BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF025E15

Length=692
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABK96436.1|  unknown                                                 229   3e-71   Populus trichocarpa x Populus deltoides
ref|XP_010450765.1|  PREDICTED: protein OSCA1-like                      224   4e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006287117.1|  hypothetical protein CARUB_v10000278mg             239   6e-70   Capsella rubella
emb|CDP04437.1|  unnamed protein product                                238   2e-69   Coffea canephora [robusta coffee]
ref|NP_192343.1|  early-responsive to dehydration stress-related ...    237   3e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006387596.1|  hypothetical protein POPTR_0796s00200g             220   1e-68   
gb|AAL07154.1|  unknown protein                                         235   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396700.1|  hypothetical protein EUTSA_v10028449mg             235   2e-68   
ref|XP_006348154.1|  PREDICTED: uncharacterized protein RSN1-like...    233   4e-68   Solanum tuberosum [potatoes]
ref|XP_002872689.1|  hypothetical protein ARALYDRAFT_911697             234   5e-68   Arabidopsis lyrata subsp. lyrata
ref|XP_010422263.1|  PREDICTED: LOW QUALITY PROTEIN: protein OSCA...    234   6e-68   
ref|XP_010496174.1|  PREDICTED: protein OSCA1-like                      234   7e-68   Camelina sativa [gold-of-pleasure]
ref|XP_011095994.1|  PREDICTED: calcium permeable stress-gated ca...    233   7e-68   Sesamum indicum [beniseed]
ref|XP_006348153.1|  PREDICTED: uncharacterized protein RSN1-like...    233   1e-67   Solanum tuberosum [potatoes]
ref|XP_008371060.1|  PREDICTED: transmembrane protein 63B-like          233   1e-67   
ref|XP_009108550.1|  PREDICTED: calcium permeable stress-gated ca...    231   5e-67   Brassica rapa
emb|CDY27443.1|  BnaC03g64830D                                          231   5e-67   Brassica napus [oilseed rape]
ref|XP_004232686.1|  PREDICTED: calcium permeable stress-gated ca...    231   7e-67   Solanum lycopersicum
gb|EYU27725.1|  hypothetical protein MIMGU_mgv1a001730mg                231   9e-67   Erythranthe guttata [common monkey flower]
ref|XP_006283166.1|  hypothetical protein CARUB_v10004197mg             231   9e-67   Capsella rubella
ref|XP_011086200.1|  PREDICTED: calcium permeable stress-gated ca...    231   1e-66   Sesamum indicum [beniseed]
ref|XP_002317144.2|  early-responsive to dehydration family protein     229   2e-66   
ref|XP_010439363.1|  PREDICTED: calcium permeable stress-gated ca...    229   2e-66   
ref|XP_010434078.1|  PREDICTED: calcium permeable stress-gated ca...    229   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_009613689.1|  PREDICTED: calcium permeable stress-gated ca...    229   2e-66   Nicotiana tomentosiformis
ref|XP_006413690.1|  hypothetical protein EUTSA_v10024476mg             229   2e-66   Eutrema salsugineum [saltwater cress]
emb|CAA18115.1|  putative protein                                       228   4e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867790.1|  hypothetical protein ARALYDRAFT_492658             229   5e-66   
ref|XP_009772257.1|  PREDICTED: calcium permeable stress-gated ca...    228   7e-66   Nicotiana sylvestris
ref|XP_010448929.1|  PREDICTED: calcium permeable stress-gated ca...    228   8e-66   
gb|KDP20707.1|  hypothetical protein JCGZ_21178                         227   8e-66   Jatropha curcas
dbj|BAD93792.1|  hypothetical protein                                   228   9e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193943.2|  early-responsive to dehydration stress-related ...    228   9e-66   Arabidopsis thaliana [mouse-ear cress]
emb|CDY21297.1|  BnaC03g29810D                                          228   1e-65   Brassica napus [oilseed rape]
ref|XP_011046977.1|  PREDICTED: calcium permeable stress-gated ca...    227   2e-65   Populus euphratica
ref|XP_011046975.1|  PREDICTED: calcium permeable stress-gated ca...    227   2e-65   Populus euphratica
ref|XP_011014901.1|  PREDICTED: calcium permeable stress-gated ca...    227   2e-65   Populus euphratica
ref|XP_009134294.1|  PREDICTED: CSC1-like protein At4g04340             226   3e-65   Brassica rapa
emb|CDX90856.1|  BnaA03g25360D                                          226   3e-65   
emb|CDX82907.1|  BnaC01g13570D                                          226   4e-65   
ref|XP_007026161.1|  ERD (early-responsive to dehydration stress)...    225   8e-65   
ref|NP_001291223.1|  calcium permeable stress-gated cation channel 1    225   1e-64   Populus euphratica
ref|XP_011002577.1|  PREDICTED: calcium permeable stress-gated ca...    224   1e-64   Populus euphratica
ref|XP_006350470.1|  PREDICTED: uncharacterized membrane protein ...    224   2e-64   Solanum tuberosum [potatoes]
ref|XP_009135587.1|  PREDICTED: calcium permeable stress-gated ca...    224   2e-64   Brassica rapa
ref|XP_009357605.1|  PREDICTED: calcium permeable stress-gated ca...    223   4e-64   Pyrus x bretschneideri [bai li]
ref|XP_009803475.1|  PREDICTED: calcium permeable stress-gated ca...    223   6e-64   Nicotiana sylvestris
ref|XP_007211353.1|  hypothetical protein PRUPE_ppa001728mg             223   6e-64   Prunus persica
ref|XP_009357481.1|  PREDICTED: calcium permeable stress-gated ca...    222   1e-63   Pyrus x bretschneideri [bai li]
ref|XP_008224710.1|  PREDICTED: uncharacterized membrane protein ...    222   1e-63   Prunus mume [ume]
ref|XP_002518432.1|  conserved hypothetical protein                     221   2e-63   
