSLQWSADGSTLYTGYTD  469

Query  222  GVIRVWGIG  196
             VIRVW +G
Sbjct  470  NVIRVWSVG  478


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 82/189 (43%), Gaps = 31/189 (16%)
 Frame = -2

Query  672  IVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLW  508
            ++S S D+TV +WNL+  +      R +L GH+ YV  V +S DG    SG  DG + LW
Sbjct  195  LLSSSRDKTVILWNLTREEENYGYPRRSLHGHSHYVQEVVISSDGQFALSGSWDGTLRLW  254

Query  507  DLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKIWDL--ESKSIVVDLRVDLK  340
            DL  G         +  + ++ FS  NR  +  + + +IK+W+   E K  + D      
Sbjct  255  DLNTGTTTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKLWNTLGECKYTIQD------  308

Query  339  QESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHM  160
                         A ++ + C   S       + SG  D +++VW      +   +    
Sbjct  309  -----------ADAHSEWVSCVRFSPVTTNPIIVSGGWDKLVKVWN-----LTNCKIRTN  352

Query  159  IIGHVCYLS  133
            ++GH  Y++
Sbjct  353  LVGHTGYIN  361


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 84/191 (44%), Gaps = 27/191 (14%)
 Frame = -2

Query  750  YTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTV  571
            Y  +   GH+ +V  V  S        +SGSWD T+++W+L+         GHT  V +V
Sbjct  218  YPRRSLHGHSHYVQEVVISSD--GQFALSGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSV  275

Query  570  AVSPDGSLCASGGKDGVILLWD-LAEGK-KLYSLDAGSI-IHALCFSP---NRYWLCAAT  409
            A S D     SG +D  I LW+ L E K  +   DA S  +  + FSP   N   +    
Sbjct  276  AFSVDNRQIVSGSRDKTIKLWNTLGECKYTIQDADAHSEWVSCVRFSPVTTNPIIVSGGW  335

Query  408  EASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGY  229
            +  +K+W+L +  I  +L         +   G          +  +++ + DGS   SG 
Sbjct  336  DKLVKVWNLTNCKIRTNL---------VGHTG----------YINTVTVSPDGSLCASGG  376

Query  228  TDGVIRVWGIG  196
             DGV  +W +G
Sbjct  377  KDGVAMLWDLG  387



>ref|NP_001056254.1| Os05g0552300 [Oryza sativa Japonica Group]
 sp|Q6L4F8.1|GBLPB_ORYSJ RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein B; Short=GPB-LR; AltName: Full=Receptor for activated 
C kinase 1B [Oryza sativa Japonica Group]
 gb|AAT39277.1| putative guanine nucleotide-binding protein beta subunit [Oryza 
sativa Japonica Group]
 gb|AAT85192.1| putative guanine nucleotide binding protein beta subunit [Oryza 
sativa Japonica Group]
 dbj|BAF18168.1| Os05g0552300 [Oryza sativa Japonica Group]
 dbj|BAG88240.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89443.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00554.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64615.1| hypothetical protein OsJ_19467 [Oryza sativa Japonica Group]
Length=336

 Score =   274 bits (701),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 156/198 (79%), Gaps = 19/198 (10%)
 Frame = -2

Query  762  GECKYTIQD----GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAG  595
            GECKYTI      G+GH  WVSCVRFSP+ + PTIVSGSWDR+VKVWNL+NCKLR+ L G
Sbjct  149  GECKYTIGGDHGAGEGHTGWVSCVRFSPNPMAPTIVSGSWDRSVKVWNLTNCKLRTKLEG  208

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCA  415
            H GYVN VAVSPDGSLCASGGKDG  LLWDL EGK LY LDAG+IIH+LCFSPNRYWLCA
Sbjct  209  HNGYVNAVAVSPDGSLCASGGKDGTTLLWDLTEGKMLYKLDAGAIIHSLCFSPNRYWLCA  268

Query  414  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  235
            ATE S+KIWDLESK ++ DL+ +++            A K+++++CTSLSW+ADGSTLF+
Sbjct  269  ATEDSVKIWDLESKLVMQDLKPEVQ------------AFKSQMLYCTSLSWSADGSTLFA  316

Query  234  GYTDGVIRVW---GIGRY  190
            GYTDG IRVW   G G Y
Sbjct  317  GYTDGTIRVWKVSGFGGY  334


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/197 (27%), Positives = 87/197 (44%), Gaps = 34/197 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLR----------------STLA  598
            GHN+ V+ +  +P    P IVS S D+++ VW+++N                      L 
Sbjct  15   GHNDMVTAIA-APIDNSPFIVSSSRDKSLLVWDITNPSTAVATDPEAAPPEYGVSYRRLT  73

Query  597  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYW  424
            GH+ +V  V +S DG    SG  DG + LWDLA G+        +  + ++ FS  NR  
Sbjct  74   GHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGRTTRRFVGHTKDVLSVAFSVDNRQI  133

Query  423  LCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI--IFCTSLSWNADG  250
            + AA + +IK+W+                E + +  G++ A +     + C   S N   
Sbjct  134  VSAARDNTIKLWNTLG-------------ECKYTIGGDHGAGEGHTGWVSCVRFSPNPMA  180

Query  249  STLFSGYTDGVIRVWGI  199
             T+ SG  D  ++VW +
Sbjct  181  PTIVSGSWDRSVKVWNL  197


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 89/207 (43%), Gaps = 31/207 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+L+  +      GHT  V +VA S D  
Sbjct  74   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLATGRTTRRFVGHTKDVLSVAFSVDNR  131

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGS------IIHALCFSPNRY---WLCAATEAS  400
               S  +D  I LW+ L E K     D G+       +  + FSPN      +  + + S
Sbjct  132  QIVSAARDNTIKLWNTLGECKYTIGGDHGAGEGHTGWVSCVRFSPNPMAPTIVSGSWDRS  191

Query  399  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  220
            +K+W+L +      LR  L        EG+N        +  +++ + DGS   SG  DG
Sbjct  192  VKVWNLTN----CKLRTKL--------EGHNG-------YVNAVAVSPDGSLCASGGKDG  232

Query  219  VIRVWGIGRY*MEEFRRSHMIIGHVCY  139
               +W +    M     +  II  +C+
Sbjct  233  TTLLWDLTEGKMLYKLDAGAIIHSLCF  259



>gb|AEO44580.1| receptor for activated C kinase 1 [Dunaliella salina]
Length=318

 Score =   273 bits (697),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 153/188 (81%), Gaps = 9/188 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKY+I + +GH+EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCKL++ L GH+GY
Sbjct  137  GECKYSIGEPEGHSEWVSCVRFSPMTANPIIVSGGWDKYVKVWNLTNCKLKNNLIGHSGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTV VSPDGSLCASGGKD V +LWDLAEGK+LYSLDAG IIHALCFSPNRYWLCAAT +
Sbjct  197  VNTVTVSPDGSLCASGGKDNVGMLWDLAEGKRLYSLDAGDIIHALCFSPNRYWLCAATSS  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKS+V DLR +  +E +  A          + +C SL+W+ADGSTL+SGYTD
Sbjct  257  SIKIWDLESKSVVDDLRPEWNKEFKKKAT---------VPYCVSLAWSADGSTLYSGYTD  307

Query  222  GVIRVWGI  199
            G+IRVW +
Sbjct  308  GMIRVWNV  315


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 60/122 (49%), Gaps = 7/122 (6%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNL-----SNCKLRSTLAGHTGYVNTVAV  565
            GH+ WV+ +          ++S S D+TV VW L     S    + +L GH+ +V  V +
Sbjct  13   GHSGWVTALAAPLDPASNVLLSASRDKTVIVWELERGGDSYGYPKKSLHGHSHFVQDVVI  72

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG  C SG  DG + LWDL  G         +  + ++ FS  NR  +  + + +I++
Sbjct  73   SSDGQFCLSGSWDGTLRLWDLNTGATTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIRL  132

Query  390  WD  385
            W+
Sbjct  133  WN  134



>ref|XP_006654750.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B-like [Oryza brachyantha]
Length=336

 Score =   273 bits (698),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 157/198 (79%), Gaps = 19/198 (10%)
 Frame = -2

Query  762  GECKYTIQD----GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAG  595
            GECKYTI      GDGH+ WVSCVRFSP+ L PTIVSGSWDR+VKVWNL+NCKLR+ L G
Sbjct  149  GECKYTIGGDLGAGDGHSGWVSCVRFSPNPLMPTIVSGSWDRSVKVWNLTNCKLRTKLEG  208

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCA  415
            H GYVN VAVSPDGSLCASGGKDGV LLWDL EGK LY L+AG+IIH+LCFSPNRYWLCA
Sbjct  209  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLTEGKMLYKLEAGAIIHSLCFSPNRYWLCA  268

Query  414  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  235
            ATE S+KIWDLESK ++ DL+ +++            A K++++ CTSLSW+ADGSTL++
Sbjct  269  ATEDSVKIWDLESKLVMQDLKPEVQ------------AFKSQMLHCTSLSWSADGSTLYT  316

Query  234  GYTDGVIRVW---GIGRY  190
            GYTDG IRVW   G G Y
Sbjct  317  GYTDGTIRVWKVSGFGGY  334


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 84/198 (42%), Gaps = 36/198 (18%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----------------CKLRSTL  601
            GHN+ V+ +  +P    P +VS S D+++ VW++SN                    R  L
Sbjct  15   GHNDVVTAIA-APIDNSPFVVSSSRDKSLMVWDISNPAPAVATDPDSAPPEYGVPFRR-L  72

Query  600  AGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRY  427
             GH+ +V  V +S DG    SG  DG + LWDL+ G   + +   A  ++       NR 
Sbjct  73   TGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGATTRRFVGHAKDVLSVAFSVDNRQ  132

Query  426  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI--IFCTSLSWNAD  253
             + A+ + +IK+W+                E + +  G+  A       + C   S N  
Sbjct  133  IVSASRDNTIKLWNTLG-------------ECKYTIGGDLGAGDGHSGWVSCVRFSPNPL  179

Query  252  GSTLFSGYTDGVIRVWGI  199
              T+ SG  D  ++VW +
Sbjct  180  MPTIVSGSWDRSVKVWNL  197


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 53/207 (26%), Positives = 86/207 (42%), Gaps = 31/207 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD  +++W+LS         GH   V +VA S D  
Sbjct  74   GHSHFVQDVVLSSD--GQFALSGSWDGELRLWDLSTGATTRRFVGHAKDVLSVAFSVDNR  131

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGS------IIHALCFSPNRYW---LCAATEAS  400
               S  +D  I LW+ L E K     D G+       +  + FSPN      +  + + S
Sbjct  132  QIVSASRDNTIKLWNTLGECKYTIGGDLGAGDGHSGWVSCVRFSPNPLMPTIVSGSWDRS  191

Query  399  IKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  220
            +K+W+L           + K  +++   G          +  +++ + DGS   SG  DG
Sbjct  192  VKVWNL----------TNCKLRTKLEGHGG---------YVNAVAVSPDGSLCASGGKDG  232

Query  219  VIRVWGIGRY*MEEFRRSHMIIGHVCY  139
            V  +W +    M     +  II  +C+
Sbjct  233  VTLLWDLTEGKMLYKLEAGAIIHSLCF  259



>ref|XP_002456166.1| hypothetical protein SORBIDRAFT_03g031520 [Sorghum bicolor]
 gb|EES01286.1| hypothetical protein SORBIDRAFT_03g031520 [Sorghum bicolor]
Length=332

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 156/195 (80%), Gaps = 16/195 (8%)
 Frame = -2

Query  762  GECKYTIQD----GDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAG  595
            GECKYTI       +GHN WVSCVRFSP+T QPTIVSGSWDR+VKVWNL+NCKLR TL G
Sbjct  148  GECKYTIGGDLGGAEGHNGWVSCVRFSPNTYQPTIVSGSWDRSVKVWNLTNCKLRCTLQG  207

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCA  415
            H GYVN VAVSPDGSLCASGGKD V LLWDL EGK+LY+LDAG IIH+LCFSPNRYWLCA
Sbjct  208  HGGYVNAVAVSPDGSLCASGGKDHVTLLWDLTEGKRLYALDAGDIIHSLCFSPNRYWLCA  267

Query  414  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  235
            AT+ SIKIWDLESK +V DL+ ++            ++ K+++++CT LSW+ADGSTL++
Sbjct  268  ATQESIKIWDLESKHVVQDLKPEV------------SSTKDQMLYCTCLSWSADGSTLYA  315

Query  234  GYTDGVIRVWGIGRY  190
            GYTDG IR++ I  Y
Sbjct  316  GYTDGSIRIYKISAY  330


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 85/197 (43%), Gaps = 36/197 (18%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN---------------CKLRSTLAG  595
            GHN  V+ +  +P      IVS S D+++ VW+L N                 LR  L G
Sbjct  16   GHNGVVTAIA-TPIDNSDLIVSSSRDKSLLVWDLRNPVQAAGDGTTTADYGVPLRR-LTG  73

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKL--YSLDAGSIIHALCFSPNRYWL  421
            H+ +V  V +S DG    SG  DG + LW+L  G+    +      ++     + NR  +
Sbjct  74   HSHFVQDVVLSSDGQFALSGSWDGDLRLWNLTTGETTCRFVGHEKDVLSVAFSADNRQIV  133

Query  420  CAATEASIKIWDLESK---SIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADG  250
             A+ + +IK+W+   +   +I  DL           AEG+     N  + C   S N   
Sbjct  134  SASRDRTIKLWNTLGECKYTIGGDLG---------GAEGH-----NGWVSCVRFSPNTYQ  179

Query  249  STLFSGYTDGVIRVWGI  199
             T+ SG  D  ++VW +
Sbjct  180  PTIVSGSWDRSVKVWNL  196



>ref|XP_003060952.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54602.1| predicted protein [Micromonas pusilla CCMP1545]
Length=325

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 150/190 (79%), Gaps = 10/190 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+ +GH EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCKLR+ L GHTGY
Sbjct  136  GECKYTIQEQEGHTEWVSCVRFSPVTSNPIIVSGGWDKLVKVWNLTNCKLRTNLVGHTGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDGV +LWDLAEGK+LY+LDAG II+ALCFSPNRYWLCAAT++
Sbjct  196  INTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYTLDAGDIIYALCFSPNRYWLCAATQS  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             +KIWDLESKSIV           E+  E      K+   FCTSL+W+ADG TLF+GYTD
Sbjct  256  CVKIWDLESKSIV----------DELHPEFPPVGKKSIPPFCTSLNWSADGGTLFTGYTD  305

Query  222  GVIRVWGIGR  193
             +IRVW + R
Sbjct  306  CLIRVWTVNR  315



>ref|XP_002502835.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64093.1| predicted protein [Micromonas sp. RCC299]
Length=324

 Score =   271 bits (693),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 149/190 (78%), Gaps = 10/190 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+ +GH EWVSCVRFSP T  P IVSG WD+ VKVWNL+NCKLR+ L GHTGY
Sbjct  137  GECKYTIQEQEGHTEWVSCVRFSPVTSNPIIVSGGWDKLVKVWNLTNCKLRTNLVGHTGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG II+ALCFSPNRYWLCAAT++
Sbjct  197  INTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDIIYALCFSPNRYWLCAATQS  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             +KIWDLESKSIV           E+  E      K+   FCTSL W++DG+TLF+GYTD
Sbjct  257  CVKIWDLESKSIV----------DELHPEFPPVGKKSIPPFCTSLQWSSDGATLFTGYTD  306

Query  222  GVIRVWGIGR  193
              IRVW + R
Sbjct  307  CQIRVWTVSR  316


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 86/208 (41%), Gaps = 31/208 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
            GH  WV+ +          ++S S D+TV +W L+  +      +  L GH+ +V  V +
Sbjct  13   GHEGWVTSLATPLDNNSDMLLSSSRDKTVILWTLTREEGNYGYAQKALRGHSHFVQDVVI  72

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G         S  + ++ FS  NR  +  + + +IK+
Sbjct  73   SSDGQFALSGSWDGTLRLWDLNTGSTTRRFVGHSKDVLSVAFSVDNRQIVSGSRDKTIKL  132

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  +        QE E   E          + C   S       + SG  D +
Sbjct  133  WNTLGECKYTI--------QEQEGHTE---------WVSCVRFSPVTSNPIIVSGGWDKL  175

Query  216  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            ++VW      +   +    ++GH  Y++
Sbjct  176  VKVWN-----LTNCKLRTNLVGHTGYIN  198



>gb|EMT00770.1| hypothetical protein F775_19376 [Aegilops tauschii]
Length=599

 Score =   279 bits (714),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 157/192 (82%), Gaps = 16/192 (8%)
 Frame = -2

Query  762  GECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAG  595
            GECKYTI    G    H  WVSCVRFSP+  QPTIVSGSWD+TVKVWNL+NCKLRSTLAG
Sbjct  79   GECKYTIGGDMGGGEGHTGWVSCVRFSPNIQQPTIVSGSWDKTVKVWNLTNCKLRSTLAG  138

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCA  415
            H GYVN VAVSPDGSLCASGGKDGV LLWDL+EGK+LY L+AGSIIHALCFSPNRYWLCA
Sbjct  139  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLSEGKRLYQLEAGSIIHALCFSPNRYWLCA  198

Query  414  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  235
            ATE S+KIWDLESK +V DL+ +++             +KN++++CTSLSW+ADGSTL++
Sbjct  199  ATEESVKIWDLESKHVVQDLKPEVQ------------VSKNQMLYCTSLSWSADGSTLYT  246

Query  234  GYTDGVIRVWGI  199
            GYTDG IRV+ I
Sbjct  247  GYTDGTIRVFKI  258



>ref|XP_010480509.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A, partial [Camelina sativa]
Length=232

 Score =   266 bits (681),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 141/161 (88%), Gaps = 2/161 (1%)
 Frame = -2

Query  762  GECKYTIQDG--DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHT  589
            GECKYTI +G  DGH +WVSCVRFSP+TLQPTIVS SWD+TVKVWNLSNCKLRSTLAGHT
Sbjct  69   GECKYTISEGGGDGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHT  128

Query  588  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAAT  409
            GYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYS +A S+IHALCFSPNRYWLCAAT
Sbjct  129  GYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSFEANSVIHALCFSPNRYWLCAAT  188

Query  408  EASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI  286
            E  IKIWDLESK+IV DL+VDLK E+E +      A K K+
Sbjct  189  EQGIKIWDLESKTIVEDLKVDLKAEAEKADNSGPAATKRKV  229



>ref|XP_002967499.1| hypothetical protein SELMODRAFT_144795 [Selaginella moellendorffii]
 gb|EFJ32098.1| hypothetical protein SELMODRAFT_144795 [Selaginella moellendorffii]
Length=315

 Score =   268 bits (685),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 149/190 (78%), Gaps = 13/190 (7%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H  WVSCVRFSP T  P IVSG WD+ VKVWNL+NCKLR+ LAGH+GY
Sbjct  139  GECKYTIQDQDSHTGWVSCVRFSPVTTNPIIVSGGWDKMVKVWNLTNCKLRTNLAGHSGY  198

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VN+V VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG IIH+LCFSPNRYWLCAAT+ 
Sbjct  199  VNSVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDIIHSLCFSPNRYWLCAATQQ  258

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             +KIWDLESK+IV +++ +               +K +  +CT+L+W+ DGS LF+GYTD
Sbjct  259  CVKIWDLESKNIVEEIKPE-------------QVSKKEPTYCTTLNWSMDGSKLFAGYTD  305

Query  222  GVIRVWGIGR  193
            GVIRV  +G 
Sbjct  306  GVIRVHSVGH  315


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 60/126 (48%), Gaps = 11/126 (9%)
 Frame = -2

Query  732  DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL--------RSTLAGHTGYVN  577
            +GH +WV+ +  +P      I+S S D++V +WN  +  L        +  L GH  +V 
Sbjct  12   EGHTDWVTAIA-TPVDNSDIILSASRDKSVLLWNTQHKDLTEQDFGLPQRRLTGHAHFVQ  70

Query  576  TVAVSPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEA  403
             V +S D     SG  DG + LWDLA G   + +      ++     + NR  +  + + 
Sbjct  71   DVVISSDSQFALSGSWDGTLRLWDLANGNTTRRFVGHTKDVLSVAFSADNRQIVSGSRDK  130

Query  402  SIKIWD  385
            SIK+W+
Sbjct  131  SIKLWN  136


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 78/185 (42%), Gaps = 27/185 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH  +V  V  S  +     +SGSWD T+++W+L+N        GHT  V +VA S D  
Sbjct  64   GHAHFVQDVVISSDS--QFALSGSWDGTLRLWDLANGNTTRRFVGHTKDVLSVAFSADNR  121

Query  549  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSP---NRYWLCAATEASIKIW  388
               SG +D  I LW+     K    D  S    +  + FSP   N   +    +  +K+W
Sbjct  122  QIVSGSRDKSIKLWNTLGECKYTIQDQDSHTGWVSCVRFSPVTTNPIIVSGGWDKMVKVW  181

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  208
            +L +      LR +L   S                +  S++ + DGS   SG  DGV  +
Sbjct  182  NLTN----CKLRTNLAGHSG---------------YVNSVTVSPDGSLCASGGKDGVAML  222

Query  207  WGIGR  193
            W +  
Sbjct  223  WDLAE  227



>ref|XP_005652002.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE27458.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
Length=317

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 148/188 (79%), Gaps = 10/188 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + DGH EWVSCVRFSP T  P IVS  WD+ VKVWNL+NCKLR+ L GH+GY
Sbjct  137  GECKYTIAEPDGHTEWVSCVRFSPVTNNPIIVSAGWDKLVKVWNLTNCKLRANLQGHSGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDGV +LWDLAEGK+LY+L+AG IIHALCFSPNRYWLCAAT  
Sbjct  197  INTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYNLEAGEIIHALCFSPNRYWLCAATTN  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLESKSIV +L+ D  +             K ++ +C SL+W+ADG+TL+SGYT+
Sbjct  257  CIKIWDLESKSIVDELKPDFGE----------LGKKAQVPYCVSLAWSADGATLYSGYTN  306

Query  222  GVIRVWGI  199
            G I VWG+
Sbjct  307  GKIEVWGV  314


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 63/123 (51%), Gaps = 7/123 (6%)
 Frame = -2

Query  732  DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVA  568
            +GH  WV+ +         TI+S S D+T+ VW L+  +      + +L GH+ +V  V 
Sbjct  12   EGHAGWVTSIATPLDPNSDTILSSSRDKTILVWTLTREEGNYGFAKRSLKGHSHFVEDVV  71

Query  567  VSPDGSLCASGGKDGVILLWDLAEGKKLYS-LDAGSIIHALCFS-PNRYWLCAATEASIK  394
            +S DG    SG  DG + LWDL+ G+     L     + ++ FS  NR  +  + + +IK
Sbjct  72   ISSDGQFALSGSWDGTLRLWDLSTGQTTRRFLGHSKDVLSVAFSMDNRQIVSGSRDKTIK  131

Query  393  IWD  385
            +W+
Sbjct  132  LWN  134


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 81/185 (44%), Gaps = 27/185 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD T+++W+LS  +      GH+  V +VA S D  
Sbjct  62   GHSHFVEDVVISSD--GQFALSGSWDGTLRLWDLSTGQTTRRFLGHSKDVLSVAFSMDNR  119

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSIIHALC--FSP---NRYWLCAATEASIKIW  388
               SG +D  I LW+ + E K   +   G      C  FSP   N   + A  +  +K+W
Sbjct  120  QIVSGSRDKTIKLWNTIGECKYTIAEPDGHTEWVSCVRFSPVTNNPIIVSAGWDKLVKVW  179

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  208
            +L +      LR +L+  S                +  +++ + DGS   SG  DGV  +
Sbjct  180  NLTN----CKLRANLQGHSG---------------YINTVTVSPDGSLCASGGKDGVAML  220

Query  207  WGIGR  193
            W +  
Sbjct  221  WDLAE  225



>ref|XP_002960209.1| hypothetical protein SELMODRAFT_266532 [Selaginella moellendorffii]
 gb|EFJ37748.1| hypothetical protein SELMODRAFT_266532 [Selaginella moellendorffii]
Length=310

 Score =   264 bits (675),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 147/190 (77%), Gaps = 18/190 (9%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H  WVSCVRFSP T  P IVSG WD+ VKVWNL+NCKLR+ LAGH+GY
Sbjct  139  GECKYTIQDQDSHTGWVSCVRFSPVTTNPIIVSGGWDKMVKVWNLTNCKLRTNLAGHSGY  198

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VN+V VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG IIH+LCFSPNRYWLCAAT+ 
Sbjct  199  VNSVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDIIHSLCFSPNRYWLCAATQQ  258

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             +KIWDLESK+IV +++ +                  +  +CT+L+W+ DGS LF+GYTD
Sbjct  259  CVKIWDLESKNIVEEIKPE------------------QPTYCTTLNWSMDGSKLFAGYTD  300

Query  222  GVIRVWGIGR  193
            GVIRV  +G 
Sbjct  301  GVIRVHSVGH  310


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 60/126 (48%), Gaps = 11/126 (9%)
 Frame = -2

Query  732  DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL--------RSTLAGHTGYVN  577
            +GH +WV+ +  +P      I+S S D++V +WN  +  L        +  L GH  +V 
Sbjct  12   EGHTDWVTAIA-TPVDNSDIILSASRDKSVLLWNTQHKDLTEQDFGLPQRRLTGHAHFVQ  70

Query  576  TVAVSPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEA  403
             V +S D     SG  DG + LWDLA G   + +      ++     + NR  +  + + 
Sbjct  71   DVVISSDSQFALSGSWDGTLRLWDLANGNTTRRFVGHTKDVLSVAFSADNRQIVSGSRDK  130

Query  402  SIKIWD  385
            SIK+W+
Sbjct  131  SIKLWN  136


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 78/185 (42%), Gaps = 27/185 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH  +V  V  S  +     +SGSWD T+++W+L+N        GHT  V +VA S D  
Sbjct  64   GHAHFVQDVVISSDS--QFALSGSWDGTLRLWDLANGNTTRRFVGHTKDVLSVAFSADNR  121

Query  549  LCASGGKDGVILLWDLAEGKKLYSLDAGSI---IHALCFSP---NRYWLCAATEASIKIW  388
               SG +D  I LW+     K    D  S    +  + FSP   N   +    +  +K+W
Sbjct  122  QIVSGSRDKSIKLWNTLGECKYTIQDQDSHTGWVSCVRFSPVTTNPIIVSGGWDKMVKVW  181

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  208
            +L +      LR +L   S                +  S++ + DGS   SG  DGV  +
Sbjct  182  NLTN----CKLRTNLAGHSG---------------YVNSVTVSPDGSLCASGGKDGVAML  222

Query  207  WGIGR  193
            W +  
Sbjct  223  WDLAE  227



>ref|XP_003569582.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Brachypodium distachyon]
Length=331

 Score =   264 bits (674),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 156/195 (80%), Gaps = 16/195 (8%)
 Frame = -2

Query  762  GECKYTIQDGDGHNE----WVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAG  595
            GECKYTI    G  E    WVSCVRFSP+T  PTIVSGSWDR+VKVWNL+NCK+RSTL G
Sbjct  145  GECKYTIGGDHGGGEGHTGWVSCVRFSPNTFVPTIVSGSWDRSVKVWNLTNCKIRSTLDG  204

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCA  415
            H GYV+ VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG+II++LCFSPNRYWLCA
Sbjct  205  HGGYVSAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIINSLCFSPNRYWLCA  264

Query  414  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  235
            AT+ SIKIWDLESK +V DLR ++              +KN++++CT LSW+ADGSTL++
Sbjct  265  ATQDSIKIWDLESKHVVQDLRPEVP------------VSKNQMLYCTCLSWSADGSTLYA  312

Query  234  GYTDGVIRVWGIGRY  190
            GYTDG IR++ I  +
Sbjct  313  GYTDGTIRIYKISGF  327


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 65/130 (50%), Gaps = 17/130 (13%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST-------------LAGHT  589
            GHN+ V+ +  +P    P IVS S D+++ VW+L+N  +++T             L GH 
Sbjct  15   GHNDVVTAIA-TPIDNSPFIVSSSRDKSLLVWDLTN-PIQATQDSSSEYGIPFRRLTGHG  72

Query  588  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCA  415
             +V  V +S DG    SG  DG + LWDL+ G   + +      ++       NR  + A
Sbjct  73   HFVQDVVLSSDGQFALSGSWDGELRLWDLSTGVTTRRFVGHEKDVLSVAFSVDNRQIVSA  132

Query  414  ATEASIKIWD  385
            + + +IK+W+
Sbjct  133  SRDRTIKLWN  142



>gb|KIY98327.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Monoraphidium neglectum]
Length=319

 Score =   263 bits (671),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 147/186 (79%), Gaps = 9/186 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + +GH+EWVSCVRFSP T  P IVSG WD+ VKV+NLSNCKL+  L GH GY
Sbjct  137  GECKYTIAEPEGHSEWVSCVRFSPMTNNPIIVSGGWDKLVKVFNLSNCKLKCNLVGHAGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG IIH+L FSPNRYWLCAAT+ 
Sbjct  197  INTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDIIHSLVFSPNRYWLCAATQT  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESKS+V DLR +  +             K  I +C SL+W+ADGSTL++GY+D
Sbjct  257  SIKIWDLESKSVVDDLRPEFSK---------TFGKKATIPYCVSLAWSADGSTLYAGYSD  307

Query  222  GVIRVW  205
            G IRV+
Sbjct  308  GDIRVF  313


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 57/122 (47%), Gaps = 7/122 (6%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
            GH  WV+ +          I+S S D+TV VW L   +         L GH+ +V  V +
Sbjct  13   GHRGWVTAIATPLDPNADVILSASRDKTVIVWKLDRSETNYGVAHKALKGHSHFVQDVVI  72

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL +G         +  + ++ FS  NR  +  A + +IK+
Sbjct  73   SSDGQFALSGSWDGTLRLWDLQQGTTTRRFVGHTKDVLSVAFSVDNRQIVSGARDKTIKL  132

Query  390  WD  385
            W+
Sbjct  133  WN  134



>ref|XP_005711409.1| receptor for activated protein kinase C [Chondrus crispus]
 emb|CDF41115.1| receptor for activated protein kinase C [Chondrus crispus]
Length=320

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 146/189 (77%), Gaps = 10/189 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+ +GH EWVSCVRFSPST  P IVS  WD+ VKVWNL+NCKLR+ L  H+GY
Sbjct  139  GECKYTIQE-EGHTEWVSCVRFSPSTQNPLIVSCGWDKLVKVWNLTNCKLRTNLHNHSGY  197

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +N V VSPDGSLCASGGKDGV +LWDL EGK LYSL+A  IIHALCFSPNRYWLCAAT +
Sbjct  198  LNAVTVSPDGSLCASGGKDGVAMLWDLQEGKHLYSLEANDIIHALCFSPNRYWLCAATNS  257

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLESK++V +LR D         +  +   K     C SL+W+ADGSTLFSGYTD
Sbjct  258  CIKIWDLESKTVVDELRDD---------QAESIGKKAAQPACISLTWSADGSTLFSGYTD  308

Query  222  GVIRVWGIG  196
             VIRVWG+G
Sbjct  309  NVIRVWGVG  317


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 52/193 (27%), Positives = 78/193 (40%), Gaps = 26/193 (13%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G   Y  +   GH  +VS V  S        +S SWD T+++W+LS         GH+  
Sbjct  53   GSYGYPKRALRGHGHFVSDVVLSSD--GQFALSSSWDHTLRLWDLSTGVTTRRFVGHSKD  110

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALC--FSP---NRYWLC  418
            V +VA S D     SG +D  I LW+     K    + G      C  FSP   N   + 
Sbjct  111  VLSVAFSADNRQIVSGSRDRTIKLWNTLGECKYTIQEEGHTEWVSCVRFSPSTQNPLIVS  170

Query  417  AATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLF  238
               +  +K+W+L +      LR +L   S                +  +++ + DGS   
Sbjct  171  CGWDKLVKVWNLTN----CKLRTNLHNHSG---------------YLNAVTVSPDGSLCA  211

Query  237  SGYTDGVIRVWGI  199
            SG  DGV  +W +
Sbjct  212  SGGKDGVAMLWDL  224



>dbj|BAJ98167.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=332

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 152/195 (78%), Gaps = 16/195 (8%)
 Frame = -2

Query  762  GECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAG  595
            GECKYTI    G    H  WVSCVRFSP+   PTIVSGSWDR+VKVWNL+NCKLR TL G
Sbjct  146  GECKYTIGGDLGGGEGHTGWVSCVRFSPNNFAPTIVSGSWDRSVKVWNLTNCKLRCTLDG  205

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCA  415
            H GYV+ VAVSPDGSLCASGGKDGV LLWDL EGK+LYSLDAGSII++LCFSPNRYWLCA
Sbjct  206  HGGYVSAVAVSPDGSLCASGGKDGVTLLWDLTEGKRLYSLDAGSIINSLCFSPNRYWLCA  265

Query  414  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  235
            AT+ SIKIWDLESK IV DLR ++   S+            ++++CT LSW+ADGSTL++
Sbjct  266  ATQDSIKIWDLESKHIVQDLRPEVPVSSK------------QMLYCTCLSWSADGSTLYA  313

Query  234  GYTDGVIRVWGIGRY  190
            GYTDG IR++ I  +
Sbjct  314  GYTDGTIRIYKISGF  328


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 28/192 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST-------------LAGHT  589
            GHN+ V+ +  +P    P IVS S D+++ VW+L+N  +++T             L GH 
Sbjct  16   GHNDVVTAIA-TPIDNSPFIVSSSRDKSLLVWDLTN-PIQATQDTSSEYGVPFRRLTGHG  73

Query  588  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCA  415
             +V  V +S DG    SG  DG + LWDL+ G   + +      ++       NR  + A
Sbjct  74   HFVQDVVLSSDGQFALSGSWDGELRLWDLSTGVTTRRFVGHEKDVLSVAFSIDNRQIVSA  133

Query  414  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  235
            + + +IK+W+   +            +  +  +          + C   S N    T+ S
Sbjct  134  SRDRTIKLWNTLGEC-----------KYTIGGDLGGGEGHTGWVSCVRFSPNNFAPTIVS  182

Query  234  GYTDGVIRVWGI  199
            G  D  ++VW +
Sbjct  183  GSWDRSVKVWNL  194



>emb|CDM83867.1| unnamed protein product [Triticum aestivum]
Length=332

 Score =   260 bits (665),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 151/195 (77%), Gaps = 16/195 (8%)
 Frame = -2

Query  762  GECKYTIQDGDG----HNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAG  595
            GECKYTI    G    H  WVSCVRFSP+   PTIVSGSWDR+VKVWNL+NCKLR TL G
Sbjct  146  GECKYTIGGDLGGGEGHTGWVSCVRFSPNNFAPTIVSGSWDRSVKVWNLTNCKLRCTLDG  205

Query  594  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCA  415
            H GYV+ VAVSPDGSLCASGGKDGV LLWDL EGK+LYSLDAGSII++LCFSPNRYWLCA
Sbjct  206  HGGYVSAVAVSPDGSLCASGGKDGVTLLWDLTEGKRLYSLDAGSIINSLCFSPNRYWLCA  265

Query  414  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  235
            AT+ SIKIWDLESK IV DLR ++              +  ++++CT LSW+ADGSTL++
Sbjct  266  ATQDSIKIWDLESKHIVQDLRPEVP------------VSTKQMLYCTCLSWSADGSTLYA  313

Query  234  GYTDGVIRVWGIGRY  190
            GYTDG IR++ I  +
Sbjct  314  GYTDGTIRIYKISGF  328


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 28/192 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRST-------------LAGHT  589
            GHN+ V+ +  +P    P IVS S D+++ VW+L+N  +++T             L GH 
Sbjct  16   GHNDVVTAIA-TPIDNSPFIVSSSRDKSLLVWDLTN-PIQATQDSSSEYGVPFRRLTGHG  73

Query  588  GYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCA  415
             +V  V +S DG    SG  DG + LWDL+ G   + +      ++       NR  + A
Sbjct  74   HFVQDVVLSSDGQFALSGSWDGELRLWDLSTGVTTRRFVGHEKDVLSVAFSIDNRQIVSA  133

Query  414  ATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFS  235
            + + +IK+W+   +            +  +  +          + C   S N    T+ S
Sbjct  134  SRDRTIKLWNTLGEC-----------KYTIGGDLGGGEGHTGWVSCVRFSPNNFAPTIVS  182

Query  234  GYTDGVIRVWGI  199
            G  D  ++VW +
Sbjct  183  GSWDRSVKVWNL  194



>gb|KDD72035.1| hypothetical protein H632_c3969p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=262

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 149/190 (78%), Gaps = 10/190 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
             ECKYT+ +  GH  WVSCVR SP    P +VS SWD+TVK+W+L++CKLR+TL+GH GY
Sbjct  82   AECKYTMAEPSGHTGWVSCVRLSPVGATPVVVSASWDKTVKIWDLASCKLRATLSGHEGY  141

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VN V +SPDGSLCASGGKDG  +LWDLAEGK+LY+L+AG +IH+L FSPNRYWLCAAT++
Sbjct  142  VNAVTISPDGSLCASGGKDGSAMLWDLAEGKQLYTLEAGDVIHSLVFSPNRYWLCAATQS  201

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLE KS+V DLR +L + S          AK ++ +  SL+W+ADGSTL++GYTD
Sbjct  202  GIKIWDLEFKSVVDDLRPELPERS----------AKAQVPYPISLTWSADGSTLYAGYTD  251