ref|XP_009619499.1|  PREDICTED: calcium permeable stress-gated ca...    220   4e-63   Nicotiana tomentosiformis
ref|XP_010539247.1|  PREDICTED: calcium permeable stress-gated ca...    220   6e-63   Tarenaya hassleriana [spider flower]
ref|XP_004231619.1|  PREDICTED: calcium permeable stress-gated ca...    220   7e-63   
gb|KJB69238.1|  hypothetical protein B456_011G012200                    217   1e-62   Gossypium raimondii
gb|KDP30779.1|  hypothetical protein JCGZ_13722                         219   1e-62   Jatropha curcas
ref|XP_011007190.1|  PREDICTED: CSC1-like protein At3g21620             219   1e-62   Populus euphratica
ref|XP_008384098.1|  PREDICTED: uncharacterized protein RSN1            219   1e-62   
ref|XP_009592755.1|  PREDICTED: CSC1-like protein At3g21620             218   3e-62   Nicotiana tomentosiformis
ref|XP_010686787.1|  PREDICTED: calcium permeable stress-gated ca...    218   3e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006469645.1|  PREDICTED: uncharacterized membrane protein ...    215   4e-62   
ref|XP_009772361.1|  PREDICTED: CSC1-like protein At3g21620             218   4e-62   Nicotiana sylvestris
ref|XP_010099166.1|  Uncharacterized membrane protein                   218   5e-62   Morus notabilis
ref|XP_010035539.1|  PREDICTED: CSC1-like protein At3g21620             217   5e-62   Eucalyptus grandis [rose gum]
ref|XP_008459005.1|  PREDICTED: uncharacterized membrane protein ...    218   5e-62   Cucumis melo [Oriental melon]
gb|KJB69243.1|  hypothetical protein B456_011G012200                    217   5e-62   Gossypium raimondii
gb|KJB69239.1|  hypothetical protein B456_011G012200                    217   6e-62   Gossypium raimondii
gb|KJB69236.1|  hypothetical protein B456_011G012200                    217   6e-62   Gossypium raimondii
ref|XP_002321139.1|  early-responsive to dehydration family protein     217   8e-62   Populus trichocarpa [western balsam poplar]
gb|KHN38468.1|  Putative membrane protein C2G11.09                      217   9e-62   Glycine soja [wild soybean]
ref|XP_003519463.1|  PREDICTED: uncharacterized membrane protein ...    217   9e-62   Glycine max [soybeans]
ref|XP_002301612.2|  early-responsive to dehydration family protein     217   1e-61   
ref|XP_003549667.1|  PREDICTED: uncharacterized membrane protein ...    217   1e-61   Glycine max [soybeans]
gb|KCW77011.1|  hypothetical protein EUGRSUZ_D01358                     214   2e-61   Eucalyptus grandis [rose gum]
ref|XP_006447609.1|  hypothetical protein CICLE_v10014378mg             215   4e-61   Citrus clementina [clementine]
ref|XP_002264502.1|  PREDICTED: calcium permeable stress-gated ca...    215   4e-61   
gb|KHG01808.1|  putative membrane C2G11.09                              215   4e-61   Gossypium arboreum [tree cotton]
ref|XP_003616997.1|  Transmembrane protein                              214   8e-61   Medicago truncatula
ref|XP_010052882.1|  PREDICTED: calcium permeable stress-gated ca...    214   9e-61   Eucalyptus grandis [rose gum]
dbj|BAF98597.1|  CM0545.360.nc                                          214   1e-60   Lotus japonicus
ref|XP_006383869.1|  hypothetical protein POPTR_0004s00750g             214   1e-60   
ref|XP_003529649.1|  PREDICTED: uncharacterized membrane protein ...    213   2e-60   Glycine max [soybeans]
ref|XP_004166876.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    213   2e-60   
ref|XP_004145433.1|  PREDICTED: uncharacterized membrane protein ...    213   2e-60   Cucumis sativus [cucumbers]
ref|XP_004151944.1|  PREDICTED: uncharacterized protein RSN1-like       213   2e-60   Cucumis sativus [cucumbers]
ref|XP_004158583.1|  PREDICTED: uncharacterized protein RSN1-like       213   2e-60   
ref|XP_007153987.1|  hypothetical protein PHAVU_003G081500g             213   2e-60   Phaseolus vulgaris [French bean]
ref|XP_006387597.1|  hypothetical protein POPTR_0796s00210g             212   3e-60   
ref|XP_008455928.1|  PREDICTED: uncharacterized membrane protein ...    210   5e-60   Cucumis melo [Oriental melon]
ref|XP_008455926.1|  PREDICTED: uncharacterized membrane protein ...    211   5e-60   
ref|XP_006467388.1|  PREDICTED: uncharacterized membrane protein ...    212   6e-60   Citrus sinensis [apfelsine]
gb|EPS60017.1|  hypothetical protein M569_14787                         212   6e-60   Genlisea aurea
ref|XP_011016279.1|  PREDICTED: CSC1-like protein At3g21620             211   7e-60   Populus euphratica
ref|XP_011047222.1|  PREDICTED: CSC1-like protein At3g21620             211   8e-60   Populus euphratica
ref|XP_010252492.1|  PREDICTED: calcium permeable stress-gated ca...    211   1e-59   Nelumbo nucifera [Indian lotus]
ref|XP_006447608.1|  hypothetical protein CICLE_v10014696mg             208   1e-59   
gb|KHG30770.1|  putative membrane C2G11.09                              211   2e-59   Gossypium arboreum [tree cotton]
ref|XP_008455922.1|  PREDICTED: uncharacterized protein RSN1 isof...    210   2e-59   Cucumis melo [Oriental melon]
gb|KDO39720.1|  hypothetical protein CISIN_1g048588mg                   208   2e-59   Citrus sinensis [apfelsine]
ref|XP_004491137.1|  PREDICTED: uncharacterized protein RSN1-like       210   3e-59   Cicer arietinum [garbanzo]
gb|KJB57786.1|  hypothetical protein B456_009G181100                    210   3e-59   Gossypium raimondii
ref|XP_009418442.1|  PREDICTED: calcium permeable stress-gated ca...    209   5e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011463550.1|  PREDICTED: calcium permeable stress-gated ca...    208   9e-59   Fragaria vesca subsp. vesca