Query  222  GVIRVWGIGR  193
            GVIRVW +GR
Sbjct  252  GVIRVWQVGR  261



>emb|CDY59680.1| BnaA05g36460D [Brassica napus]
Length=225

 Score =   256 bits (653),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 150/199 (75%), Gaps = 21/199 (11%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWD-------------------RTVKVWNLSNCKLRS  607
            GH+ +V  V  S        +SGSWD                    T  VWNL+NCKLR+
Sbjct  29   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGASTRRFVGHTKDVWNLANCKLRN  86

Query  606  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  427
            TLAGH+GY+NTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSL+AGSIIH+LCFSPNRY
Sbjct  87   TLAGHSGYLNTVAVSPDGSLCASGGKDGAILLWDLAEGKKLYSLEAGSIIHSLCFSPNRY  146

Query  426  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  247
            WLCAATE SI+IWDLESKS+V DL+VDLK E+E S     T  K K+I+CTSL+W+ADG+
Sbjct  147  WLCAATENSIRIWDLESKSVVEDLKVDLKAEAEKSDVSAATGNKTKVIYCTSLNWSADGN  206

Query  246  TLFSGYTDGVIRVWGIGRY  190
            TLFSGYTDGVIRVWGIG Y
Sbjct  207  TLFSGYTDGVIRVWGIGHY  225



>dbj|BAF47116.1| G protein beta-subunit-like protein [Nicotiana tabacum]
Length=144

 Score =   253 bits (645),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 132/144 (92%), Gaps = 1/144 (1%)
 Frame = -2

Query  681  QPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDL  502
            Q TIVSGSWDRTVK+WNL+NCKLRSTLAGH GYVNTVAVSPDGSLCASGGKDG ILLWDL
Sbjct  1    QRTIVSGSWDRTVKIWNLTNCKLRSTLAGHGGYVNTVAVSPDGSLCASGGKDGTILLWDL  60

Query  501  AEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMS  322
            AEGKKLYSLDAGSIIHALCFSPNRYWLCAATE SIKIWDLESKS+VVDL+VDLKQESEM+
Sbjct  61   AEGKKLYSLDAGSIIHALCFSPNRYWLCAATETSIKIWDLESKSVVVDLKVDLKQESEMA  120

Query  321  AEGNN-TAAKNKIIFCTSLSWNAD  253
             EG    A KNKI++CT LSW AD
Sbjct  121  TEGTTGPACKNKIMYCTCLSWCAD  144



>ref|XP_007508318.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20422.1| predicted protein [Bathycoccus prasinos]
Length=318

 Score =   258 bits (660),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 146/190 (77%), Gaps = 10/190 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQ+ +GH EWVSCVRFSP+   P IVS  WD+ VKVWNL+NCKLR+ L GHTGY
Sbjct  135  GECKYTIQEHEGHTEWVSCVRFSPAPSNPIIVSCGWDKLVKVWNLNNCKLRTNLVGHTGY  194

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG II+++CFSPNRYWLCAAT++
Sbjct  195  INTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAGDIIYSMCFSPNRYWLCAATQS  254

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             +KIWDLESKSIV           E+  E      K+    CTSL W+ADG TL++GY+D
Sbjct  255  CVKIWDLESKSIV----------DELHPEFPPVGKKSMPPHCTSLQWSADGQTLYTGYSD  304

Query  222  GVIRVWGIGR  193
              +RV+ + R
Sbjct  305  NKVRVYVVSR  314


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 61/123 (50%), Gaps = 8/123 (7%)
 Frame = -2

Query  732  DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVA  568
            +GH  WV+ +  +P      +++ S D++V +W L+  +      R  L GH+ +V  V 
Sbjct  11   EGHEGWVTSIA-TPLDNSDILLTSSRDKSVILWTLTREEGNYGYPRRRLHGHSHFVQDVV  69

Query  567  VSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIK  394
            +S DG    SG  DG + LWDL  G         S  + ++ FS  NR  +  + + +IK
Sbjct  70   ISSDGQFALSGSWDGTLRLWDLNSGTTTRRFVGHSKDVLSVAFSVDNRQIVSGSRDKTIK  129

Query  393  IWD  385
            +W+
Sbjct  130  LWN  132



>dbj|BAF47119.1| G protein beta-subunit-like protein [Nicotiana tabacum]
Length=144

 Score =   249 bits (637),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 132/144 (92%), Gaps = 1/144 (1%)
 Frame = -2

Query  681  QPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDL  502
            Q TIVSGSWDRTVK+WNL+NCKLRSTLAGH GYVNTVAVSPDGSLCAS GKDG ILLWDL
Sbjct  1    QRTIVSGSWDRTVKIWNLTNCKLRSTLAGHGGYVNTVAVSPDGSLCASRGKDGTILLWDL  60

Query  501  AEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMS  322
            AEGKKLYSLDAGSIIHALCFSPNRYWLCAATE SIKIWDLESKS+VVDL+VDL+QESEM+
Sbjct  61   AEGKKLYSLDAGSIIHALCFSPNRYWLCAATETSIKIWDLESKSVVVDLKVDLEQESEMA  120

Query  321  AEGNN-TAAKNKIIFCTSLSWNAD  253
             EG   +A KNKI++CT LSW AD
Sbjct  121  TEGTTGSACKNKIMYCTCLSWCAD  144



>emb|CDY71917.1| BnaCnng75080D [Brassica napus]
Length=244

 Score =   253 bits (646),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 152/199 (76%), Gaps = 24/199 (12%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWD-------------------RTVKVWNLSNCKLRS  607
            GH+ +V  V  S        +SGSWD                    T  VWNL+NCKLR+
Sbjct  51   GHSHFVEDVVLSSD--GQFALSGSWDGELRLWDLATGASTRRFVGHTKDVWNLANCKLRN  108

Query  606  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRY  427
            TLAGH+GY+NTVAVSPDGSLCASGGKDG ILLWDLAEGKKLY L+AGSIIH+LCFSPNRY
Sbjct  109  TLAGHSGYLNTVAVSPDGSLCASGGKDGGILLWDLAEGKKLYCLEAGSIIHSLCFSPNRY  168

Query  426  WLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGS  247
            WLCAATE SI+IWDLESKS+V DL+VDLK ES++SA    T  K K+I+CTSL+W+ADG+
Sbjct  169  WLCAATENSIRIWDLESKSVVEDLKVDLKAESDVSA---GTGNKTKVIYCTSLNWSADGN  225

Query  246  TLFSGYTDGVIRVWGIGRY  190
            TLFSGYTDGVIRVWGIGRY
Sbjct  226  TLFSGYTDGVIRVWGIGRY  244



>ref|XP_009836542.1| guanine nucleotide-binding protein subunit beta-like protein 
[Aphanomyces astaci]
 gb|ETV74029.1| guanine nucleotide-binding protein subunit beta-like protein 
[Aphanomyces astaci]
Length=318

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 146/189 (77%), Gaps = 11/189 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + +GH EWVSCVRFSPS+  P IVS  WDR VKVWNL+NCKLR+ L GHTGY
Sbjct  139  GECKYTITE-EGHTEWVSCVRFSPSSANPLIVSAGWDRLVKVWNLTNCKLRTNLCGHTGY  197

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDGV +LWDL EGK+LYSL+A  IIHAL FSPNRYWL AAT +
Sbjct  198  LNTVTVSPDGSLCASGGKDGVAMLWDLNEGKRLYSLEANDIIHALVFSPNRYWLVAATSS  257

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            +IKIWDLESK +VVD         E+  E  N   K++     SL+W+ADG TLF+GYTD
Sbjct  258  AIKIWDLESK-VVVD---------ELVPEFENVGKKSQPPHAVSLAWSADGQTLFAGYTD  307

Query  222  GVIRVWGIG  196
            G++RV+ +G
Sbjct  308  GIVRVYAVG  316


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 62/127 (49%), Gaps = 13/127 (10%)
 Frame = -2

Query  735  GDGHNEWVSCVRFSPSTLQPT-IVSGSWDRTVKVWNLSNCK-------LRSTLAGHTGYV  580
            G G N WV+ +  + S   P  +V+ S D++V VW L++          R  L GH+ +V
Sbjct  13   GHGKN-WVTAI--ATSRENPNLVVTSSRDKSVLVWQLTHDADPDNYGYARRRLTGHSHFV  69

Query  579  NTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATE  406
              V +S DG    SG  DG + LWDL  G   + +   +  ++     + NR  +  + +
Sbjct  70   EDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHSKDVLSVAFSADNRQIVSGSRD  129

Query  405  ASIKIWD  385
             SIK+W+
Sbjct  130  RSIKLWN  136



>ref|XP_002903189.1| guanine nucleotide-binding protein subunit beta-2-like protein 
[Phytophthora infestans T30-4]
 ref|XP_008893306.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica INRA-310]
 gb|EEY55613.1| guanine nucleotide-binding protein subunit beta-2-like protein 
[Phytophthora infestans T30-4]
 gb|ETK85071.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica]
 gb|ETL38496.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica]
 gb|ETL91623.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica]
 gb|ETN21521.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica INRA-310]
 gb|ETO73708.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica P1976]
 gb|ETP14913.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica CJ01A1]
Length=317

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 145/189 (77%), Gaps = 10/189 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + DGH EWVSCVRFSPST  P IVS  WD+ VK+WNLSNCKLR+ L GH GY
Sbjct  138  GECKYTITE-DGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWNLSNCKLRTNLFGHEGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGS+CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRYWLCAAT +
Sbjct  197  LNTVTVSPDGSICASGGKDGTANLWDLNEGKRLYSLVAGDVIHALIFSPNRYWLCAATTS  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLESK +V DL+ ++++     A+  +         C SL+W+ADGS LFSGYTD
Sbjct  257  GIKIWDLESKIVVHDLQPEIEEPKGKYAQPPH---------CISLAWSADGSVLFSGYTD  307

Query  222  GVIRVWGIG  196
            G++RVW +G
Sbjct  308  GIVRVWAVG  316


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 63/133 (47%), Gaps = 15/133 (11%)
 Frame = -2

Query  750  YTIQDGDGHN----EWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLA  598
            Y   + DGHN      ++  R +P+ L    ++ S D+++ VW LSN        R  L 
Sbjct  7    YPRAELDGHNGKAVTAIATTRENPNLL----LTASRDKSLLVWQLSNDGEEYGFARRRLQ  62

Query  597  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYW  424
            GH+ YV  V +S DG    SG  DG + LWDL  G   + +      ++     + NR  
Sbjct  63   GHSHYVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNRQI  122

Query  423  LCAATEASIKIWD  385
            +  + + ++K+W+
Sbjct  123  VSGSRDKTVKLWN  135


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 87/202 (43%), Gaps = 30/202 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD T+++W+L+         GHT  V +VA S D  
Sbjct  63   GHSHYVEDVVISSD--GQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNR  120

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI-IHALCFSP---NRYWLCAATEASIKIWD  385
               SG +D  + LW+ L E K   + D  +  +  + FSP   N   +    +  +KIW+
Sbjct  121  QIVSGSRDKTVKLWNTLGECKYTITEDGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWN  180

Query  384  LESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW  205
            L +      LR +L        EG          +  +++ + DGS   SG  DG   +W
Sbjct  181  LSN----CKLRTNL-----FGHEG----------YLNTVTVSPDGSICASGGKDGTANLW  221

Query  204  GIGRY*MEEFRRSHMIIGHVCY  139
             +     E  R   ++ G V +
Sbjct  222  DLN----EGKRLYSLVAGDVIH  239



>ref|XP_010926201.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=299

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 134/161 (83%), Gaps = 12/161 (7%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTIQD D H  WVSCVRFSP+T QPTIVSGSWDRTVKVWNL++CKLRSTL GH GY
Sbjct  150  GECKYTIQDADAHTNWVSCVRFSPNTSQPTIVSGSWDRTVKVWNLTSCKLRSTLTGHGGY  209

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VN VAVSPDGSLCASGGKDGV LLWDLAEG++LYSLDAG+IIH LCFSP+RYWLCAAT+ 
Sbjct  210  VNAVAVSPDGSLCASGGKDGVALLWDLAEGRRLYSLDAGAIIHGLCFSPSRYWLCAATQD  269

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIF  280
            S+KIWDLESKSIV DLR ++              +KN+++F
Sbjct  270  SVKIWDLESKSIVQDLRPEMP------------TSKNQVLF  298


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 51/200 (26%), Positives = 82/200 (41%), Gaps = 41/200 (21%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-------------------RS  607
            GH++ V+ +  +P      IVS S D++V VW+L+                       R 
Sbjct  13   GHSDVVTAIA-TPLDNSDMIVSSSRDKSVLVWHLTKASPVAVAGDSSATSAVPSYGVPRR  71

Query  606  TLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPN  433
             L GH+ +V  V +S DG    SG  DG + LWDLA G   + +   +  ++  +    N
Sbjct  72   RLTGHSHFVEDVVLSSDGQFALSGSWDGELRLWDLATGTTTRRFVGHSKDVLSVVLSVDN  131

Query  432  RYWLCAATEASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWN  259
            R  + A+ + +IK+W+   E K  + D                   A    + C   S N
Sbjct  132  RQIVSASRDRTIKLWNTLGECKYTIQD-----------------ADAHTNWVSCVRFSPN  174

Query  258  ADGSTLFSGYTDGVIRVWGI  199
                T+ SG  D  ++VW +
Sbjct  175  TSQPTIVSGSWDRTVKVWNL  194



>gb|ETM44908.1| guanine nucleotide-binding protein subunit beta-like protein, 
partial [Phytophthora parasitica]
Length=334

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 145/189 (77%), Gaps = 10/189 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + DGH EWVSCVRFSPST  P IVS  WD+ VK+WNLSNCKLR+ L GH GY
Sbjct  155  GECKYTITE-DGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWNLSNCKLRTNLFGHEGY  213

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGS+CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRYWLCAAT +
Sbjct  214  LNTVTVSPDGSICASGGKDGTANLWDLNEGKRLYSLVAGDVIHALIFSPNRYWLCAATTS  273

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLESK +V DL+ ++++     A+  +         C SL+W+ADGS LFSGYTD
Sbjct  274  GIKIWDLESKIVVHDLQPEIEEPKGKYAQPPH---------CISLAWSADGSVLFSGYTD  324

Query  222  GVIRVWGIG  196
            G++RVW +G
Sbjct  325  GIVRVWAVG  333


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 63/133 (47%), Gaps = 15/133 (11%)
 Frame = -2

Query  750  YTIQDGDGHN----EWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLA  598
            Y   + DGHN      ++  R +P+ L    ++ S D+++ VW LSN        R  L 
Sbjct  24   YPRAELDGHNGKAVTAIATTRENPNLL----LTASRDKSLLVWQLSNDGEEYGFARRRLQ  79

Query  597  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYW  424
            GH+ YV  V +S DG    SG  DG + LWDL  G   + +      ++     + NR  
Sbjct  80   GHSHYVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNRQI  139

Query  423  LCAATEASIKIWD  385
            +  + + ++K+W+
Sbjct  140  VSGSRDKTVKLWN  152


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 87/202 (43%), Gaps = 30/202 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD T+++W+L+         GHT  V +VA S D  
Sbjct  80   GHSHYVEDVVISSD--GQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNR  137

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI-IHALCFSP---NRYWLCAATEASIKIWD  385
               SG +D  + LW+ L E K   + D  +  +  + FSP   N   +    +  +KIW+
Sbjct  138  QIVSGSRDKTVKLWNTLGECKYTITEDGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWN  197

Query  384  LESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW  205
            L +      LR +L        EG          +  +++ + DGS   SG  DG   +W
Sbjct  198  LSN----CKLRTNL-----FGHEG----------YLNTVTVSPDGSICASGGKDGTANLW  238

Query  204  GIGRY*MEEFRRSHMIIGHVCY  139
             +     E  R   ++ G V +
Sbjct  239  DLN----EGKRLYSLVAGDVIH  256



>ref|XP_009531042.1| hypothetical protein PHYSODRAFT_355000 [Phytophthora sojae]
 gb|EGZ13613.1| hypothetical protein PHYSODRAFT_355000 [Phytophthora sojae]
Length=317

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 145/189 (77%), Gaps = 10/189 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + DGH EWVSCVRFSPST  P IVS  WD+ VK+WNLSNCKLR+ L GH GY
Sbjct  138  GECKYTITE-DGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWNLSNCKLRTNLFGHEGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGS+CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRYWLCAAT +
Sbjct  197  LNTVTVSPDGSICASGGKDGTANLWDLNEGKRLYSLVAGDVIHALVFSPNRYWLCAATTS  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLESK +V DL+ ++++     A+  +         C SL+W+ADG+ LFSGYTD
Sbjct  257  GIKIWDLESKIVVHDLQPEVEEPKGKYAQPPH---------CISLAWSADGTVLFSGYTD  307

Query  222  GVIRVWGIG  196
            G++RVW +G
Sbjct  308  GIVRVWAVG  316


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 63/133 (47%), Gaps = 15/133 (11%)
 Frame = -2

Query  750  YTIQDGDGHN----EWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLA  598
            Y   + DGHN      ++  R +P+ L    ++ S D+++ VW LSN        R  L 
Sbjct  7    YPRAELDGHNGKAVTALATTRENPNLL----LTASRDKSLLVWQLSNDGEEYGFARRRLQ  62

Query  597  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYW  424
            GH+ YV  V +S DG    SG  DG + LWDL  G   + +      ++     + NR  
Sbjct  63   GHSHYVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNRQI  122

Query  423  LCAATEASIKIWD  385
            +  + + ++K+W+
Sbjct  123  VSGSRDKTVKLWN  135


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 87/202 (43%), Gaps = 30/202 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD T+++W+L+         GHT  V +VA S D  
Sbjct  63   GHSHYVEDVVISSD--GQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNR  120

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI-IHALCFSP---NRYWLCAATEASIKIWD  385
               SG +D  + LW+ L E K   + D  +  +  + FSP   N   +    +  +KIW+
Sbjct  121  QIVSGSRDKTVKLWNTLGECKYTITEDGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWN  180

Query  384  LESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW  205
            L +      LR +L        EG          +  +++ + DGS   SG  DG   +W
Sbjct  181  LSN----CKLRTNL-----FGHEG----------YLNTVTVSPDGSICASGGKDGTANLW  221

Query  204  GIGRY*MEEFRRSHMIIGHVCY  139
             +     E  R   ++ G V +
Sbjct  222  DLN----EGKRLYSLVAGDVIH  239



>gb|KDO19117.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Saprolegnia 
parasitica CBS 223.65]
Length=326

 Score =   252 bits (644),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 146/189 (77%), Gaps = 11/189 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + +GH EWVSCVRFSPS+  P IVS  WDR VKVWNL+NCKLR+ L GHTGY
Sbjct  147  GECKYTITE-EGHTEWVSCVRFSPSSANPLIVSCGWDRLVKVWNLTNCKLRTNLCGHTGY  205

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDGV +LWDL EGK+LY+L+AG IIHAL FSPNRYWLCAAT +
Sbjct  206  LNTVTVSPDGSLCASGGKDGVAMLWDLNEGKRLYTLEAGDIIHALVFSPNRYWLCAATSS  265

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLESK +VVD         E+  E      K+    C SL W+ADG++LF+GYTD
Sbjct  266  GIKIWDLESK-VVVD---------EIVPEFEAVGKKSLPPHCVSLCWSADGASLFAGYTD  315

Query  222  GVIRVWGIG  196
            G++RV+ +G
Sbjct  316  GIVRVYAVG  324


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 62/129 (48%), Gaps = 18/129 (14%)
 Frame = -2

Query  729  GHNE-WVSCV---RFSPSTLQPTIVSGSWDRTVKVWNLSNCK--------LRSTLAGHTG  586
            GH + WV+ +   R +PS     IV+ S D+++ VW L+            R  L GH+ 
Sbjct  20   GHGKAWVTAIATSRENPSM----IVTASRDKSILVWQLTGDSSDLENYGFARRRLQGHSH  75

Query  585  YVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAA  412
            +V  V +S DG    SG  DG + LWDL  G   + +   +  ++     + NR  +  +
Sbjct  76   FVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHSKDVLSVAFSADNRQIVSGS  135

Query  411  TEASIKIWD  385
             + SIK+W+
Sbjct  136  RDRSIKLWN  144



>ref|XP_008608530.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Saprolegnia 
diclina VS20]
 gb|EQC38203.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Saprolegnia 
diclina VS20]
Length=319

 Score =   252 bits (644),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 146/189 (77%), Gaps = 11/189 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + +GH EWVSCVRFSPS+  P IVS  WDR VKVWNL+NCKLR+ L GHTGY
Sbjct  140  GECKYTITE-EGHTEWVSCVRFSPSSANPLIVSCGWDRLVKVWNLTNCKLRTNLCGHTGY  198

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDGV +LWDL EGK+LY+L+AG IIHAL FSPNRYWLCAAT +
Sbjct  199  LNTVTVSPDGSLCASGGKDGVAMLWDLNEGKRLYTLEAGDIIHALVFSPNRYWLCAATSS  258

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLESK +VVD         E+  E      K+    C SL W+ADG++LF+GYTD
Sbjct  259  GIKIWDLESK-VVVD---------EIVPEFEAVGKKSLPPHCVSLCWSADGASLFAGYTD  308

Query  222  GVIRVWGIG  196
            G++RV+ +G
Sbjct  309  GIVRVYAVG  317


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 62/129 (48%), Gaps = 18/129 (14%)
 Frame = -2

Query  729  GHNE-WVSCV---RFSPSTLQPTIVSGSWDRTVKVWNLSNCK--------LRSTLAGHTG  586
            GH + WV+ +   R +PS     IV+ S D+++ VW L+            R  L GH+ 
Sbjct  13   GHGKAWVTAIATSRENPSM----IVTASRDKSILVWQLTGDSSDLENYGFARRRLQGHSH  68

Query  585  YVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAA  412
            +V  V +S DG    SG  DG + LWDL  G   + +   +  ++     + NR  +  +
Sbjct  69   FVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHSKDVLSVAFSADNRQIVSGS  128

Query  411  TEASIKIWD  385
             + SIK+W+
Sbjct  129  RDRSIKLWN  137



>ref|XP_011397272.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Auxenochlorella protothecoides]
 gb|KFM24384.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Auxenochlorella protothecoides]
Length=317

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 146/190 (77%), Gaps = 11/190 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
             ECK+T+ +  GH EWVSCVR SP +  P IVS SWD+TVKVWNL +CKLR TL+GH GY
Sbjct  138  AECKFTVAEPAGHTEWVSCVRLSPVSKPPLIVSASWDKTVKVWNLQDCKLRDTLSGHRGY  197

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +N+V VSPDGSLCASGGKDGV +LWDL+ GK LYSLDAG++I+AL FSPNRYWLCAAT+ 
Sbjct  198  INSVTVSPDGSLCASGGKDGVAMLWDLSVGKHLYSLDAGNVINALVFSPNRYWLCAATDR  257

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLE KS+V DL   L        EG   A + K +   SL+W+ADG+TL+SGYTD
Sbjct  258  GIKIWDLEYKSVVDDLDAPL--------EGVEAAKQPKPV---SLAWSADGATLYSGYTD  306

Query  222  GVIRVWGIGR  193
            GVIRVW +GR
Sbjct  307  GVIRVWAVGR  316


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/209 (24%), Positives = 86/209 (41%), Gaps = 32/209 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK------LRSTLAGHTGYVNTVA  568
            GH  WV+ +          +V+ S D++V VW L+  +       R +L GH+ YV  V 
Sbjct  13   GHRGWVTAIAPPLDPNSDLLVTSSRDKSVIVWTLTRGEKEDYGFARRSLRGHSHYVQDVV  72

Query  567  VSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIK  394
            +S D     SG  DG + LWDL +G   + +      ++     + NR  L  + + SIK
Sbjct  73   LSSDAQYALSGSWDGTMRLWDLNKGTTTRRFLGHTKDVLSVAISADNRQILSGSRDKSIK  132

Query  393  IWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDG  220
            +W+   E K  V +                  A   + + C  LS  +    + S   D 
Sbjct  133  LWNTLAECKFTVAE-----------------PAGHTEWVSCVRLSPVSKPPLIVSASWDK  175

Query  219  VIRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
             ++VW      +++ +    + GH  Y++
Sbjct  176  TVKVWN-----LQDCKLRDTLSGHRGYIN  199


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 81/183 (44%), Gaps = 27/183 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD T+++W+L+         GHT  V +VA+S D  
Sbjct  63   GHSHYVQDVVLSSDA--QYALSGSWDGTMRLWDLNKGTTTRRFLGHTKDVLSVAISADNR  120

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAG-----SIIHALCFSPNRYWLCAATEASIKIW  388
               SG +D  I LW+ LAE K   +  AG     S +     S     + A+ + ++K+W
Sbjct  121  QILSGSRDKSIKLWNTLAECKFTVAEPAGHTEWVSCVRLSPVSKPPLIVSASWDKTVKVW  180

Query  387  DLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRV  208
            +L+          D K    +S             +  S++ + DGS   SG  DGV  +
Sbjct  181  NLQ----------DCKLRDTLSGHRG---------YINSVTVSPDGSLCASGGKDGVAML  221

Query  207  WGI  199
            W +
Sbjct  222  WDL  224



>ref|XP_004343796.1| guanine nucleotide-binding protein [Capsaspora owczarzaki ATCC 
30864]
 gb|KJE96804.1| guanine nucleotide-binding protein [Capsaspora owczarzaki ATCC 
30864]
Length=316

 Score =   251 bits (642),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 147/191 (77%), Gaps = 11/191 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECK+ IQ+ DGH+EWVS VRFSP+T  P IVS  WDR VKVWNL+NCKLR+   GHTGY
Sbjct  136  GECKFVIQE-DGHSEWVSSVRFSPNTSNPNIVSVGWDRVVKVWNLNNCKLRTNHYGHTGY  194

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTV VSPDGSLCASGGKDGV +LWDL EGK LY+L+AG  I+AL FSPNRYWLCAA+ A
Sbjct  195  VNTVTVSPDGSLCASGGKDGVAMLWDLNEGKHLYTLEAGDEINALVFSPNRYWLCAASGA  254

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLESK++V DLR           E  +   K+++  C SL+W+ADG TLF+GYTD
Sbjct  255  SIKIWDLESKNLVDDLR----------PEFLSVGKKSQLPQCISLAWSADGQTLFAGYTD  304

Query  222  GVIRVWGIGRY  190
             VIRVW + R+
Sbjct  305  NVIRVWQVTRH  315


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 61/122 (50%), Gaps = 8/122 (7%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
            GH+ WV+ +  +P  +   +VS S D+++ +WNL+  +      +  L GH  +V+ V +
Sbjct  13   GHSGWVTQIATTPE-VPDLLVSASRDKSLIIWNLTRDETNYGVPKRRLQGHNHFVSDVVI  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  D  + LWDL  G   + +      ++     + NR  +  + + SI++
Sbjct  72   SSDGQFALSGSWDHTLRLWDLNSGVTTRRFVGHTSDVLSVAFSADNRQIVSGSRDKSIRL  131

Query  390  WD  385
            W+
Sbjct  132  WN  133


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 80/182 (44%), Gaps = 26/182 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GHN +VS V  S        +SGSWD T+++W+L++        GHT  V +VA S D  
Sbjct  61   GHNHFVSDVVISSDG--QFALSGSWDHTLRLWDLNSGVTTRRFVGHTSDVLSVAFSADNR  118

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI-IHALCFSPNR---YWLCAATEASIKIWD  385
               SG +D  I LW+ L E K +   D  S  + ++ FSPN      +    +  +K+W+
Sbjct  119  QIVSGSRDKSIRLWNTLGECKFVIQEDGHSEWVSSVRFSPNTSNPNIVSVGWDRVVKVWN  178

Query  384  LESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW  205
            L +  +                    T       +  +++ + DGS   SG  DGV  +W
Sbjct  179  LNNCKL-------------------RTNHYGHTGYVNTVTVSPDGSLCASGGKDGVAMLW  219

Query  204  GI  199
             +
Sbjct  220  DL  221



>emb|CCI48432.1| unnamed protein product [Albugo candida]
Length=318

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 145/189 (77%), Gaps = 10/189 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + +GH+EWVSCVRFSPS+  P IVS  WD+ VK+WNL+NCKL + L GHTGY
Sbjct  139  GECKYTITE-NGHSEWVSCVRFSPSSSNPLIVSCGWDKAVKIWNLTNCKLHTNLLGHTGY  197

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +N+V VSPDGS+CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRYWLCAAT +
Sbjct  198  LNSVTVSPDGSICASGGKDGTANLWDLNEGKRLYSLVAGDVIHALVFSPNRYWLCAATSS  257

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLESK++V +L  DL+      A         ++  C SL+W+ADGS LFSGYTD
Sbjct  258  GIKIWDLESKAVVHELNPDLEPPKGKYA---------RVPHCVSLAWSADGSILFSGYTD  308

Query  222  GVIRVWGIG  196
            G++RVW +G
Sbjct  309  GIVRVWAVG  317


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 64/133 (48%), Gaps = 15/133 (11%)
 Frame = -2

Query  750  YTIQDGDGHN----EWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLS----NCKL-RSTLA  598
            Y   + DGHN      ++  R +P+ L    ++ S D++V VW L+    NC   R  L 
Sbjct  8    YLRGELDGHNGKCVSSIATSRENPNML----LTASHDKSVLVWQLTSDGENCGFPRRRLL  63

Query  597  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYW  424
            GH  YV  V +S DG    SG  D  + LWDL  G   + +   +  ++     + NR  
Sbjct  64   GHAHYVQDVVISSDGQFALSGSWDSTLRLWDLNTGNTTRRFVGHSKDVLSVAFSADNRQI  123

Query  423  LCAATEASIKIWD  385
            + A+ + +IK+W+
Sbjct  124  VSASRDKTIKLWN  136



>emb|CCA26420.1| guanine nucleotidebinding protein subunit beta2like protein putative 
[Albugo laibachii Nc14]
Length=318

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 145/189 (77%), Gaps = 10/189 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + +GH+EWVSCVRFSPS+  P IVS  WD+ VK+WNL+NCKL + L GHTGY
Sbjct  139  GECKYTITE-NGHSEWVSCVRFSPSSSNPLIVSCGWDKAVKIWNLTNCKLHTNLLGHTGY  197

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +N+V VSPDGS+CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRYWLCAAT +
Sbjct  198  LNSVTVSPDGSICASGGKDGTANLWDLNEGKRLYSLVAGDVIHALVFSPNRYWLCAATSS  257

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLESK++V +L  DL+      A         ++  C SL+W+ADGS LFSGYTD
Sbjct  258  GIKIWDLESKAVVHELNPDLEPPKGKYA---------RVPHCVSLAWSADGSILFSGYTD  308

Query  222  GVIRVWGIG  196
            G++RVW +G
Sbjct  309  GIVRVWAVG  317


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 62/131 (47%), Gaps = 11/131 (8%)
 Frame = -2

Query  750  YTIQDGDGHNEWVSCVR-FSPSTLQPTIV-SGSWDRTVKVWNLSN----CKL-RSTLAGH  592
            Y   + DGHN    CV   + S   P ++ + S D++V VW L++    C   R  L GH
Sbjct  8    YLRGELDGHNG--KCVSSIATSRENPNLLLTASHDKSVLVWQLTSDGESCGFPRRRLLGH  65

Query  591  TGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLC  418
              YV  V +S DG    SG  D  + LWDL  G   + +      ++     + NR  + 
Sbjct  66   AHYVQDVVISSDGQFALSGSWDSTLRLWDLNTGNTTRRFVGHTKDVLSVAFSADNRQIVS  125

Query  417  AATEASIKIWD  385
            A+ + +IK+W+
Sbjct  126  ASRDKTIKLWN  136



>ref|XP_009037831.1| hypothetical protein AURANDRAFT_37768 [Aureococcus anophagefferens]
 gb|EGB07194.1| hypothetical protein AURANDRAFT_37768 [Aureococcus anophagefferens]
Length=319

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 141/189 (75%), Gaps = 11/189 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI D +GH EWVSCVRFSPS   P IVS  WD+ VKVW+L+NCKLR+ L GH GY
Sbjct  141  GECKYTISD-EGHTEWVSCVRFSPSVQAPVIVSCGWDKLVKVWSLTNCKLRTNLYGHNGY  199

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK+LYSLDAG +IH+L FSPNRYWLCAAT  
Sbjct  200  LNTVTVSPDGSLCASGGKDGTAMLWDLNEGKRLYSLDAGDVIHSLVFSPNRYWLCAATTL  259

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             +KIWDLESK +V +L+       E  A G N        +CT + W+ADG+ LFSGYTD
Sbjct  260  GVKIWDLESKVVVDELK------PEFPAMGKNATPP----YCTCICWSADGAVLFSGYTD  309

Query  222  GVIRVWGIG  196
            G+IR W +G
Sbjct  310  GLIRAWHVG  318


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 63/127 (50%), Gaps = 13/127 (10%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNC----------KLRSTLAGHTGYV  580
            GH++WV+ +  + S     I+S S D+TV +W L+              R  L GH+ +V
Sbjct  13   GHSDWVTSIA-TTSEDPSMILSSSRDKTVLLWALTAGGGSAEGEAYGYPRRALKGHSHFV  71

Query  579  NTVAVSPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATE  406
            + V +S DG    SG  DG + LW+LA GK  + +      ++     + NR  +  + +
Sbjct  72   SDVVISSDGQFALSGSWDGTLRLWELATGKTTRRFVGHTKDVLSVAFSTDNRQIVSGSRD  131

Query  405  ASIKIWD  385
             ++K+W+
Sbjct  132  KTVKLWN  138



>gb|ACQ83470.1| receptor of activated protein kinase C [Platynereis dumerilii]
Length=318

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 142/188 (76%), Gaps = 10/188 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYTIQ  DGH++WVSCVRFSP+T  P IVS  WD+TVKVWNL+NCKL++   GHTGY
Sbjct  136  GVCKYTIQQEDGHSDWVSCVRFSPNTQNPIIVSCGWDKTVKVWNLTNCKLKTNHIGHTGY  195

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +N V VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II++LCFSPNRYWLCAAT  
Sbjct  196  LNVVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINSLCFSPNRYWLCAATGP  255

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K +V +LR           E  +T+ K +   C SL+W+ADG TLF+GYTD
Sbjct  256  SIKIWDLEGKVVVDELR----------PEVISTSPKAQPPQCISLAWSADGQTLFAGYTD  305

Query  222  GVIRVWGI  199
             VIRVW +
Sbjct  306  NVIRVWQV  313


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 88/206 (43%), Gaps = 28/206 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
            GH  WV+ +  +P      I+S S D+++ +W L+  +      +  L GH  +V+ V +
Sbjct  13   GHGNWVTQIATTPQ-YPDMILSASRDKSLIMWKLTRDETNYGIPQKALRGHGHFVSDVVM  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSL--DAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL+ G    +       ++     + NR  +  + + SIK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLSAGTTTRNFVGHTKDVLSVAFSADNRQIVSGSRDKSIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+      +   +  ++QE   S            + C   S N     + S   D  ++
Sbjct  132  WN-----TLGVCKYTIQQEDGHS----------DWVSCVRFSPNTQNPIIVSCGWDKTVK  176

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW +      + + +H  IGH  YL+
Sbjct  177  VWNLTNC---KLKTNH--IGHTGYLN  197



>gb|ETI45096.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica P1569]
Length=431

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 143/187 (76%), Gaps = 10/187 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + DGH EWVSCVRFSPST  P IVS  WD+ VK+WNLSNCKLR+ L GH GY
Sbjct  138  GECKYTITE-DGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWNLSNCKLRTNLFGHEGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGS+CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRYWLCAAT +
Sbjct  197  LNTVTVSPDGSICASGGKDGTANLWDLNEGKRLYSLVAGDVIHALIFSPNRYWLCAATTS  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLESK +V DL+ ++++     A+  +         C SL+W+ADGS LFSGYTD
Sbjct  257  GIKIWDLESKIVVHDLQPEIEEPKGKYAQPPH---------CISLAWSADGSVLFSGYTD  307

Query  222  GVIRVWG  202
            G++RVW 
Sbjct  308  GIVRVWA  314


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 63/133 (47%), Gaps = 15/133 (11%)
 Frame = -2

Query  750  YTIQDGDGHN----EWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLA  598
            Y   + DGHN      ++  R +P+ L    ++ S D+++ VW LSN        R  L 
Sbjct  7    YPRAELDGHNGKAVTAIATTRENPNLL----LTASRDKSLLVWQLSNDGEEYGFARRRLQ  62

Query  597  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYW  424
            GH+ YV  V +S DG    SG  DG + LWDL  G   + +      ++     + NR  
Sbjct  63   GHSHYVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNRQI  122

Query  423  LCAATEASIKIWD  385
            +  + + ++K+W+
Sbjct  123  VSGSRDKTVKLWN  135


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 80/182 (44%), Gaps = 26/182 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD T+++W+L+         GHT  V +VA S D  
Sbjct  63   GHSHYVEDVVISSD--GQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNR  120

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI-IHALCFSP---NRYWLCAATEASIKIWD  385
               SG +D  + LW+ L E K   + D  +  +  + FSP   N   +    +  +KIW+
Sbjct  121  QIVSGSRDKTVKLWNTLGECKYTITEDGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWN  180