ref|XP_004289181.1|  PREDICTED: calcium permeable stress-gated ca...    208   1e-58   Fragaria vesca subsp. vesca
ref|XP_007217157.1|  hypothetical protein PRUPE_ppa001757mg             208   1e-58   Prunus persica
ref|XP_004295293.1|  PREDICTED: calcium permeable stress-gated ca...    207   2e-58   Fragaria vesca subsp. vesca
ref|XP_007049121.1|  ERD (early-responsive to dehydration stress)...    207   2e-58   
ref|XP_004293317.1|  PREDICTED: calcium permeable stress-gated ca...    206   9e-58   Fragaria vesca subsp. vesca
ref|XP_010089460.1|  Uncharacterized membrane protein                   206   9e-58   
ref|XP_008229991.1|  PREDICTED: uncharacterized membrane protein ...    205   1e-57   
ref|XP_006417282.1|  hypothetical protein EUTSA_v10006870mg             204   3e-57   Eutrema salsugineum [saltwater cress]
ref|XP_010924083.1|  PREDICTED: protein OSCA1-like isoform X6           203   3e-57   
ref|XP_004507664.1|  PREDICTED: uncharacterized membrane protein ...    204   4e-57   Cicer arietinum [garbanzo]
ref|XP_010924080.1|  PREDICTED: calcium permeable stress-gated ca...    204   4e-57   
ref|XP_010924079.1|  PREDICTED: calcium permeable stress-gated ca...    204   4e-57   
ref|XP_003555683.1|  PREDICTED: uncharacterized membrane protein ...    203   6e-57   Glycine max [soybeans]
ref|XP_010924075.1|  PREDICTED: calcium permeable stress-gated ca...    203   6e-57   Elaeis guineensis
gb|KHN28986.1|  Putative membrane protein C2G11.09                      203   6e-57   Glycine soja [wild soybean]
ref|XP_008363487.1|  PREDICTED: uncharacterized protein RSN1-like       201   6e-57   
ref|XP_010924081.1|  PREDICTED: calcium permeable stress-gated ca...    203   7e-57   Elaeis guineensis
ref|XP_007141612.1|  hypothetical protein PHAVU_008G210700g             203   7e-57   Phaseolus vulgaris [French bean]
ref|XP_010546606.1|  PREDICTED: CSC1-like protein At1g11960             203   7e-57   Tarenaya hassleriana [spider flower]
gb|EPS71959.1|  hypothetical protein M569_02795                         202   1e-56   Genlisea aurea
ref|XP_006363038.1|  PREDICTED: uncharacterized protein RSN1-like...    202   1e-56   Solanum tuberosum [potatoes]
gb|EMS56194.1|  Uncharacterized membrane protein C2G11.09               201   1e-56   Triticum urartu
gb|EYU33878.1|  hypothetical protein MIMGU_mgv1a018274mg                202   1e-56   Erythranthe guttata [common monkey flower]
ref|XP_003610472.1|  Membrane protein, putative                         201   3e-56   Medicago truncatula
ref|XP_003569164.1|  PREDICTED: calcium permeable stress-gated ca...    201   3e-56   Brachypodium distachyon [annual false brome]
ref|XP_010548889.1|  PREDICTED: CSC1-like protein At3g21620             201   3e-56   Tarenaya hassleriana [spider flower]
ref|XP_008799225.1|  PREDICTED: calcium permeable stress-gated ca...    201   4e-56   Phoenix dactylifera
ref|XP_003542161.1|  PREDICTED: uncharacterized membrane protein ...    201   5e-56   Glycine max [soybeans]
ref|XP_008803557.1|  PREDICTED: LOW QUALITY PROTEIN: calcium perm...    201   6e-56   Phoenix dactylifera
ref|XP_004243535.1|  PREDICTED: CSC1-like protein At3g21620             200   9e-56   Solanum lycopersicum
ref|XP_002457968.1|  hypothetical protein SORBIDRAFT_03g023990          200   9e-56   Sorghum bicolor [broomcorn]
gb|EMT27455.1|  Putative membrane protein                               200   1e-55   
ref|XP_011046982.1|  PREDICTED: calcium permeable stress-gated ca...    198   3e-55   Populus euphratica
ref|XP_010657219.1|  PREDICTED: CSC1-like protein At3g21620             198   4e-55   Vitis vinifera
gb|KHG22816.1|  putative membrane C2G11.09                              197   4e-55   Gossypium arboreum [tree cotton]
ref|XP_006644293.1|  PREDICTED: uncharacterized membrane protein ...    197   7e-55   Oryza brachyantha
ref|XP_011046979.1|  PREDICTED: calcium permeable stress-gated ca...    197   8e-55   Populus euphratica
ref|XP_009148626.1|  PREDICTED: CSC1-like protein At1g11960             197   1e-54   Brassica rapa
emb|CDX98089.1|  BnaA06g08400D                                          197   1e-54   
ref|XP_009113086.1|  PREDICTED: CSC1-like protein At1g62320             197   1e-54   Brassica rapa
emb|CDY12941.1|  BnaA09g13330D                                          197   1e-54   Brassica napus [oilseed rape]
ref|XP_010921296.1|  PREDICTED: calcium permeable stress-gated ca...    197   1e-54   Elaeis guineensis
emb|CDY30043.1|  BnaC05g09770D                                          197   1e-54   Brassica napus [oilseed rape]
ref|XP_010493595.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...    197   1e-54   
ref|XP_006306821.1|  hypothetical protein CARUB_v10008363mg             196   2e-54   Capsella rubella
dbj|BAK03311.1|  predicted protein                                      196   2e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007145950.1|  hypothetical protein PHAVU_006G000300g             195   5e-54   Phaseolus vulgaris [French bean]
ref|XP_006383870.1|  early-responsive to dehydration family protein     195   7e-54   
gb|KJB10672.1|  hypothetical protein B456_001G215500                    192   2e-53   Gossypium raimondii
gb|KJB10674.1|  hypothetical protein B456_001G215500                    192   5e-53   Gossypium raimondii
gb|KJB10673.1|  hypothetical protein B456_001G215500                    192   5e-53   Gossypium raimondii
ref|NP_001043256.1|  Os01g0534900                                       192   5e-53   
ref|XP_002892667.1|  hypothetical protein ARALYDRAFT_312226             192   7e-53   
gb|KJB42871.1|  hypothetical protein B456_007G171500                    192   7e-53   Gossypium raimondii