Query  384  LESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW  205
            L +      LR +L        EG          +  +++ + DGS   SG  DG   +W
Sbjct  181  LSN----CKLRTNL-----FGHEG----------YLNTVTVSPDGSICASGGKDGTANLW  221

Query  204  GI  199
             +
Sbjct  222  DL  223



>emb|CEG76293.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
Length=278

 Score =   247 bits (631),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 141/190 (74%), Gaps = 10/190 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKY I + DGH EWVSCVRFSP+   P IVSG WD+ VKVW+L+  KLR+   GH GY
Sbjct  97   GECKYNITE-DGHTEWVSCVRFSPNPATPLIVSGGWDKLVKVWDLTKLKLRTNFIGHNGY  155

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTV +SPDGSLCAS GKDGV++LWDL + K LYSLDAGS++HAL FSPNRYWLCAAT  
Sbjct  156  VNTVTISPDGSLCASAGKDGVVMLWDLNDAKHLYSLDAGSVVHALTFSPNRYWLCAATAN  215

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLE+KSIV +LR +  Q  +          KN    C S++W+ADG+TLFSGY+D
Sbjct  216  GIKIWDLETKSIVDELRPEFAQLGKR---------KNPDPECLSVAWSADGATLFSGYSD  266

Query  222  GVIRVWGIGR  193
             +IRVW + R
Sbjct  267  NIIRVWQVTR  276



>ref|XP_002286095.1| guanine nucleotide binding protein beta subunit-like protein 
[Thalassiosira pseudonana CCMP1335]
 gb|EED95736.1| guanine nucleotide binding protein beta subunit-like protein 
[Thalassiosira pseudonana CCMP1335]
Length=326

 Score =   248 bits (634),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 144/187 (77%), Gaps = 6/187 (3%)
 Frame = -2

Query  762  GECKYTI-QDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  586
            GECKYTI  D  GH+EWVSCVRFSPS   P IVS  WDR VKVW L+NCKLR+ L GHTG
Sbjct  140  GECKYTIGTDAQGHSEWVSCVRFSPSQSVPLIVSCGWDRLVKVWALTNCKLRNDLIGHTG  199

Query  585  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  406
            Y+NTV VSPDGSLCASGGKDG  +LWDL EGK+LYSLDAG IIH+L FSPNRYWLCAAT+
Sbjct  200  YLNTVCVSPDGSLCASGGKDGTAMLWDLNEGKRLYSLDAGEIIHSLVFSPNRYWLCAATD  259

Query  405  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
              IKIWDLESK +V  LR    +E ++  E     A+     CTSL+W+ADGSTLF+GY+
Sbjct  260  ECIKIWDLESKVVVDTLR---PEEFDLGNEEGTGHARAP--HCTSLAWSADGSTLFAGYS  314

Query  225  DGVIRVW  205
            D VIRV+
Sbjct  315  DKVIRVY  321


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 51/213 (24%), Positives = 94/213 (44%), Gaps = 37/213 (17%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPT-IVSGSWDRTVKVWNLSNCKL---------RSTLAGHTGYV  580
            GH +WV+ +  + ++  P  I+S S D++V VW L++            +  L GH+ +V
Sbjct  13   GHRDWVTSI--ATTSEDPNLILSASRDKSVMVWRLTHSNTGEDDSYGYAQRALRGHSHFV  70

Query  579  NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATE  406
            + V +S DG    SG  DG + LW++  G+        S  + ++ FS  NR  +  + +
Sbjct  71   SDVVISSDGQFALSGSWDGTLRLWEINSGRTTRRFVGHSKDVLSVAFSVDNRQIVSGSRD  130

Query  405  ASIKIWDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSG  232
             SIK+W+   E K  +                G +    ++ + C   S +     + S 
Sbjct  131  KSIKLWNTLGECKYTI----------------GTDAQGHSEWVSCVRFSPSQSVPLIVSC  174

Query  231  YTDGVIRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
              D +++VW      +   +  + +IGH  YL+
Sbjct  175  GWDRLVKVWA-----LTNCKLRNDLIGHTGYLN  202



>ref|XP_005795376.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Xiphophorus maculatus]
Length=317

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 144/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYTIQD +GH EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  136  GVCKYTIQD-EGHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGY  194

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD+G II+ALCFSPNRYWLCAAT  
Sbjct  195  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDSGDIINALCFSPNRYWLCAATGP  254

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K IV +LR           E  +T +K +   CTSL+W+ADG TLF+GYTD
Sbjct  255  SIKIWDLEGKIIVDELR----------QEVISTNSKAEPPQCTSLAWSADGQTLFAGYTD  304

Query  222  GVIRVWGI  199
             +IRVW +
Sbjct  305  NLIRVWQV  312


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 92/206 (45%), Gaps = 29/206 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
            GH+ WV+ +  +P      I+S S D+++ +W L+  +      + +L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPQ-YPDMILSASRDKSIIMWKLTRDETNYGIPQRSLRGHSHFVSDVVI  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G   + +      ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGAWDGTLRLWDLTTGATTRQFVGHNKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+                +  +  EG+      + + C   S N+    + S   D +++
Sbjct  132  WNTLGVC-----------KYTIQDEGH-----TEWVSCVRFSPNSSNPIIVSCGWDKMVK  175

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW +      + + +H  IGH  YL+
Sbjct  176  VWNLANC---KLKTNH--IGHTGYLN  196



>gb|EIE78732.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Rhizopus 
delemar RA 99-880]
Length=311

 Score =   246 bits (629),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 142/190 (75%), Gaps = 10/190 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKY I + DGH+EWVSCVRFSP+   P IVSG WD+ VKVW+L+  KLR+   GH GY
Sbjct  130  GECKYNITE-DGHSEWVSCVRFSPNPANPLIVSGGWDKLVKVWDLTKLKLRTNFIGHNGY  188

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTV +SPDGSLCAS GKDGV++LWDL + K LYSLDAGS++HAL FSPNRYWLCAAT  
Sbjct  189  VNTVTISPDGSLCASAGKDGVVMLWDLNDAKHLYSLDAGSVVHALTFSPNRYWLCAATAN  248

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLE+KSIV +LR +  Q  +          KN    C S++W+ADG+TLFSGY+D
Sbjct  249  GIKIWDLETKSIVDELRPEFAQLGKR---------KNPDPECLSVAWSADGATLFSGYSD  299

Query  222  GVIRVWGIGR  193
             +IRVW + R
Sbjct  300  NIIRVWQVTR  309


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 74/162 (46%), Gaps = 24/162 (15%)
 Frame = -2

Query  669  VSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWD-LAEG  493
            +S SWD T+++W+L+N        GHT  V +V+ S D     SG +D  I LW+ L E 
Sbjct  73   LSASWDHTLRLWDLNNGTTTCRFVGHTNDVLSVSFSADNRQIVSGSRDKSIKLWNTLGEC  132

Query  492  KKLYSLDAGSI-IHALCFSP---NRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEM  325
            K   + D  S  +  + FSP   N   +    +  +K+WDL      + LR +       
Sbjct  133  KYNITEDGHSEWVSCVRFSPNPANPLIVSGGWDKLVKVWDLTK----LKLRTNFI-----  183

Query  324  SAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  199
               G+N        +  +++ + DGS   S   DGV+ +W +
Sbjct  184  ---GHNG-------YVNTVTISPDGSLCASAGKDGVVMLWDL  215


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 41/187 (22%), Positives = 83/187 (44%), Gaps = 28/187 (15%)
 Frame = -2

Query  672  IVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLW  508
            ++S S D+++ VW+L+  ++     R +L GH+ +V  +A+S DG    S   D  + LW
Sbjct  25   VLSASRDKSIIVWHLTRDEVNYGVPRKSLVGHSHFVEDLAISSDGQFALSASWDHTLRLW  84

Query  507  DLAEGKKL--YSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQE  334
            DL  G     +      ++     + NR  +  + + SIK+W+   +            +
Sbjct  85   DLNNGTTTCRFVGHTNDVLSVSFSADNRQIVSGSRDKSIKLWNTLGEC-----------K  133

Query  333  SEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMII  154
              ++ +G+     ++ + C   S N     + SG  D +++VW + +      +     I
Sbjct  134  YNITEDGH-----SEWVSCVRFSPNPANPLIVSGGWDKLVKVWDLTK-----LKLRTNFI  183

Query  153  GHVCYLS  133
            GH  Y++
Sbjct  184  GHNGYVN  190



>ref|XP_002181732.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC46946.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=316

 Score =   246 bits (629),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 143/189 (76%), Gaps = 14/189 (7%)
 Frame = -2

Query  762  GECKYTIQ-DGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTG  586
            GECKYTI  D +GH+EWVSCVRFSPS   P IVS  WDR VKVWNL+NCKLR+ L GHTG
Sbjct  141  GECKYTISGDSEGHSEWVSCVRFSPSQSVPLIVSAGWDRLVKVWNLTNCKLRNDLVGHTG  200

Query  585  YVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE  406
            Y+NTV VSPDGSL ASGGKD   +LWDL EGK+LYSLDAG II+ L FSPNRYWLCAAT+
Sbjct  201  YLNTVCVSPDGSLAASGGKDSTAMLWDLNEGKRLYSLDAGEIINGLVFSPNRYWLCAATD  260

Query  405  ASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYT  226
             SIKIWDLESK +V  LR    +ESE            KI  CT L+W+ADGSTLF+G+T
Sbjct  261  DSIKIWDLESKIVVDTLR---PEESE----------SGKIPSCTCLAWSADGSTLFAGFT  307

Query  225  DGVIRVWGI  199
            D VIRV+ +
Sbjct  308  DNVIRVYAV  316


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/210 (22%), Positives = 94/210 (45%), Gaps = 31/210 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK---------LRSTLAGHTGYVN  577
            GH +W++ +  +P      ++S S D++V  W+L++            R  L GH+ +V+
Sbjct  14   GHGDWITSLATTPEDPN-LLLSSSRDKSVIAWHLTHSSSGEDDSYGYARRALRGHSHFVS  72

Query  576  TVAVSPDGSLCASGGKDGVILLWDLAEGK--KLYSLDAGSIIHALCFSPNRYWLCAATEA  403
             V +S DG+   S   D  + LWD+A GK  + +      ++     + NR  +  + +A
Sbjct  73   DVVISSDGAFALSASWDSELRLWDIATGKTTRRFVGHEKDVLSVAFSADNRQIVSGSRDA  132

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SI++W+      + + +  +  +SE  +E          + C   S +     + S   D
Sbjct  133  SIRLWN-----TLGECKYTISGDSEGHSE---------WVSCVRFSPSQSVPLIVSAGWD  178

Query  222  GVIRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
             +++VW      +   +  + ++GH  YL+
Sbjct  179  RLVKVWN-----LTNCKLRNDLVGHTGYLN  203



>ref|XP_004073369.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Oryzias latipes]
Length=317

 Score =   246 bits (629),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 144/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYTIQD +GH EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  136  GVCKYTIQD-EGHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGY  194

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD+G +I+ALCFSPNRYWLCAAT  
Sbjct  195  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDSGDVINALCFSPNRYWLCAATGP  254

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K IV +LR           E  +T +K +   CTSL+W+ADG TLF+GYTD
Sbjct  255  SIKIWDLEGKIIVDELR----------QEVISTNSKAEPPQCTSLAWSADGQTLFAGYTD  304

Query  222  GVIRVWGI  199
             +IRVW +
Sbjct  305  NLIRVWQV  312


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 92/206 (45%), Gaps = 29/206 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
            GH+ WV+ +  +P      I+S S D+++ +W L+  +      + +L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPQ-YPDMILSASRDKSIIMWKLTRDETNYGIPQRSLKGHSHFVSDVVI  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G   + +      ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGAWDGTLRLWDLTTGLTTRQFVGHTKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+                +  +  EG+      + + C   S N+    + S   D +++
Sbjct  132  WNTLGVC-----------KYTIQDEGH-----TEWVSCVRFSPNSSNPIIVSCGWDKMVK  175

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW +      + + +H  IGH  YL+
Sbjct  176  VWNLANC---KLKTNH--IGHTGYLN  196



>ref|XP_004696065.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide binding protein 
(G protein), beta polypeptide 2-like 1 [Condylura cristata]
Length=271

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 147/188 (78%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  90   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  148

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  149  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  208

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  209  SIKIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTD  258

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  259  NLVRVWQV  266



>ref|XP_005703361.1| hypothetical protein Gasu_55280 [Galdieria sulphuraria]
 gb|EME26841.1| hypothetical protein Gasu_55280 [Galdieria sulphuraria]
Length=315

 Score =   246 bits (628),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 146/188 (78%), Gaps = 12/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYT+ + DGH++WVSCVRFSPST  P IVS  WD+ VKVWNLSNCK+RS LA HTGY
Sbjct  136  GECKYTLTE-DGHSDWVSCVRFSPSTATPLIVSCGWDKMVKVWNLSNCKIRSNLASHTGY  194

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV+VSPDGSLCASGGKDGV +LW+L EGK LYSL+A  II+ALCFSP RYWLCAAT  
Sbjct  195  LNTVSVSPDGSLCASGGKDGVAMLWELQEGKHLYSLNANDIINALCFSPVRYWLCAATNT  254

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            +IKIWDLE K+IV +L      E E+S        K ++  CT L+W+ADGSTL++GYTD
Sbjct  255  AIKIWDLEKKNIVAELL----YEEEVS-------KKAQVPACTCLAWSADGSTLYAGYTD  303

Query  222  GVIRVWGI  199
              IRVW +
Sbjct  304  NSIRVWTV  311


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 60/122 (49%), Gaps = 8/122 (7%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
            GH  WV+ +  +P      IVS S DR + +W ++  +      R +L GH+ +++ + +
Sbjct  13   GHGNWVTSI-CTPLDNSDFIVSCSRDRKIMIWQITREEGAFGVPRKSLTGHSHFISDIVL  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSL-DAGSIIHALCFSP-NRYWLCAATEASIKI  391
            S DG    S   D  + LWDL +G       D    + ++ FS  NR  +  + + +IK+
Sbjct  72   SSDGQFALSSSWDHTLRLWDLTQGVSTRRFVDHTKDVLSVAFSADNRQIVSGSRDRTIKL  131

Query  390  WD  385
            W+
Sbjct  132  WN  133



>ref|XP_004540947.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Maylandia zebra]
 ref|XP_005719882.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Pundamilia nyererei]
 ref|XP_005921230.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Haplochromis burtoni]
 ref|XP_006781554.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Neolamprologus brichardi]
 gb|AAQ91574.1| receptor for activated protein kinase C [Oreochromis mossambicus]
Length=317

 Score =   246 bits (628),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 144/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYTIQD +GH EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  136  GVCKYTIQD-EGHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGY  194

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD+G +I+ALCFSPNRYWLCAAT  
Sbjct  195  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDSGDVINALCFSPNRYWLCAATGP  254

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K IV +LR           E  +T +K +   CTSL+W+ADG TLF+GYTD
Sbjct  255  SIKIWDLEGKIIVDELR----------QEVISTNSKAEPPQCTSLAWSADGQTLFAGYTD  304

Query  222  GVIRVWGI  199
             +IRVW +
Sbjct  305  NLIRVWQV  312


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 92/206 (45%), Gaps = 29/206 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
            GH+ WV+ +  +P      I+S S D+++ +W L+  +      + +L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPQ-YPDMILSASRDKSIIMWKLTRDETNYGIPQRSLKGHSHFVSDVVI  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G   + +      ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGAWDGTLRLWDLTTGLTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+                +  +  EG+      + + C   S N+    + S   D +++
Sbjct  132  WNTLGVC-----------KYTIQDEGH-----TEWVSCVRFSPNSSNPIIVSCGWDKMVK  175

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW +      + + +H  IGH  YL+
Sbjct  176  VWNLANC---KLKTNH--IGHTGYLN  196



>ref|NP_001266445.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Oreochromis 
niloticus]
 sp|O42249.1|GBLP_ORENI RecName: Full=Guanine nucleotide-binding protein subunit beta-2-like 
1; AltName: Full=Receptor of activated protein kinase 
C; Short=RACK [Oreochromis niloticus]
 gb|AAB81618.1| receptor for activated protein kinase C [Oreochromis niloticus]
Length=317

 Score =   246 bits (628),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 144/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYTIQD +GH EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  136  GVCKYTIQD-EGHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGY  194

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD+G +I+ALCFSPNRYWLCAAT  
Sbjct  195  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDSGDVINALCFSPNRYWLCAATGP  254

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K IV +LR           E  +T +K +   CTSL+W+ADG TLF+GYTD
Sbjct  255  SIKIWDLEGKIIVDELR----------QEVISTNSKAEPPQCTSLAWSADGQTLFAGYTD  304

Query  222  GVIRVWGI  199
             +IRVW +
Sbjct  305  NLIRVWQV  312


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 92/206 (45%), Gaps = 29/206 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
            GH+ WV+ +  +P      I+S S D+++ +W L+  +      + +L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPK-YPDMILSASRDKSIIMWKLTRDETNYGIPQRSLKGHSHFVSDVVI  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G   + +      ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGAWDGTLRLWDLTTGLTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+                +  +  EG+      + + C   S N+    + S   D +++
Sbjct  132  WNTLGVC-----------KYTIQDEGH-----TEWVSCVRFSPNSSNPIIVSCGWDKMVK  175

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW +      + + +H  IGH  YL+
Sbjct  176  VWNLANC---KLKTNH--IGHTGYLN  196



>emb|CEG67117.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
 emb|CEI95133.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
 emb|CEI93908.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
Length=316

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 141/190 (74%), Gaps = 10/190 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKY I + DGH EWVSCVRFSP+   P IVSG WD+ VKVW+L+  KLR+   GH GY
Sbjct  135  GECKYNITE-DGHTEWVSCVRFSPNPATPLIVSGGWDKLVKVWDLTKLKLRTNFIGHNGY  193

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTV +SPDGSLCAS GKDGV++LWDL + K LYSLDAGS++HAL FSPNRYWLCAAT  
Sbjct  194  VNTVTISPDGSLCASAGKDGVVMLWDLNDAKHLYSLDAGSVVHALTFSPNRYWLCAATAN  253

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLE+KSIV +LR +  Q  +          KN    C S++W+ADG+TLFSGY+D
Sbjct  254  GIKIWDLETKSIVDELRPEFAQLGKR---------KNPDPECLSVAWSADGATLFSGYSD  304

Query  222  GVIRVWGIGR  193
             +IRVW + R
Sbjct  305  NIIRVWQVTR  314


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 92/207 (44%), Gaps = 29/207 (14%)
 Frame = -2

Query  732  DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVA  568
            +GH  WV+ +  + S     ++S S D+T+ VWNL+  ++     R +L GH+ +V  +A
Sbjct  11   EGHGNWVTAIA-TTSEAPDMVLSASRDKTIIVWNLTRDEVNYGVPRKSLVGHSHFVEDIA  69