gb|KJB42870.1|  hypothetical protein B456_007G171500                    192   8e-53   Gossypium raimondii
ref|NP_001056508.1|  Os05g0594700                                       191   1e-52   
gb|EEE64912.1|  hypothetical protein OsJ_19772                          191   2e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008363043.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    190   2e-52   
ref|XP_010458617.1|  PREDICTED: CSC1-like protein At1g11960             189   5e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010476146.1|  PREDICTED: CSC1-like protein At1g11960             189   6e-52   Camelina sativa [gold-of-pleasure]
emb|CDY19541.1|  BnaC09g13620D                                          189   1e-51   Brassica napus [oilseed rape]
gb|AAC17615.1|  Similar to hypothetical protein HYP1 gb|Z97338 fr...    187   3e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008673458.1|  PREDICTED: calcium permeable stress-gated ca...    187   3e-51   
ref|NP_172660.5|  putative ERD4 protein                                 187   3e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008675529.1|  PREDICTED: calcium permeable stress-gated ca...    187   3e-51   
ref|XP_006654880.1|  PREDICTED: uncharacterized membrane protein ...    187   5e-51   Oryza brachyantha
emb|CDP11354.1|  unnamed protein product                                186   7e-51   Coffea canephora [robusta coffee]
ref|XP_010418218.1|  PREDICTED: CSC1-like protein At1g62320             186   8e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010430277.1|  PREDICTED: CSC1-like protein At1g62320             186   9e-51   Camelina sativa [gold-of-pleasure]
sp|F4HYR3.2|CSCL6_ARATH  RecName: Full=CSC1-like protein At1g62320      185   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006843810.1|  hypothetical protein AMTR_s00007p00254340          185   3e-50   Amborella trichopoda
ref|XP_008808245.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    184   5e-50   Phoenix dactylifera
emb|CDY32438.1|  BnaC03g42220D                                          183   8e-50   Brassica napus [oilseed rape]
emb|CDY48898.1|  BnaA03g36370D                                          183   1e-49   Brassica napus [oilseed rape]
ref|XP_009135761.1|  PREDICTED: CSC1-like protein At3g21620             183   1e-49   Brassica rapa
ref|XP_006300401.1|  hypothetical protein CARUB_v10019839mg             182   3e-49   Capsella rubella
ref|XP_006850790.1|  hypothetical protein AMTR_s00025p00102970          181   3e-49   Amborella trichopoda
emb|CDP03600.1|  unnamed protein product                                181   4e-49   Coffea canephora [robusta coffee]
ref|XP_004968885.1|  PREDICTED: uncharacterized membrane protein ...    181   4e-49   Setaria italica
ref|XP_011046985.1|  PREDICTED: calcium permeable stress-gated ca...    184   4e-49   Populus euphratica
ref|XP_011046984.1|  PREDICTED: uncharacterized protein LOC105141...    184   9e-49   Populus euphratica
ref|NP_001147493.1|  LOC100281102                                       180   1e-48   Zea mays [maize]
ref|XP_010255871.1|  PREDICTED: CSC1-like protein At4g02900             180   1e-48   Nelumbo nucifera [Indian lotus]
gb|AFW81357.1|  HYP1 isoform 1                                          180   1e-48   
ref|XP_010038117.1|  PREDICTED: CSC1-like protein At4g02900             179   2e-48   Eucalyptus grandis [rose gum]
ref|XP_009396325.1|  PREDICTED: calcium permeable stress-gated ca...    179   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002870239.1|  hypothetical protein ARALYDRAFT_493346             179   3e-48   
ref|XP_002440380.1|  hypothetical protein SORBIDRAFT_09g030770          178   5e-48   Sorghum bicolor [broomcorn]
ref|XP_010473449.1|  PREDICTED: CSC1-like protein At1g62320             178   6e-48   Camelina sativa [gold-of-pleasure]
ref|XP_006654360.1|  PREDICTED: uncharacterized protein C354.08c-...    177   1e-47   Oryza brachyantha
gb|EYU46618.1|  hypothetical protein MIMGU_mgv1a001779mg                177   1e-47   Erythranthe guttata [common monkey flower]
ref|XP_006406250.1|  hypothetical protein EUTSA_v10020132mg             176   2e-47   Eutrema salsugineum [saltwater cress]
ref|XP_011079804.1|  PREDICTED: CSC1-like protein At4g02900             176   2e-47   Sesamum indicum [beniseed]
ref|XP_009395092.1|  PREDICTED: calcium permeable stress-gated ca...    176   2e-47   
ref|XP_009147362.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    176   3e-47   Brassica rapa
ref|XP_009147329.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    176   3e-47   Brassica rapa
ref|NP_001055457.1|  Os05g0393800                                       176   4e-47   
gb|EAY97938.1|  hypothetical protein OsI_19855                          176   4e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_010466416.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    175   5e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010488177.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    175   5e-47   
ref|XP_003568506.1|  PREDICTED: CSC1-like protein At4g02900             175   6e-47   Brachypodium distachyon [annual false brome]
ref|XP_006299035.1|  hypothetical protein CARUB_v10015172mg             175   6e-47   Capsella rubella
ref|XP_010488175.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    175   7e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010466415.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    175   7e-47   
gb|KDO68804.1|  hypothetical protein CISIN_1g0209791mg                  164   7e-47   Citrus sinensis [apfelsine]
ref|XP_009404947.1|  PREDICTED: calcium permeable stress-gated ca...    175   7e-47   
ref|XP_009404922.1|  PREDICTED: calcium permeable stress-gated ca...    175   7e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_188799.1|  early-responsive to dehydration stress-related ...    174   1e-46   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD94445.1|  hypothetical protein                                   174   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009393118.1|  PREDICTED: CSC1-like protein At4g02900             174   1e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002885454.1|  hypothetical protein ARALYDRAFT_342312             174   1e-46   Arabidopsis lyrata subsp. lyrata
ref|XP_006285697.1|  hypothetical protein CARUB_v10007167mg             174   2e-46   Capsella rubella
ref|XP_010231849.1|  PREDICTED: calcium permeable stress-gated ca...    173   2e-46   
ref|XP_003569103.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    174   2e-46   Brachypodium distachyon [annual false brome]
ref|XP_006854105.1|  hypothetical protein AMTR_s00048p00143150          173   3e-46   Amborella trichopoda
ref|XP_008373502.1|  PREDICTED: uncharacterized protein RSN1            174   3e-46   
ref|XP_010110412.1|  Uncharacterized protein RSN1                       168   4e-46   
ref|XP_010510410.1|  PREDICTED: CSC1-like protein At3g21620             173   4e-46   Camelina sativa [gold-of-pleasure]
gb|EMS50375.1|  Transmembrane protein 63B                               172   5e-46   Triticum urartu
ref|XP_002441130.1|  hypothetical protein SORBIDRAFT_09g021010          172   6e-46   Sorghum bicolor [broomcorn]
dbj|BAJ96091.1|  predicted protein                                      172   8e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004962175.1|  PREDICTED: uncharacterized protein RSN1-like       172   1e-45   Setaria italica
ref|XP_008451390.1|  PREDICTED: uncharacterized membrane protein ...    171   1e-45   
ref|XP_008451392.1|  PREDICTED: uncharacterized membrane protein ...    171   1e-45   Cucumis melo [Oriental melon]
ref|XP_008238126.1|  PREDICTED: uncharacterized protein RSN1            171   2e-45   Prunus mume [ume]
ref|XP_002973564.1|  hypothetical protein SELMODRAFT_442177             171   2e-45   Selaginella moellendorffii
ref|XP_010664612.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    169   3e-45   Vitis vinifera
ref|XP_006444131.1|  hypothetical protein CICLE_v10024532mg             170   3e-45   Citrus clementina [clementine]
ref|XP_006479762.1|  PREDICTED: uncharacterized membrane protein ...    170   3e-45   
ref|XP_002886475.1|  F24O1.4                                            170   4e-45   Arabidopsis lyrata subsp. lyrata
ref|XP_010326353.1|  PREDICTED: CSC1-like protein At4g02900             170   4e-45   Solanum lycopersicum
ref|XP_004293316.1|  PREDICTED: calcium permeable stress-gated ca...    169   5e-45   Fragaria vesca subsp. vesca
ref|XP_002273732.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    170   5e-45   Vitis vinifera
ref|XP_010261636.1|  PREDICTED: CSC1-like protein At1g32090             170   5e-45   Nelumbo nucifera [Indian lotus]
ref|XP_006391905.1|  hypothetical protein EUTSA_v10023297mg             169   8e-45   
ref|XP_002975592.1|  hypothetical protein SELMODRAFT_150725             169   8e-45   Selaginella moellendorffii
ref|XP_004960982.1|  PREDICTED: uncharacterized membrane protein ...    169   1e-44   Setaria italica
ref|XP_009373514.1|  PREDICTED: CSC1-like protein At1g32090             169   1e-44   Pyrus x bretschneideri [bai li]
ref|XP_007210357.1|  hypothetical protein PRUPE_ppa001580mg             169   1e-44   Prunus persica
ref|XP_002271834.1|  PREDICTED: CSC1-like protein At4g02900             169   1e-44   Vitis vinifera
emb|CBI32349.3|  unnamed protein product                                169   1e-44   Vitis vinifera
gb|AFW78070.1|  hypothetical protein ZEAMMB73_829601                    168   2e-44   
ref|XP_006355875.1|  PREDICTED: uncharacterized protein C354.08c-...    168   2e-44   Solanum tuberosum [potatoes]
emb|CDY32032.1|  BnaA03g60360D                                          168   4e-44   Brassica napus [oilseed rape]
ref|XP_008649660.1|  PREDICTED: LOW QUALITY PROTEIN: calcium perm...    167   4e-44   
ref|XP_009123383.1|  PREDICTED: CSC1-like protein At1g62320             167   5e-44   Brassica rapa
ref|XP_008451393.1|  PREDICTED: uncharacterized membrane protein ...    167   5e-44   Cucumis melo [Oriental melon]
ref|XP_004164564.1|  PREDICTED: uncharacterized membrane protein ...    166   7e-44   
ref|XP_004136187.1|  PREDICTED: uncharacterized membrane protein ...    166   8e-44   Cucumis sativus [cucumbers]
dbj|BAK05559.1|  predicted protein                                      166   9e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH23730.1|  ERD (early-responsive to dehydration stress) fami...    166   1e-43   Medicago truncatula
emb|CAB10322.1|  hypothetical protein                                   166   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001154237.1|  ERD (early-responsive to dehydration stress)...    166   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004300169.1|  PREDICTED: CSC1-like protein At1g32090             166   2e-43   Fragaria vesca subsp. vesca
ref|XP_010090368.1|  Uncharacterized membrane protein                   166   3e-43   
ref|XP_010276749.1|  PREDICTED: CSC1-like protein At1g32090             165   3e-43   Nelumbo nucifera [Indian lotus]