Query  567  VSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIK  394
            +S DG    S   D  + LWDL  G   + +      ++     + NR  +  + + SIK
Sbjct  70   ISSDGQFALSASWDHTLRLWDLNNGTTTRRFVGHTNDVLSVSFSADNRQIVSGSRDKSIK  129

Query  393  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  214
            +W+   +            +  ++ +G+      + + C   S N     + SG  D ++
Sbjct  130  LWNTLGEC-----------KYNITEDGH-----TEWVSCVRFSPNPATPLIVSGGWDKLV  173

Query  213  RVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            +VW      + + +     IGH  Y++
Sbjct  174  KVWD-----LTKLKLRTNFIGHNGYVN  195


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 81/182 (45%), Gaps = 26/182 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  +  S        +S SWD T+++W+L+N        GHT  V +V+ S D  
Sbjct  60   GHSHFVEDIAISSD--GQFALSASWDHTLRLWDLNNGTTTRRFVGHTNDVLSVSFSADNR  117

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI-IHALCFSPN---RYWLCAATEASIKIWD  385
               SG +D  I LW+ L E K   + D  +  +  + FSPN      +    +  +K+WD
Sbjct  118  QIVSGSRDKSIKLWNTLGECKYNITEDGHTEWVSCVRFSPNPATPLIVSGGWDKLVKVWD  177

Query  384  LESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW  205
            L      + LR +          G+N        +  +++ + DGS   S   DGV+ +W
Sbjct  178  LTK----LKLRTNFI--------GHNG-------YVNTVTISPDGSLCASAGKDGVVMLW  218

Query  204  GI  199
             +
Sbjct  219  DL  220



>gb|ETP42980.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica P10297]
Length=429

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 142/185 (77%), Gaps = 10/185 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + DGH EWVSCVRFSPST  P IVS  WD+ VK+WNLSNCKLR+ L GH GY
Sbjct  138  GECKYTITE-DGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWNLSNCKLRTNLFGHEGY  196

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGS+CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRYWLCAAT +
Sbjct  197  LNTVTVSPDGSICASGGKDGTANLWDLNEGKRLYSLVAGDVIHALIFSPNRYWLCAATTS  256

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLESK +V DL+ ++++     A+  +         C SL+W+ADGS LFSGYTD
Sbjct  257  GIKIWDLESKIVVHDLQPEIEEPKGKYAQPPH---------CISLAWSADGSVLFSGYTD  307

Query  222  GVIRV  208
            G++RV
Sbjct  308  GIVRV  312


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 63/133 (47%), Gaps = 15/133 (11%)
 Frame = -2

Query  750  YTIQDGDGHN----EWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSN-----CKLRSTLA  598
            Y   + DGHN      ++  R +P+ L    ++ S D+++ VW LSN        R  L 
Sbjct  7    YPRAELDGHNGKAVTAIATTRENPNLL----LTASRDKSLLVWQLSNDGEEYGFARRRLQ  62

Query  597  GHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYW  424
            GH+ YV  V +S DG    SG  DG + LWDL  G   + +      ++     + NR  
Sbjct  63   GHSHYVEDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNRQI  122

Query  423  LCAATEASIKIWD  385
            +  + + ++K+W+
Sbjct  123  VSGSRDKTVKLWN  135


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 80/182 (44%), Gaps = 26/182 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GH+ +V  V  S        +SGSWD T+++W+L+         GHT  V +VA S D  
Sbjct  63   GHSHYVEDVVISSD--GQFALSGSWDGTLRLWDLNTGITTRRFVGHTKDVLSVAFSADNR  120

Query  549  LCASGGKDGVILLWD-LAEGKKLYSLDAGSI-IHALCFSP---NRYWLCAATEASIKIWD  385
               SG +D  + LW+ L E K   + D  +  +  + FSP   N   +    +  +KIW+
Sbjct  121  QIVSGSRDKTVKLWNTLGECKYTITEDGHTEWVSCVRFSPSTANPLIVSCGWDKVVKIWN  180

Query  384  LESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW  205
            L +      LR +L        EG          +  +++ + DGS   SG  DG   +W
Sbjct  181  LSN----CKLRTNL-----FGHEG----------YLNTVTVSPDGSICASGGKDGTANLW  221

Query  204  GI  199
             +
Sbjct  222  DL  223



>gb|AAX94566.1| Gpa1 interacting G protein subunit [Cryptococcus neoformans var. 
grubii]
Length=227

 Score =   243 bits (619),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECK+ I + DGH EWVSCVRFSP+   P I+S  WD+TVKVW LSNCKL++T  GHTGY
Sbjct  49   GECKFDIVE-DGHTEWVSCVRFSPNPALPVIISAGWDKTVKVWELSNCKLKTTHHGHTGY  107

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NT+AVSPDGSL ASGGKDG+ +LWDL EGK LYSLDAG +I+AL FSPNRYWLCAAT +
Sbjct  108  LNTLAVSPDGSLAASGGKDGITMLWDLNEGKHLYSLDAGDVINALVFSPNRYWLCAATAS  167

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKI+DLESKS+V DL+ D    S+          K +   CTSL+W+ADG TLF+G++D
Sbjct  168  SIKIFDLESKSLVDDLQPDFDGLSD----------KARKPECTSLAWSADGQTLFAGFSD  217

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  218  NLVRVWAV  225



>gb|EDL33790.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2 like 1, isoform CRA_a [Mus musculus]
 gb|EDM04194.1| rCG34190, isoform CRA_b [Rattus norvegicus]
Length=228

 Score =   243 bits (619),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  47   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  105

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  106  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  165

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  166  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  215

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  216  NLVRVWQV  223



>ref|XP_009576203.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Fulmarus glacialis]
Length=223

 Score =   242 bits (618),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  42   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  100

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  101  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  160

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  161  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  210

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  211  NLVRVWQV  218



>gb|ERE68979.1| guanine nucleotide-binding protein subunit beta-2-like 1-like 
protein [Cricetulus griseus]
Length=235

 Score =   243 bits (620),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  54   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  112

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  113  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  172

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  173  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  222

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  223  NLVRVWQV  230



>gb|KFM07186.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Aptenodytes forsteri]
 gb|KFW05064.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Fulmarus glacialis]
Length=224

 Score =   242 bits (618),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  43   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  101

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  102  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  161

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  162  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  211

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  212  NLVRVWQV  219



>ref|XP_006746631.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Leptonychotes weddellii]
Length=271

 Score =   244 bits (623),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 147/188 (78%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  90   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  148

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  149  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  208

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  209  SIKIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTD  258

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  259  NLVRVWQV  266



>ref|XP_005977784.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like isoform X2 [Pantholops hodgsonii]
Length=271

 Score =   244 bits (623),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 147/188 (78%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  90   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  148

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  149  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  208

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  209  SIKIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTD  258

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  259  NLVRVWQV  266



>gb|EWM27643.1| guanine nucleotide binding protein [Nannochloropsis gaditana]
Length=314

 Score =   245 bits (626),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 142/188 (76%), Gaps = 9/188 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECK+TI +G GH+EWVSCVRFSPS   P IVS  WD+ VKVWNL++CKL+  L GHTGY
Sbjct  135  GECKFTITEG-GHSEWVSCVRFSPSPTAPVIVSCGWDKRVKVWNLADCKLKQNLIGHTGY  193

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +N V VSPDGSLCASGGKDG  +LWDL EGK+LYSLDAG IIH+L FSPNRYWLCAAT  
Sbjct  194  LNVVTVSPDGSLCASGGKDGTAMLWDLNEGKRLYSLDAGDIIHSLVFSPNRYWLCAATSQ  253

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLESK +V  L      + +   +G ++ +     +CTSL+W+ADG TLFSGYTD
Sbjct  254  GIKIWDLESKDMVDHL------QPKWPVQGKHSLSPQP--YCTSLAWSADGQTLFSGYTD  305

Query  222  GVIRVWGI  199
            G IR W +
Sbjct  306  GKIRCWSV  313


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 53/206 (26%), Positives = 91/206 (44%), Gaps = 30/206 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIV-SGSWDRTVKVWNLSNCK----LRSTLAGHTGYVNTVAV  565
            GH  WV+ +  +     P +V S S D+TV VWNL+  +     +  L GH  +V+ V +
Sbjct  13   GHAGWVTSI--ATHADNPNLVLSSSRDKTVMVWNLTGGEDYGYPQRALRGHGHFVSDVII  70

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFS-PNRYWLCAATEASIKI  391
            S DG    SG  DG + LW++  GK   +    S  + ++ FS  NR  +  + + +IK+
Sbjct  71   SSDGQFALSGSWDGTLRLWEIKTGKSTRTFVGHSKDVLSVSFSHDNRQIVSGSRDKTIKL  130

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+             L +      EG ++    + + C   S +     + S   D  ++
Sbjct  131  WNT------------LGECKFTITEGGHS----EWVSCVRFSPSPTAPVIVSCGWDKRVK  174

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW +      + +    +IGH  YL+
Sbjct  175  VWNLA-----DCKLKQNLIGHTGYLN  195



>ref|XP_007527211.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Erinaceus europaeus]
Length=271

 Score =   244 bits (622),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 147/188 (78%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  90   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  148

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  149  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  208

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  209  SIKIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTD  258

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  259  NLVRVWQV  266



>ref|XP_005891160.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Bos mutus]
Length=271

 Score =   244 bits (622),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 147/188 (78%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  90   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  148

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  149  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  208

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  209  SIKIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTD  258

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  259  NLVRVWQV  266



>ref|XP_009277073.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Aptenodytes forsteri]
Length=240

 Score =   243 bits (620),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 147/188 (78%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  59   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  117

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  118  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  177

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  178  SIKIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTD  227

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  228  NLVRVWQV  235



>gb|EAW53697.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1, isoform CRA_f [Homo sapiens]
Length=228

 Score =   242 bits (618),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 147/188 (78%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  47   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  105

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  106  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  165

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  166  SIKIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTD  215

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  216  NLVRVWQV  223



>gb|AAR24619.1| proliferation-inducing gene 21 [Homo sapiens]
Length=271

 Score =   244 bits (622),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 147/188 (78%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  90   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  148

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  149  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  208

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  209  SIKIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTD  258

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  259  NLVRVWQV  266



>gb|ELK03178.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Pteropus 
alecto]
Length=251

 Score =   243 bits (620),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  70   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  128

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  129  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  188

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  189  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  238

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  239  NLVRVWQV  246



>gb|EJT47727.1| G protein beta subunit-like protein Rkp1 [Trichosporon asahii 
var. asahii CBS 2479]
 gb|EKD01510.1| G protein beta subunit-like protein Rkp1 [Trichosporon asahii 
var. asahii CBS 8904]
Length=314

 Score =   245 bits (626),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 144/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECK+ I D DGH+EWVSCVRFSP+ + P IVS  WD+ VKVW LS CKL++   GHTGY
Sbjct  136  GECKFNIVD-DGHSEWVSCVRFSPNPVIPVIVSAGWDKVVKVWELSKCKLKTNHYGHTGY  194

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NT+AVSPDGSL ASGGKDG+++LWDL EGK LYSL+AG I+++L FSPNRYWLCAAT +
Sbjct  195  INTLAVSPDGSLAASGGKDGIVMLWDLNEGKHLYSLEAGDIVNSLVFSPNRYWLCAATAS  254

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKI+DLESKSIV DL+ D  + SE + +            C SL+W+ADG TLF GYTD
Sbjct  255  SIKIFDLESKSIVDDLKPDFNELSEKARKPE----------CASLAWSADGQTLFGGYTD  304

Query  222  GVIRVWGI  199
             +IRVW +
Sbjct  305  NLIRVWAV  312


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 78/182 (43%), Gaps = 26/182 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GHN +VS V  S        +S SWD+T+++W+L+         GHTG V +V+ S D  
Sbjct  61   GHNHFVSDVVISSD--GQFALSSSWDKTLRLWDLNTGLTTRKFVGHTGDVLSVSFSADNR  118

Query  549  LCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALC--FSPN---RYWLCAATEASIKIWD  385
               S  +D  I LW+     K   +D G      C  FSPN      + A  +  +K+W+
Sbjct  119  QIVSASRDRTIKLWNTLGECKFNIVDDGHSEWVSCVRFSPNPVIPVIVSAGWDKVVKVWE  178

Query  384  LESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW  205
            L         +  LK           T       +  +L+ + DGS   SG  DG++ +W
Sbjct  179  LS--------KCKLK-----------TNHYGHTGYINTLAVSPDGSLAASGGKDGIVMLW  219

Query  204  GI  199
             +
Sbjct  220  DL  221


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 52/210 (25%), Positives = 90/210 (43%), Gaps = 33/210 (16%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
            GH  WV+ +  S S     I++ S D+T+ VW L+  +      +  L GH  +V+ V +
Sbjct  13   GHAGWVTAIATS-SENPDMILTASRDKTIIVWQLTRDESSFGFPKKILHGHNHFVSDVVI  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    S   D  + LWDL  G   + +    G ++     + NR  + A+ + +IK+
Sbjct  72   SSDGQFALSSSWDKTLRLWDLNTGLTTRKFVGHTGDVLSVSFSADNRQIVSASRDRTIKL  131

Query  390  WDL--ESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            W+   E K  +VD                     ++ + C   S N     + S   D V
Sbjct  132  WNTLGECKFNIVD------------------DGHSEWVSCVRFSPNPVIPVIVSAGWDKV  173

Query  216  IRVWGIGRY*MEEFRRSHMIIGHVCYLSHL  127
            ++VW + +    + + +H   GH  Y++ L
Sbjct  174  VKVWELSKC---KLKTNHY--GHTGYINTL  198



>gb|EPQ05298.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Myotis 
brandtii]
Length=256

 Score =   243 bits (621),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  75   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  133

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  134  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  193

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  194  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  243

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  244  NLVRVWQV  251



>gb|ABY75292.1| putative guanine nucleotide binding protein beta polypeptide 
2-like 1 protein [Ovis aries]
Length=227

 Score =   242 bits (618),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  46   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  104

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  105  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  164

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  165  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  214

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  215  NLVRVWQV  222



>ref|XP_004657524.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Jaculus jaculus]
Length=267

 Score =   243 bits (621),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 147/188 (78%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  86   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  144

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  145  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  204

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  205  SIKIWDLEGK-IIVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTD  254

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  255  NLVRVWQV  262



>ref|NP_571519.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Danio 
rerio]
 sp|O42248.1|GBLP_DANRE RecName: Full=Guanine nucleotide-binding protein subunit beta-2-like 
1; AltName: Full=Receptor of activated protein kinase 
C; Short=RACK [Danio rerio]
 gb|AAB81617.1| receptor for activated protein kinase C [Danio rerio]
 gb|AAH49459.1| Guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Danio rerio]
 gb|AAQ98014.1| guanine nucleotide binding protein beta polypeptide 2-like 1 
[Danio rerio]
Length=317

 Score =   245 bits (626),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 141/188 (75%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYTIQD D H EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  136  GVCKYTIQD-DSHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGY  194

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  I+ALCFSPNRYWLCAAT  
Sbjct  195  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDTINALCFSPNRYWLCAATGP  254

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K IV +LR D+            T +K +   CTSL+W+ADG TLF+GYTD
Sbjct  255  SIKIWDLEGKIIVDELRQDII----------TTNSKAEPPQCTSLAWSADGQTLFAGYTD  304

Query  222  GVIRVWGI  199
             +IRVW +
Sbjct  305  NLIRVWQV  312


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 89/206 (43%), Gaps = 29/206 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
            GH+ WV+ +  +P      I+S S D+T+ +W L+  +      +  L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPQ-FPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVI  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G   + +      ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+      V    +     +E              + C   S N+    + S   D +++
Sbjct  132  WNTLG---VCKYTIQDDSHTEW-------------VSCVRFSPNSSNPIIVSCGWDKMVK  175

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW +      + + +H  IGH  YL+
Sbjct  176  VWNLANC---KLKTNH--IGHTGYLN  196



>dbj|BAE39095.1| unnamed protein product [Mus musculus]
Length=232

 Score =   242 bits (618),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  51   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  109

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  110  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  169

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  170  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  219

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  220  NLVRVWQV  227



>ref|XP_008063710.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Tarsius syrichta]
Length=262

 Score =   243 bits (620),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  81   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  139

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  140  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  199

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  200  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  249

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  250  NLVRVWQV  257



>gb|EPB90862.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Mucor 
circinelloides f. circinelloides 1006PhL]
Length=311

 Score =   244 bits (624),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 141/190 (74%), Gaps = 10/190 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKY I + DGH+EWVSCVRFSP+   P IVSG WD+ VKVW+L+  KLR+   GH GY
Sbjct  130  GECKYNITE-DGHSEWVSCVRFSPNPANPLIVSGGWDKLVKVWDLTKMKLRTNFIGHNGY  188

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTV +SPDGSLCAS GKDGV++LWDL + K LYSL+AGS++HAL FSPNRYWLCAAT  
Sbjct  189  VNTVTISPDGSLCASAGKDGVVMLWDLNDAKHLYSLEAGSLVHALTFSPNRYWLCAATAN  248

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLESKSIV +LR +  Q  +          KN    C S+ W+ADG+TLFSGY+D
Sbjct  249  GIKIWDLESKSIVDELRPEFAQLGKR---------KNPDPDCLSVCWSADGATLFSGYSD  299

Query  222  GVIRVWGIGR  193
             VIRVW + R
Sbjct  300  NVIRVWQVTR  309


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 43/187 (23%), Positives = 83/187 (44%), Gaps = 28/187 (15%)
 Frame = -2

Query  672  IVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLW  508
            ++S S D+T+ VWNL   ++     R +L GH+ +V  +A+S DG    S   D  + LW
Sbjct  25   VLSASRDKTIIVWNLIRDEMNYGVPRKSLVGHSHFVEDLAISSDGQFALSASWDQTLRLW  84

Query  507  DLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQE  334
            DL  G   + +      ++     + NR  +  + + SIK+W+   +            +
Sbjct  85   DLNSGTTTRRFVGHTNDVLSVSFSADNRQIVSGSRDKSIKLWNTLGEC-----------K  133

Query  333  SEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMII  154
              ++ +G+     ++ + C   S N     + SG  D +++VW + +      +     I
Sbjct  134  YNITEDGH-----SEWVSCVRFSPNPANPLIVSGGWDKLVKVWDLTK-----MKLRTNFI  183

Query  153  GHVCYLS  133
            GH  Y++
Sbjct  184  GHNGYVN  190


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 74/162 (46%), Gaps = 24/162 (15%)
 Frame = -2

Query  669  VSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWD-LAEG  493
            +S SWD+T+++W+L++        GHT  V +V+ S D     SG +D  I LW+ L E 
Sbjct  73   LSASWDQTLRLWDLNSGTTTRRFVGHTNDVLSVSFSADNRQIVSGSRDKSIKLWNTLGEC  132

Query  492  KKLYSLDAGSI-IHALCFSP---NRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEM  325
            K   + D  S  +  + FSP   N   +    +  +K+WDL             K +   
Sbjct  133  KYNITEDGHSEWVSCVRFSPNPANPLIVSGGWDKLVKVWDLT------------KMKLRT  180