ref|NP_176422.1|  ERD (early-responsive to dehydration stress) fa...    165   3e-43   
ref|XP_006352784.1|  PREDICTED: uncharacterized membrane protein ...    164   5e-43   Solanum tuberosum [potatoes]
gb|KDP46674.1|  hypothetical protein JCGZ_12198                         164   6e-43   Jatropha curcas
ref|XP_010235059.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    164   6e-43   
ref|XP_008808246.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    164   6e-43   
ref|XP_009625807.1|  PREDICTED: CSC1-like protein At4g02900             164   8e-43   Nicotiana tomentosiformis
ref|NP_001065504.1|  Os10g0579100                                       164   8e-43   
gb|EAY79648.1|  hypothetical protein OsI_34792                          164   1e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_006662108.1|  PREDICTED: uncharacterized membrane protein ...    164   1e-42   Oryza brachyantha
ref|XP_003574401.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    164   1e-42   Brachypodium distachyon [annual false brome]
ref|XP_007050676.1|  ERD (early-responsive to dehydration stress)...    163   1e-42   
ref|XP_009147369.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    162   2e-42   Brassica rapa
emb|CDY22920.1|  BnaA01g18580D                                          162   2e-42   Brassica napus [oilseed rape]
ref|XP_002464863.1|  hypothetical protein SORBIDRAFT_01g027810          163   2e-42   Sorghum bicolor [broomcorn]
ref|XP_004245915.1|  PREDICTED: CSC1-like protein At1g32090             163   3e-42   Solanum lycopersicum
gb|EMT18085.1|  Putative membrane protein                               162   3e-42   
ref|XP_006352918.1|  PREDICTED: uncharacterized protein RSN1-like       162   3e-42   Solanum tuberosum [potatoes]
ref|XP_010440309.1|  PREDICTED: CSC1-like protein At4g15430             162   4e-42   Camelina sativa [gold-of-pleasure]
gb|EMS63788.1|  Uncharacterized membrane protein C2G11.09               162   4e-42   Triticum urartu
gb|KHN19872.1|  Putative membrane protein C2G11.09                      161   4e-42   Glycine soja [wild soybean]
ref|XP_008658829.1|  PREDICTED: uncharacterized protein RSN1            162   4e-42   
ref|XP_010434984.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    162   4e-42   
ref|XP_004242328.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    162   5e-42   
ref|XP_003520558.1|  PREDICTED: uncharacterized membrane protein ...    161   5e-42   
ref|XP_007040776.1|  Early-responsive to dehydration stress prote...    162   5e-42   
ref|XP_004493651.1|  PREDICTED: uncharacterized protein RSN1-like...    161   5e-42   
emb|CDY49293.1|  BnaC01g22480D                                          161   7e-42   
ref|XP_011074804.1|  PREDICTED: CSC1-like protein At1g32090             161   7e-42   
ref|XP_009601393.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    160   8e-42   
ref|XP_004983522.1|  PREDICTED: uncharacterized membrane protein ...    161   9e-42   
ref|NP_193278.4|  ERD (early-responsive to dehydration stress) fa...    160   1e-41   
ref|XP_007040777.1|  Early-responsive to dehydration stress prote...    161   1e-41   
ref|XP_007158205.1|  hypothetical protein PHAVU_002G133000g             161   1e-41   
ref|XP_010449938.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    160   1e-41   
gb|KJB51550.1|  hypothetical protein B456_008G222200                    160   1e-41   
ref|XP_008234907.1|  PREDICTED: uncharacterized protein RSN1 isof...    160   1e-41   
gb|EMT13890.1|  Putative membrane protein                               160   1e-41   
ref|XP_007162399.1|  hypothetical protein PHAVU_001G148800g             160   1e-41   
ref|XP_006604421.1|  PREDICTED: uncharacterized protein RSN1-like...    160   2e-41   
ref|XP_003553451.1|  PREDICTED: uncharacterized protein RSN1-like...    160   2e-41   
ref|XP_009601331.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    160   2e-41   
gb|KJB51549.1|  hypothetical protein B456_008G222200                    160   3e-41   
gb|EMS63833.1|  Uncharacterized membrane protein C2G11.09               160   3e-41   
ref|XP_009603996.1|  PREDICTED: CSC1-like protein At1g32090             160   3e-41   
gb|AFI41197.1|  dehydration stress protein                              159   4e-41   
ref|XP_009784323.1|  PREDICTED: CSC1-like protein At1g32090             159   6e-41   
ref|XP_007200309.1|  hypothetical protein PRUPE_ppa001848mg             159   6e-41   
gb|EYU29074.1|  hypothetical protein MIMGU_mgv1a021500mg                158   7e-41   
ref|XP_003612662.1|  Membrane protein, putative                         158   1e-40   
ref|XP_010434983.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    157   2e-40   
gb|EMS65241.1|  Uncharacterized membrane protein C2G11.09               157   3e-40   
emb|CDP11732.1|  unnamed protein product                                157   3e-40   
ref|XP_002519965.1|  Extensin-3 precursor, putative                     157   4e-40   
gb|EMT23208.1|  Putative membrane protein                               157   4e-40   
ref|XP_009347716.1|  PREDICTED: CSC1-like protein At4g02900             150   6e-40   
ref|XP_010449936.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    156   6e-40   
ref|XP_004292602.1|  PREDICTED: CSC1-like protein At4g02900             155   6e-40   
ref|XP_006414510.1|  hypothetical protein EUTSA_v10024504mg             154   1e-39   
gb|EMT11783.1|  Putative membrane protein                               155   1e-39   
ref|XP_002533077.1|  conserved hypothetical protein                     154   2e-39   
gb|KFK30892.1|  hypothetical protein AALP_AA6G039600                    153   3e-39   
gb|KFK30891.1|  hypothetical protein AALP_AA6G039600                    153   3e-39   
ref|XP_010920040.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...    154   3e-39   
ref|XP_006414511.1|  hypothetical protein EUTSA_v10024504mg             154   3e-39   
ref|XP_010490005.1|  PREDICTED: CSC1-like protein At3g21620             144   3e-39   
gb|KDP21496.1|  hypothetical protein JCGZ_21967                         153   4e-39   
gb|KHG26829.1|  putative membrane C2G11.09                              153   8e-39   
ref|XP_006396516.1|  hypothetical protein EUTSA_v10029277mg             153   8e-39   
gb|EMT22148.1|  Putative membrane protein                               152   1e-38   
gb|KJB42060.1|  hypothetical protein B456_007G134700                    151   1e-38   
gb|KJB42062.1|  hypothetical protein B456_007G134700                    151   2e-38   
ref|XP_010522696.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    152   2e-38   
ref|XP_010522697.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    152   2e-38   
ref|XP_010522695.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    152   2e-38   
ref|XP_010278586.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    151   2e-38   
ref|XP_010677412.1|  PREDICTED: CSC1-like protein At1g32090             152   2e-38   
gb|KJB42059.1|  hypothetical protein B456_007G134700                    151   2e-38   
ref|XP_008788615.1|  PREDICTED: CSC1-like protein At1g32090             151   3e-38   
ref|XP_009356857.1|  PREDICTED: CSC1-like protein At4g02900             151   3e-38   
ref|XP_008386531.1|  PREDICTED: uncharacterized protein RSN1            150   4e-38   
gb|EMS66710.1|  Uncharacterized membrane protein C2G11.09               150   4e-38   
ref|XP_010684236.1|  PREDICTED: CSC1-like protein At4g02900             150   5e-38   
gb|AAC79116.1|  hypothetical protein                                    149   7e-38   
gb|KHG10946.1|  putative membrane C2G11.09                              150   8e-38   
ref|XP_010422520.1|  PREDICTED: CSC1-like protein At4g02900             150   1e-37   
ref|XP_010430503.1|  PREDICTED: CSC1-like protein At4g02900             149   1e-37   
ref|XP_009134388.1|  PREDICTED: CSC1-like protein At4g02900             149   1e-37   
emb|CDX90914.1|  BnaA03g25940D                                          149   1e-37   
emb|CDY17981.1|  BnaC03g30530D                                          149   1e-37   
emb|CDP11733.1|  unnamed protein product                                150   1e-37   
ref|XP_011082546.1|  PREDICTED: CSC1-like protein At4g02900             149   2e-37   
gb|EPS71707.1|  hypothetical protein M569_03051                         149   2e-37   
ref|NP_192199.1|  ERD (early-responsive to dehydration stress) fa...    149   2e-37   
gb|EPS61105.1|  hypothetical protein M569_13694                         147   2e-37   
gb|EYU38139.1|  hypothetical protein MIMGU_mgv1a022024mg                148   4e-37   
gb|KDO58806.1|  hypothetical protein CISIN_1g040696mg                   148   4e-37   
ref|XP_006432649.1|  hypothetical protein CICLE_v10000312mg             148   4e-37   
ref|XP_002874888.1|  hypothetical protein ARALYDRAFT_352535             147   8e-37   
emb|CDY09064.1|  BnaC08g10180D                                          147   1e-36   
ref|XP_009107840.1|  PREDICTED: CSC1-like protein At4g15430             147   1e-36   
ref|XP_010455942.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    146   2e-36   
ref|XP_004146108.1|  PREDICTED: uncharacterized membrane protein ...    146   2e-36   
ref|XP_010455941.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    146   2e-36   
ref|XP_008448614.1|  PREDICTED: uncharacterized protein RSN1            146   2e-36   
ref|XP_002304365.2|  hypothetical protein POPTR_0003s09900g             145   4e-36   
ref|XP_010056204.1|  PREDICTED: CSC1-like protein At1g32090             145   4e-36   
ref|XP_010054102.1|  PREDICTED: CSC1-like protein At1g32090             145   5e-36   
ref|XP_011028084.1|  PREDICTED: CSC1-like protein At1g32090             145   6e-36   
ref|XP_011082330.1|  PREDICTED: CSC1-like protein At1g32090             144   9e-36   
gb|KHN40403.1|  Putative membrane protein C2G11.09                      144   1e-35   
ref|XP_003516847.1|  PREDICTED: uncharacterized protein RSN1-like       144   1e-35   
ref|XP_006604422.1|  PREDICTED: uncharacterized protein RSN1-like...    144   1e-35   
ref|XP_003533453.1|  PREDICTED: uncharacterized protein RSN1-like       144   2e-35   
ref|XP_008234908.1|  PREDICTED: uncharacterized protein RSN1 isof...    142   5e-35   
ref|XP_006368323.1|  early-responsive to dehydration family protein     142   5e-35   
emb|CDM81261.1|  unnamed protein product                                141   1e-34   
ref|XP_011018446.1|  PREDICTED: CSC1-like protein At1g32090             142   1e-34   
gb|KJB22581.1|  hypothetical protein B456_004G055300                    139   1e-34   
gb|KFK44972.1|  hypothetical protein AALP_AA1G327200                    140   2e-34   
ref|XP_004512449.1|  PREDICTED: uncharacterized membrane protein ...    140   2e-34   
gb|KHG17938.1|  putative membrane C2G11.09                              140   3e-34   
emb|CDY35541.1|  BnaA05g16450D                                          140   3e-34   
emb|CDY29933.1|  BnaC05g29030D                                          140   3e-34   
ref|XP_009145210.1|  PREDICTED: CSC1-like protein At1g32090             140   3e-34   
gb|EYU23284.1|  hypothetical protein MIMGU_mgv1a001448mg                140   4e-34   