Query  324  SAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  199
            +  G+N        +  +++ + DGS   S   DGV+ +W +
Sbjct  181  NFIGHNG-------YVNTVTISPDGSLCASAGKDGVVMLWDL  215



>ref|XP_007548404.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Poecilia formosa]
 ref|XP_008418331.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Poecilia reticulata]
Length=317

 Score =   245 bits (625),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 143/188 (76%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYTIQD +GH EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  136  GVCKYTIQD-EGHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGY  194

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD+G  I+ALCFSPNRYWLCAAT  
Sbjct  195  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDSGDTINALCFSPNRYWLCAATGP  254

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K IV +LR           E  +T +K +   CTSL+W+ADG TLF+GYTD
Sbjct  255  SIKIWDLEGKIIVDELR----------QEVISTNSKAEPPQCTSLAWSADGQTLFAGYTD  304

Query  222  GVIRVWGI  199
             +IRVW +
Sbjct  305  NLIRVWQV  312


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 51/206 (25%), Positives = 93/206 (45%), Gaps = 29/206 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
            GH+ WV+ +  +P      I+S S D+++ +W L+  +      + +L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPQ-YPDMILSASRDKSIIMWKLTRDETNYGIPQRSLRGHSHFVSDVVI  71

Query  564  SPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSI-IHALCFSP-NRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G         S  + ++ FS  NR  +  + + +IK+
Sbjct  72   SSDGQFALSGAWDGTLRLWDLTTGATTRQFVGHSKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+                +  +  EG+      + + C   S N+    + S   D +++
Sbjct  132  WNTLGVC-----------KYTIQDEGH-----TEWVSCVRFSPNSSNPIIVSCGWDKMVK  175

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW +      + + +H  IGH  YL+
Sbjct  176  VWNLANC---KLKTNH--IGHTGYLN  196



>ref|XP_005989393.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Latimeria chalumnae]
Length=317

 Score =   245 bits (625),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 142/188 (76%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYTIQD +GH EW SCVRFSP++  P IVS  WDR VKVWNL+NCKL++   GH GY
Sbjct  136  GVCKYTIQD-EGHTEWASCVRFSPNSNNPIIVSCGWDRLVKVWNLANCKLKTNHIGHVGY  194

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  195  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  254

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K IV +LR           E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  255  SIKIWDLEGKIIVDELR----------QEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  304

Query  222  GVIRVWGI  199
             +IRVW +
Sbjct  305  NLIRVWQV  312


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 91/206 (44%), Gaps = 29/206 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
            GHN WV+ +  +P      I+S S D+++ +W L+  +      +  L GH  +V+ V +
Sbjct  13   GHNGWVTQIATTPQ-FPDMILSASRDKSIIMWKLTRDETNYGIPQRALRGHAHFVSDVVI  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  D  + LWDL  G   + +   +  ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDSNLRLWDLTLGITTRQFVGHSKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+                +  +  EG+   A      C   S N++   + S   D +++
Sbjct  132  WNTLGVC-----------KYTIQDEGHTEWAS-----CVRFSPNSNNPIIVSCGWDRLVK  175

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW +      + + +H  IGHV YL+
Sbjct  176  VWNLANC---KLKTNH--IGHVGYLN  196



>ref|XP_002804718.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Macaca mulatta]
Length=279

 Score =   243 bits (621),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  98   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  156

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  157  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  216

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  217  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  266

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  267  NLVRVWQV  274



>dbj|BAG53102.1| unnamed protein product [Homo sapiens]
Length=275

 Score =   243 bits (621),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  94   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  152

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  153  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  212

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  213  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  262

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  263  NLVRVWQV  270



>ref|XP_007244608.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Astyanax mexicanus]
Length=317

 Score =   244 bits (624),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 144/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYTIQD +GH+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTG+
Sbjct  136  GVCKYTIQD-EGHSEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGF  194

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  I+ALCFSPNRYWLCAAT  
Sbjct  195  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDTINALCFSPNRYWLCAATGP  254

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K IV +LR           E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  255  SIKIWDLEGKIIVDELR----------QEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  304

Query  222  GVIRVWGI  199
             +IRVW +
Sbjct  305  NLIRVWQV  312


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 90/206 (44%), Gaps = 29/206 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
            GH+ WV+ +  +P      I+S S D+T+ +W L+  +      +  L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPQ-FPDMILSASRDKTIVMWKLTRDETNYGVPQRALRGHSHFVSDVVI  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G   + +      ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+      V    +  +  SE              + C   S N+    + S   D +++
Sbjct  132  WNTLG---VCKYTIQDEGHSEW-------------VSCVRFSPNSSNPIIVSCGWDKMVK  175

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW +      + + +H  IGH  +L+
Sbjct  176  VWNLANC---KLKTNH--IGHTGFLN  196



>gb|AAI50408.1| Guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Danio rerio]
Length=317

 Score =   244 bits (624),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 141/188 (75%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYTIQD D H EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  136  GVCKYTIQD-DSHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGY  194

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  I+ALCFSPNRYWLCAAT  
Sbjct  195  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDTINALCFSPNRYWLCAATGP  254

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SI+IWDLE K IV +LR D+            T +K +   CTSL+W+ADG TLF+GYTD
Sbjct  255  SIRIWDLEGKIIVDELRQDII----------TTNSKAEPPQCTSLAWSADGQTLFAGYTD  304

Query  222  GVIRVWGI  199
             +IRVW +
Sbjct  305  NLIRVWQV  312


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 89/206 (43%), Gaps = 29/206 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
            GH+ WV+ +  +P      I+S S D+T+ +W L+  +      +  L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPQ-FPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVI  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G   + +      ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+      V    +     +E              + C   S N+    + S   D +++
Sbjct  132  WNTLG---VCKYTIQDDSHTEW-------------VSCVRFSPNSSNPIIVSCGWDKMVK  175

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW +      + + +H  IGH  YL+
Sbjct  176  VWNLANC---KLKTNH--IGHTGYLN  196



>ref|XP_006147504.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Tupaia chinensis]
Length=262

 Score =   242 bits (618),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  81   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  139

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  140  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  199

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  200  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  249

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  250  NLVRVWQV  257



>gb|ADO27998.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Ictalurus 
furcatus]
Length=317

 Score =   244 bits (623),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 144/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYTIQD +GH+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTG+
Sbjct  136  GVCKYTIQD-EGHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLTNCKLKTNHIGHTGF  194

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  I+ALCFSPNRYWLCAAT  
Sbjct  195  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDTINALCFSPNRYWLCAATGP  254

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K IV +LR           E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  255  SIKIWDLEGKIIVDELR----------QEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  304

Query  222  GVIRVWGI  199
             +IRVW +
Sbjct  305  NLIRVWQV  312


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 90/206 (44%), Gaps = 29/206 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
            GH+ WV+ +  +P      I+S S D+++ +W L+  +      +  L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPQ-FPDMILSASRDKSIIMWKLTRDETNYGVPQRALRGHSHFVSDVVI  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G   + +      ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVASSADNRQIVSGSRDKTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+      V    +  +  SE              + C   S N+    + S   D +++
Sbjct  132  WNTLG---VCKYTIQDEGHSEW-------------VSCVRFSPNSSNPIIVSCGWDKLVK  175

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW +      + + +H  IGH  +L+
Sbjct  176  VWNLTNC---KLKTNH--IGHTGFLN  196



>ref|XP_572317.1| cytoplasm protein [Cryptococcus neoformans var. neoformans JEC21]
 ref|XP_772506.1| hypothetical protein CNBL1210 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL17859.1| hypothetical protein CNBL1210 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW45010.1| cytoplasm protein, putative [Cryptococcus neoformans var. neoformans 
JEC21]
 gb|AAX94564.1| G protein beta subunit Gib2 [Cryptococcus neoformans var. grubii]
 gb|AAX94565.1| G protein beta subunit Gib2 [Cryptococcus neoformans var. neoformans]
 gb|AFR98895.1| guanine nucleotide-binding protein subunit beta-like protein 
[Cryptococcus neoformans var. grubii H99]
Length=314

 Score =   244 bits (623),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECK+ I + DGH EWVSCVRFSP+   P I+S  WD+TVKVW LSNCKL++T  GHTGY
Sbjct  136  GECKFDIVE-DGHTEWVSCVRFSPNPALPVIISAGWDKTVKVWELSNCKLKTTHHGHTGY  194

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NT+AVSPDGSL ASGGKDG+ +LWDL EGK LYSLDAG +I+AL FSPNRYWLCAAT +
Sbjct  195  LNTLAVSPDGSLAASGGKDGITMLWDLNEGKHLYSLDAGDVINALVFSPNRYWLCAATAS  254

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKI+DLESKS+V DL+ D    S+          K +   CTSL+W+ADG TLF+G++D
Sbjct  255  SIKIFDLESKSLVDDLQPDFDGLSD----------KARKPECTSLAWSADGQTLFAGFSD  304

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  305  NLVRVWAV  312


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 89/208 (43%), Gaps = 29/208 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
            GHN WV+ +  S S     I++ S D+TV  W L+         +  L GH  +V+ VA+
Sbjct  13   GHNGWVTAIATS-SENPDMILTASRDKTVIAWQLTREDNLYGFPKKILHGHNHFVSDVAI  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    S   D  + LWDL  G   K +    G ++     + NR  + A+ + SIK+
Sbjct  72   SSDGQFALSSSWDHTLRLWDLNTGLTTKKFVGHTGDVLSVSFSADNRQIVSASRDRSIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+      + + + D+ ++              + + C   S N     + S   D  ++
Sbjct  132  WN-----TLGECKFDIVEDGH-----------TEWVSCVRFSPNPALPVIISAGWDKTVK  175

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLSHL  127
            VW +      + + +H   GH  YL+ L
Sbjct  176  VWELSNC---KLKTTHH--GHTGYLNTL  198


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 76/184 (41%), Gaps = 26/184 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GHN +VS V  S        +S SWD T+++W+L+         GHTG V +V+ S D  
Sbjct  61   GHNHFVSDVAISSD--GQFALSSSWDHTLRLWDLNTGLTTKKFVGHTGDVLSVSFSADNR  118

Query  549  LCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALC--FSPNRYW---LCAATEASIKIWD  385
               S  +D  I LW+     K   ++ G      C  FSPN      + A  + ++K+W+
Sbjct  119  QIVSASRDRSIKLWNTLGECKFDIVEDGHTEWVSCVRFSPNPALPVIISAGWDKTVKVWE  178

Query  384  LESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW  205
            L +  +                    T       +  +L+ + DGS   SG  DG+  +W
Sbjct  179  LSNCKL-------------------KTTHHGHTGYLNTLAVSPDGSLAASGGKDGITMLW  219

Query  204  GIGR  193
             +  
Sbjct  220  DLNE  223



>emb|CEP13972.1| hypothetical protein [Parasitella parasitica]
Length=316

 Score =   244 bits (623),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 141/190 (74%), Gaps = 10/190 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKY I + DGH+EWVSCVRFSP+   P IVSG WD+ VKVW+L+  KLR+   GH GY
Sbjct  135  GECKYNITE-DGHSEWVSCVRFSPNPANPLIVSGGWDKLVKVWDLTKMKLRTNFIGHNGY  193

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTV +SPDGSLCAS GKDGV++LWDL + K LYSL+AGS++HAL FSPNRYWLCAAT  
Sbjct  194  VNTVTISPDGSLCASAGKDGVVMLWDLNDAKHLYSLEAGSLVHALTFSPNRYWLCAATAN  253

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLESKSIV +LR +  Q  +          KN    C S+ W+ADG+TLFSGY+D
Sbjct  254  GIKIWDLESKSIVDELRPEFPQLGKR---------KNPDPDCLSVCWSADGATLFSGYSD  304

Query  222  GVIRVWGIGR  193
             +IRVW + R
Sbjct  305  NIIRVWQVTR  314


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 92/207 (44%), Gaps = 29/207 (14%)
 Frame = -2

Query  732  DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVA  568
            +GH  WV+ +  + S     ++S S D+++ VWNL+  +L     R +L GH+ +V  +A
Sbjct  11   EGHGNWVTAIA-TTSEAPDMVLSASRDKSIIVWNLTRDELNYGVPRKSLLGHSHFVEDLA  69

Query  567  VSPDGSLCASGGKDGVILLWDLAEGKKLYSL--DAGSIIHALCFSPNRYWLCAATEASIK  394
            +S DG    S   D  + LWDL  G    S       ++     + NR  +  + + SIK
Sbjct  70   ISSDGQFALSASWDQTLRLWDLTTGTTTRSFVGHTNDVLSVSFSADNRQIVSGSRDKSIK  129

Query  393  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  214
            +W+      + + + ++ ++             ++ + C   S N     + SG  D ++
Sbjct  130  LWN-----TLGECKYNITED-----------GHSEWVSCVRFSPNPANPLIVSGGWDKLV  173

Query  213  RVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            +VW + +      +     IGH  Y++
Sbjct  174  KVWDLTK-----MKLRTNFIGHNGYVN  195


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 74/162 (46%), Gaps = 24/162 (15%)
 Frame = -2

Query  669  VSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWD-LAEG  493
            +S SWD+T+++W+L+      +  GHT  V +V+ S D     SG +D  I LW+ L E 
Sbjct  78   LSASWDQTLRLWDLTTGTTTRSFVGHTNDVLSVSFSADNRQIVSGSRDKSIKLWNTLGEC  137

Query  492  KKLYSLDAGSI-IHALCFSP---NRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEM  325
            K   + D  S  +  + FSP   N   +    +  +K+WDL             K +   
Sbjct  138  KYNITEDGHSEWVSCVRFSPNPANPLIVSGGWDKLVKVWDLT------------KMKLRT  185

Query  324  SAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  199
            +  G+N        +  +++ + DGS   S   DGV+ +W +
Sbjct  186  NFIGHNG-------YVNTVTISPDGSLCASAGKDGVVMLWDL  220



>ref|XP_009080129.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Acanthisitta chloris]
Length=236

 Score =   241 bits (615),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  55   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  113

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  114  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  173

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  174  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  223

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  224  NLVRVWQV  231



>emb|CCQ18636.1| G protein beta subunit-like protein [Sycon ciliatum]
Length=321

 Score =   244 bits (623),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 143/190 (75%), Gaps = 11/190 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYTIQD +GH+EWVSCVRFSP+   P IVS  WDR VKVWNL+NC+L++   GHTGY
Sbjct  140  GVCKYTIQD-EGHSEWVSCVRFSPNNQNPIIVSAGWDRLVKVWNLTNCRLKTNHIGHTGY  198

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG+ +LWDL EGK LY+L+ G +I+AL FSPNRYWLCAA   
Sbjct  199  LNTVTVSPDGSLCASGGKDGLAMLWDLNEGKHLYTLEGGDVINALTFSPNRYWLCAACGP  258

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            +IK+WDLE+KS+V           E + +    ++  +   CTSL+W+ADG TLFSGYTD
Sbjct  259  TIKVWDLETKSVV----------DECTIQDPTQSSSQEAATCTSLAWSADGQTLFSGYTD  308

Query  222  GVIRVWGIGR  193
            G+IRVW + R
Sbjct  309  GLIRVWQVTR  318


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 90/208 (43%), Gaps = 31/208 (15%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-------LRSTLAGHTGYVNTV  571
            GH +WV+ +  +P  +   I+S S D+++ VWNL+  +        +  L GH+ +V+ V
Sbjct  15   GHKDWVTQIATTPQ-VPDMILSSSRDKSIIVWNLNREEGTGNVGVPKRRLTGHSHFVSDV  73

Query  570  AVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASI  397
             +S DG    SG  D  + LWDL  G   + +      ++     + NR  + A+ + SI
Sbjct  74   VISSDGQFALSGSWDHTLRLWDLQRGVTTRRFVGHTKDVLSVAFSADNRQIVSASRDRSI  133

Query  396  KIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGV  217
            K+W+      V    +  +  SE              + C   S N     + S   D +
Sbjct  134  KLWNTLG---VCKYTIQDEGHSEW-------------VSCVRFSPNNQNPIIVSAGWDRL  177

Query  216  IRVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            ++VW +        + +H  IGH  YL+
Sbjct  178  VKVWNLTNC---RLKTNH--IGHTGYLN  200



>emb|CEP08121.1| hypothetical protein [Parasitella parasitica]
Length=316

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 141/190 (74%), Gaps = 10/190 (5%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKY I + DGH+EWVSCVRFSP+   P IVSG WD+ VKVW+L+  KLR+   GH GY
Sbjct  135  GECKYNITE-DGHSEWVSCVRFSPNPANPLIVSGGWDKLVKVWDLTKMKLRTNFIGHNGY  193

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            VNTV +SPDGSLCAS GKDGV++LWDL E K LYSL+AGS++HAL FSPNRYWLCAAT  
Sbjct  194  VNTVTISPDGSLCASAGKDGVVMLWDLNEAKHLYSLEAGSLVHALTFSPNRYWLCAATAT  253

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
             IKIWDLESKS+V +LR +  Q  +          KN    C S+ W++DG+TLFSGY+D
Sbjct  254  GIKIWDLESKSLVDELRPEFPQLGKR---------KNPDPDCLSVCWSSDGATLFSGYSD  304

Query  222  GVIRVWGIGR  193
             +IRVW + R
Sbjct  305  NIIRVWQVTR  314


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/207 (24%), Positives = 92/207 (44%), Gaps = 29/207 (14%)
 Frame = -2

Query  732  DGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVA  568
            +GH  WV+ +  + S     ++S S D++V VWNL+  +L     R +L GH+ +V  +A
Sbjct  11   EGHGNWVTAIA-TTSEAPDMVLSASRDKSVIVWNLTRDELNYGVPRKSLLGHSHFVEDLA  69

Query  567  VSPDGSLCASGGKDGVILLWDLAEGKKLYSL--DAGSIIHALCFSPNRYWLCAATEASIK  394
            +S DG    S   D  + LWDL  G    S       ++     + NR  +  + + SIK
Sbjct  70   ISSDGQFALSASWDHTLRLWDLTTGTTTRSFVGHTNDVLSVSFSADNRQIVSGSRDKSIK  129

Query  393  IWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVI  214
            +W+      + + + ++ ++             ++ + C   S N     + SG  D ++
Sbjct  130  LWN-----TLGECKYNITED-----------GHSEWVSCVRFSPNPANPLIVSGGWDKLV  173

Query  213  RVWGIGRY*MEEFRRSHMIIGHVCYLS  133
            +VW + +      +     IGH  Y++
Sbjct  174  KVWDLTK-----MKLRTNFIGHNGYVN  195


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 73/162 (45%), Gaps = 24/162 (15%)
 Frame = -2

Query  669  VSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWD-LAEG  493
            +S SWD T+++W+L+      +  GHT  V +V+ S D     SG +D  I LW+ L E 
Sbjct  78   LSASWDHTLRLWDLTTGTTTRSFVGHTNDVLSVSFSADNRQIVSGSRDKSIKLWNTLGEC  137

Query  492  KKLYSLDAGSI-IHALCFSP---NRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEM  325
            K   + D  S  +  + FSP   N   +    +  +K+WDL             K +   
Sbjct  138  KYNITEDGHSEWVSCVRFSPNPANPLIVSGGWDKLVKVWDLT------------KMKLRT  185

Query  324  SAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  199
            +  G+N        +  +++ + DGS   S   DGV+ +W +
Sbjct  186  NFIGHNG-------YVNTVTISPDGSLCASAGKDGVVMLWDL  220



>ref|NP_001187435.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Ictalurus 
punctatus]
 gb|ADO28638.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Ictalurus 
punctatus]
Length=317

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 144/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYTIQD +GH+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTG+
Sbjct  136  GVCKYTIQD-EGHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGF  194

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  I+ALCFSPNRYWLCAAT  
Sbjct  195  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDTINALCFSPNRYWLCAATGP  254

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K IV +LR           E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  255  SIKIWDLEGKIIVDELR----------QEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  304

Query  222  GVIRVWGI  199
             +IRVW +
Sbjct  305  NLIRVWQV  312


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 90/206 (44%), Gaps = 29/206 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAV  565
            GH+ WV+ +  +P      I+S S D+++ +W L+  +      +  L GH+ +V+ V +
Sbjct  13   GHSGWVTQIATTPQ-FPDMILSASRDKSIIMWKLTRDETNYGVPQRALRGHSHFVSDVVI  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    SG  DG + LWDL  G   + +      ++     + NR  +  + + +IK+
Sbjct  72   SSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+      V    +  +  SE              + C   S N+    + S   D +++
Sbjct  132  WNTLG---VCKYTIQDEGHSEW-------------VSCVRFSPNSSNPIIVSCGWDKLVK  175

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLS  133
            VW +      + + +H  IGH  +L+
Sbjct  176  VWNLANC---KLKTNH--IGHTGFLN  196



>gb|EDL33792.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2 like 1, isoform CRA_c [Mus musculus]
Length=264

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  83   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  141

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  142  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  201

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  202  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  251

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  252  NLVRVWQV  259



>gb|AEW43729.1| activated protein kinase C receptor, partial [Epinephelus coioides]
Length=302

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 144/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYTIQD +GH+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTG+
Sbjct  121  GVCKYTIQD-EGHSEWVSCVRFSPNSQNPIIVSCGWDKMVKVWNLTNCKLKTNHIGHTGF  179

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGG+DG  +LWDL EGK LY+LD+G  I+ALCFSPNRYWLCAAT  
Sbjct  180  LNTVTVSPDGSLCASGGRDGQAMLWDLNEGKHLYTLDSGDTINALCFSPNRYWLCAATGP  239

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K IV +LR           E  +T +K +   CTSL+W+ADG TLF+GYTD
Sbjct  240  SIKIWDLEGKVIVDELR----------QEVISTNSKAEPPQCTSLAWSADGQTLFAGYTD  289

Query  222  GVIRVWGI  199
             +IRVW +
Sbjct  290  NLIRVWQV  297



>ref|XP_009922131.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Haliaeetus albicilla]
Length=291

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  110  GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  168

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  169  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  228

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  229  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  278

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  279  NLVRVWQV  286


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (43%), Gaps = 28/181 (15%)
 Frame = -2

Query  654  DRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG-  493
            D+T+ +W L+  +      +  L GH+ +V+ V +S DG    SG  DG + LWDL  G 
Sbjct  11   DKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSGDGTLRLWDLTTGT  70

Query  492  -KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAE  316
              + +      ++     S NR  +  + + +IK+W+      V    V  +  SE    
Sbjct  71   TTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLG---VCKYTVQDESHSEW---  124

Query  315  GNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCYL  136
                      + C   S N+    + S   D +++VW +      + + +H  IGH  YL
Sbjct  125  ----------VSCVRFSPNSSNPIIVSCGWDKLVKVWNLANC---KLKTNH--IGHTGYL  169

Query  135  S  133
            +
Sbjct  170  N  170



>gb|KFP96911.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Haliaeetus albicilla]
Length=287

 Score =   243 bits (619),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  106  GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  164

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  165  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  224

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  225  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  274

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  275  NLVRVWQV  282


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (43%), Gaps = 28/181 (15%)
 Frame = -2

Query  654  DRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG-  493
            D+T+ +W L+  +      +  L GH+ +V+ V +S DG    SG  DG + LWDL  G 
Sbjct  7    DKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSGDGTLRLWDLTTGT  66

Query  492  -KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAE  316
              + +      ++     S NR  +  + + +IK+W+      V    V  +  SE    
Sbjct  67   TTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLG---VCKYTVQDESHSEW---  120

Query  315  GNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCYL  136
                      + C   S N+    + S   D +++VW +      + + +H  IGH  YL
Sbjct  121  ----------VSCVRFSPNSSNPIIVSCGWDKLVKVWNLANC---KLKTNH--IGHTGYL  165

Query  135  S  133
            +
Sbjct  166  N  166



>gb|KFQ89059.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Phoenicopterus ruber ruber]
Length=290

 Score =   243 bits (619),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  109  GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  167

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  168  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  227

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  228  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  277

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  278  NLVRVWQV  285


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 47/190 (25%), Positives = 81/190 (43%), Gaps = 29/190 (15%)
 Frame = -2

Query  678  PTIVSGS-WDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVI  517
            P + S S  D+T+ +W L+  +      +  L GH+ +V+ V +S DG    SG  DG +
Sbjct  1    PNLTSASPTDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTL  60

Query  516  LLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDL  343
             LWDL  G   + +      ++     S NR  +  + + +IK+W+      V    V  
Sbjct  61   RLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLG---VCKYTVQD  117

Query  342  KQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSH  163
            +  SE              + C   S N+    + S   D +++VW +      + + +H
Sbjct  118  ESHSEW-------------VSCVRFSPNSSNPIIVSCGWDKLVKVWNLANC---KLKTNH  161

Query  162  MIIGHVCYLS  133
              IGH  YL+
Sbjct  162  --IGHTGYLN  169



>gb|KFP58388.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Cathartes aura]
Length=287

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  106  GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  164

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  165  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  224

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  225  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  274

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  275  NLVRVWQV  282


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (43%), Gaps = 28/181 (15%)
 Frame = -2

Query  654  DRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG-  493
            D+T+ +W L+  +      +  L GH+ +V+ V +S DG    SG  DG + LWDL  G 
Sbjct  7    DKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGT  66

Query  492  -KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAE  316
              + +      ++     S NR  +  + + +IK+W+      V    V  +  SE    
Sbjct  67   TTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLG---VCKYTVQDESHSEW---  120

Query  315  GNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCYL  136
                      + C   S N+    + S   D +++VW +      + + +H  IGH  YL
Sbjct  121  ----------VSCVRFSPNSSNPIIVSCGWDKLVKVWNLANC---KLKTNH--IGHTGYL  165

Query  135  S  133
            +
Sbjct  166  N  166



>gb|KFP61115.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Cariama cristata]
Length=300

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  119  GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  177

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  178  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  237

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  238  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  287

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  288  NLVRVWQV  295


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 81/194 (42%), Gaps = 34/194 (18%)
 Frame = -2

Query  693  PSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGK  529
            P +  PT      D+T+ +W L+  +      +  L GH+ +V+ V +S DG    SG  
Sbjct  13   PRSASPT------DKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSW  66

Query  528  DGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDL  355
            DG + LWDL  G   + +      ++     S NR  +  + + +IK+W+      V   
Sbjct  67   DGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLG---VCKY  123

Query  354  RVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEF  175
             V  +  SE              + C   S N+    + S   D +++VW +      + 
Sbjct  124  TVQDESHSEW-------------VSCVRFSPNSSNPIIVSCGWDKLVKVWNLANC---KL  167

Query  174  RRSHMIIGHVCYLS  133
            + +H  IGH  YL+
Sbjct  168  KTNH--IGHTGYLN  179



>ref|XP_009489930.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Pelecanus crispus]
Length=289

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  108  GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  166

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  167  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  226

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  227  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  276

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  277  NLVRVWQV  284


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (43%), Gaps = 28/181 (15%)
 Frame = -2

Query  654  DRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG-  493
            D+T+ +W L+  +      +  L GH+ +V+ V +S DG    SG  DG + LWDL  G 
Sbjct  9    DKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGT  68

Query  492  -KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAE  316
              + +      ++     S NR  +  + + +IK+W+      V    V  +  SE    
Sbjct  69   TTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLG---VCKYTVQDESHSEW---  122

Query  315  GNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCYL  136
                      + C   S N+    + S   D +++VW +      + + +H  IGH  YL
Sbjct  123  ----------VSCVRFSPNSSNPIIVSCGWDKLVKVWNLANC---KLKTNH--IGHTGYL  167

Query  135  S  133
            +
Sbjct  168  N  168



>ref|XP_003197003.1| G protein beta subunit-like protein Rkp1 [Cryptococcus gattii 
WM276]
 gb|ADV25216.1| G protein beta subunit-like protein Rkp1, putative [Cryptococcus 
gattii WM276]
 gb|KGB78558.1| cytoplasm protein [Cryptococcus gattii R265]
 gb|KIR27048.1| guanine nucleotide-binding protein subunit beta-like protein 
[Cryptococcus gattii LA55]
 gb|KIR32005.1| guanine nucleotide-binding protein subunit beta-like protein 
[Cryptococcus gattii MMRL2647]
 gb|KIR40023.1| guanine nucleotide-binding protein subunit beta-like protein 
[Cryptococcus gattii Ram5]
 gb|KIR51837.1| guanine nucleotide-binding protein subunit beta-like protein 
[Cryptococcus gattii Ru294]
 gb|KIR71417.1| guanine nucleotide-binding protein subunit beta-like protein 
[Cryptococcus gattii CA1014]
 gb|KIR76720.1| guanine nucleotide-binding protein subunit beta-like protein 
[Cryptococcus gattii EJB2]
 gb|KIR83567.1| guanine nucleotide-binding protein subunit beta-like protein 
[Cryptococcus gattii IND107]
 gb|KIR90996.1| guanine nucleotide-binding protein subunit beta-like protein 
[Cryptococcus gattii CBS 10090]
 gb|KIR96251.1| guanine nucleotide-binding protein subunit beta-like protein 
[Cryptococcus gattii 2001/935-1]
 gb|KIY31621.1| guanine nucleotide-binding protein subunit beta-like protein 
[Cryptococcus gattii E566]
 gb|KIY55692.1| guanine nucleotide-binding protein subunit beta-like protein 
[Cryptococcus gattii 99/473]
 gb|KJE01123.1| guanine nucleotide-binding protein subunit beta-like protein 
[Cryptococcus gattii NT-10]
Length=314

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECK+ I + DGH EWVSCVRFSP+   P I+S  WD+TVKVW LSNCKL++T  GHTGY
Sbjct  136  GECKFDIVE-DGHTEWVSCVRFSPNPALPVIISAGWDKTVKVWELSNCKLKTTHHGHTGY  194

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NT+AVSPDGSL ASGGKDG+ +LWDL EGK LYSLDAG II++L FSPNRYWLCAAT +
Sbjct  195  LNTLAVSPDGSLAASGGKDGITMLWDLNEGKHLYSLDAGDIINSLVFSPNRYWLCAATAS  254

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKI+DLESKS+V DL+ D    S+          K +   CTSL+W+ADG TLF+G++D
Sbjct  255  SIKIFDLESKSLVDDLQPDFDGLSD----------KARKPECTSLAWSADGQTLFAGFSD  304

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  305  NLVRVWAV  312


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 89/208 (43%), Gaps = 29/208 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCK-----LRSTLAGHTGYVNTVAV  565
            GHN WV+ +  S S     I++ S D+TV  W L+         +  L GH  +V+ VA+
Sbjct  13   GHNGWVTAIATS-SENPDMILTASRDKTVIAWQLTREDNLYGFPKKILHGHNHFVSDVAI  71

Query  564  SPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKI  391
            S DG    S   D  + LWDL  G   K +    G ++     + NR  + A+ + SIK+
Sbjct  72   SSDGQFALSSSWDHTLRLWDLNTGLTTKKFVGHTGDVLSVSFSADNRQIVSASRDRSIKL  131

Query  390  WDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIR  211
            W+      + + + D+ ++              + + C   S N     + S   D  ++
Sbjct  132  WN-----TLGECKFDIVEDGH-----------TEWVSCVRFSPNPALPVIISAGWDKTVK  175

Query  210  VWGIGRY*MEEFRRSHMIIGHVCYLSHL  127
            VW +      + + +H   GH  YL+ L
Sbjct  176  VWELSNC---KLKTTHH--GHTGYLNTL  198


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 76/184 (41%), Gaps = 26/184 (14%)
 Frame = -2

Query  729  GHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGYVNTVAVSPDGS  550
            GHN +VS V  S        +S SWD T+++W+L+         GHTG V +V+ S D  
Sbjct  61   GHNHFVSDVAISSD--GQFALSSSWDHTLRLWDLNTGLTTKKFVGHTGDVLSVSFSADNR  118

Query  549  LCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALC--FSPNRYW---LCAATEASIKIWD  385
               S  +D  I LW+     K   ++ G      C  FSPN      + A  + ++K+W+
Sbjct  119  QIVSASRDRSIKLWNTLGECKFDIVEDGHTEWVSCVRFSPNPALPVIISAGWDKTVKVWE  178

Query  384  LESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW  205
            L +  +                    T       +  +L+ + DGS   SG  DG+  +W
Sbjct  179  LSNCKL-------------------KTTHHGHTGYLNTLAVSPDGSLAASGGKDGITMLW  219

Query  204  GIGR  193
             +  
Sbjct  220  DLNE  223



>dbj|BAB28114.1| unnamed protein product [Mus musculus]
Length=280

 Score =   242 bits (618),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  99   GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  157

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  158  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  217

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  218  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  267

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  268  NLVRVWQV  275



>ref|XP_007070338.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Chelonia mydas]
Length=282

 Score =   242 bits (618),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  101  GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  159

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  160  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  219

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  220  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  269

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  270  NLVRVWQV  277



>ref|XP_008873892.1| guanine nucleotide-binding protein subunit beta-like protein 
[Aphanomyces invadans]
 gb|ETV97683.1| guanine nucleotide-binding protein subunit beta-like protein 
[Aphanomyces invadans]
Length=318

 Score =   244 bits (622),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 144/189 (76%), Gaps = 11/189 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            GECKYTI + +GH EWVS VRFSPS+  P IVS  WDR VKVWNL+NCKLR+ L GH+GY
Sbjct  139  GECKYTITE-EGHTEWVSSVRFSPSSANPLIVSAGWDRVVKVWNLTNCKLRTNLFGHSGY  197

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDGV +LWDL EGK+LY+L+A  IIHAL FSPNRYWL AAT +
Sbjct  198  LNTVTVSPDGSLCASGGKDGVAMLWDLNEGKRLYALEANDIIHALVFSPNRYWLVAATSS  257

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            +IKIWDLESK +VVD         E+     +   K++     SL+W+ADG +LF+GYTD
Sbjct  258  AIKIWDLESK-VVVD---------EIVPTFEHVGKKSQPPHAVSLAWSADGQSLFAGYTD  307

Query  222  GVIRVWGIG  196
            G++RV+ +G
Sbjct  308  GIVRVYAVG  316


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 62/127 (49%), Gaps = 13/127 (10%)
 Frame = -2

Query  735  GDGHNEWVSCVRFSPSTLQPT-IVSGSWDRTVKVWNLSNCK-------LRSTLAGHTGYV  580
            G G N WV+ +  + S   P  +V+ S D++V VW L++          R  L GH+ +V
Sbjct  13   GHGKN-WVTAI--ATSRENPNLVVTASRDKSVLVWQLTHDADPDNYGYARRRLTGHSHFV  69

Query  579  NTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATE  406
              V +S DG    SG  DG + LWDL  G   + +   +  ++     + NR  +  + +
Sbjct  70   QDVVISSDGQFALSGSWDGTLRLWDLNTGITTRRFVGHSKDVLSVAFSADNRQIVSGSRD  129

Query  405  ASIKIWD  385
             SIK+W+
Sbjct  130  RSIKLWN  136



>ref|XP_009701898.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Cariama cristata]
Length=301

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  120  GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  178

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  179  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  238

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  239  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  288

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  289  NLVRVWQV  296


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 81/194 (42%), Gaps = 34/194 (18%)
 Frame = -2

Query  693  PSTLQPTIVSGSWDRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGK  529
            P +  PT      D+T+ +W L+  +      +  L GH+ +V+ V +S DG    SG  
Sbjct  14   PRSASPT------DKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSW  67

Query  528  DGVILLWDLAEG--KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDL  355
            DG + LWDL  G   + +      ++     S NR  +  + + +IK+W+      V   
Sbjct  68   DGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLG---VCKY  124

Query  354  RVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEF  175
             V  +  SE              + C   S N+    + S   D +++VW +      + 
Sbjct  125  TVQDESHSEW-------------VSCVRFSPNSSNPIIVSCGWDKLVKVWNLANC---KL  168

Query  174  RRSHMIIGHVCYLS  133
            + +H  IGH  YL+
Sbjct  169  KTNH--IGHTGYLN  180



>gb|KFQ96249.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Nipponia nippon]
Length=291

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -2

Query  762  GECKYTIQDGDGHNEWVSCVRFSPSTLQPTIVSGSWDRTVKVWNLSNCKLRSTLAGHTGY  583
            G CKYT+QD + H+EWVSCVRFSP++  P IVS  WD+ VKVWNL+NCKL++   GHTGY
Sbjct  110  GVCKYTVQD-ESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGY  168

Query  582  VNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEA  403
            +NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  
Sbjct  169  LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP  228

Query  402  SIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  223
            SIKIWDLE K I+VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD
Sbjct  229  SIKIWDLEGK-IIVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTD  278

Query  222  GVIRVWGI  199
             ++RVW +
Sbjct  279  NLVRVWQV  286


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (43%), Gaps = 28/181 (15%)
 Frame = -2

Query  654  DRTVKVWNLSNCKL-----RSTLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG-  493
            D+T+ +W L+  +      +  L GH+ +V+ V +S DG    SG  DG + LWDL  G 
Sbjct  11   DKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGT  70

Query  492  -KKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAE  316
              + +      ++     S NR  +  + + +IK+W+      V    V  +  SE    
Sbjct  71   TTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLG---VCKYTVQDESHSEW---  124

Query  315  GNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCYL  136
                      + C   S N+    + S   D +++VW +      + + +H  IGH  YL
Sbjct  125  ----------VSCVRFSPNSSNPIIVSCGWDKLVKVWNLANC---KLKTNH--IGHTGYL  169

Query  135  S  133
            +
Sbjct  170  N  170



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680