gb|EPS74192.1|  hypothetical protein M569_00556                         139   5e-34   
ref|XP_010461028.1|  PREDICTED: CSC1-like protein At1g32090             139   6e-34   
ref|XP_010499754.1|  PREDICTED: CSC1-like protein At1g32090             139   7e-34   
ref|NP_174489.1|  early-responsive to dehydration stress protein ...    139   7e-34   
ref|XP_002893699.1|  hypothetical protein ARALYDRAFT_473392             139   7e-34   
ref|XP_010478627.1|  PREDICTED: CSC1-like protein At1g32090             139   8e-34   
ref|XP_006415254.1|  hypothetical protein EUTSA_v10006831mg             138   1e-33   
ref|XP_001754358.1|  predicted protein                                  137   2e-33   
ref|XP_006304000.1|  hypothetical protein CARUB_v10011444mg             137   3e-33   
ref|XP_009409814.1|  PREDICTED: CSC1-like protein At1g32090             135   1e-32   
emb|CDX76386.1|  BnaA08g10140D                                          134   3e-32   
emb|CDY27442.1|  BnaC03g64820D                                          124   6e-32   
ref|XP_001782141.1|  predicted protein                                  132   1e-31   
emb|CDX79125.1|  BnaA01g11920D                                          130   4e-31   
ref|XP_002969287.1|  hypothetical protein SELMODRAFT_91711              131   5e-31   
gb|KHG01781.1|  putative membrane C2G11.09                              129   1e-30   
gb|AFW81356.1|  hypothetical protein ZEAMMB73_379943                    129   2e-30   
ref|XP_010455943.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    129   3e-30   
ref|XP_010518924.1|  PREDICTED: CSC1-like protein At1g32090             126   3e-29   
ref|XP_008360740.1|  PREDICTED: uncharacterized protein RSN1-like       118   8e-28   
ref|XP_002529341.1|  conserved hypothetical protein                     120   2e-27   
ref|XP_001770572.1|  predicted protein                                  117   2e-26   
ref|XP_001757556.1|  predicted protein                                  114   3e-25   
ref|XP_001759032.1|  predicted protein                                  114   4e-25   
ref|XP_010323041.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    113   5e-25   
gb|EPS60193.1|  hypothetical protein M569_14609                         112   1e-24   
ref|XP_010323040.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    110   4e-24   
ref|XP_010278603.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    104   7e-22   
ref|XP_002986828.1|  hypothetical protein SELMODRAFT_425683             100   2e-20   
ref|XP_002317143.2|  hypothetical protein POPTR_0011s01450g           98.2    2e-20   
ref|XP_006287199.1|  hypothetical protein CARUB_v10000374mg             100   3e-20   
gb|KJB25199.1|  hypothetical protein B456_004G180800                  99.0    3e-20   
ref|XP_010924082.1|  PREDICTED: calcium permeable stress-gated ca...  96.7    4e-19   
ref|XP_010921304.1|  PREDICTED: calcium permeable stress-gated ca...  93.6    4e-18   
gb|KJB22580.1|  hypothetical protein B456_004G055300                  90.5    2e-17   
gb|AAG50793.1|AC074309_10  hypothetical protein                       85.1    9e-17   
ref|XP_001764420.1|  predicted protein                                85.5    2e-15   
ref|XP_006853160.1|  hypothetical protein AMTR_s00038p00185310        83.2    6e-15   
ref|XP_004304272.1|  PREDICTED: CSC1-like protein HYP1                84.0    6e-15   
ref|XP_006483099.1|  PREDICTED: uncharacterized membrane protein ...  83.6    7e-15   
ref|XP_006483098.1|  PREDICTED: uncharacterized membrane protein ...  83.6    9e-15   
ref|XP_001765646.1|  predicted protein                                83.6    9e-15   
ref|XP_009360589.1|  PREDICTED: CSC1-like protein HYP1                82.4    2e-14   
gb|KDO83033.1|  hypothetical protein CISIN_1g0052161mg                77.0    3e-14   
ref|XP_007045993.1|  Early-responsive to dehydration stress prote...  82.0    3e-14   
gb|EYU34204.1|  hypothetical protein MIMGU_mgv1a001911mg              82.0    3e-14   
emb|CAA56145.1|  HYP1                                                 81.3    3e-14   
ref|XP_010029368.1|  PREDICTED: CSC1-like protein HYP1                81.6    3e-14   
ref|XP_002882200.1|  hypothetical protein ARALYDRAFT_477418           81.6    4e-14   
ref|XP_002984025.1|  hypothetical protein SELMODRAFT_156268           81.6    4e-14   
ref|XP_002960116.1|  hypothetical protein SELMODRAFT_450821           81.6    4e-14   
gb|AAF26164.1|AC008261_21  unknown protein                            80.5    5e-14   
ref|XP_011463530.1|  PREDICTED: protein OSCA1-like                    75.1    5e-14   
emb|CDY37544.1|  BnaA05g34090D                                        81.3    6e-14   
ref|XP_009147396.1|  PREDICTED: CSC1-like protein HYP1                80.9    6e-14   
dbj|BAD94293.1|  hypothetical protein                                 80.9    6e-14   
ref|NP_186759.2|  uncharacterized protein                             80.9    6e-14   
emb|CDY43268.1|  BnaC05g48610D                                        80.5    8e-14   
ref|XP_008341608.1|  PREDICTED: phosphate metabolism protein 7-like   80.5    8e-14   
gb|KJB80261.1|  hypothetical protein B456_013G089300                  80.5    8e-14   
ref|XP_006855764.1|  hypothetical protein AMTR_s00044p00184510        80.1    1e-13   
gb|KJB80259.1|  hypothetical protein B456_013G089300                  80.1    1e-13   
ref|XP_006408462.1|  hypothetical protein EUTSA_v10020163mg           80.1    1e-13   
ref|XP_009105488.1|  PREDICTED: CSC1-like protein At1g69450           79.7    2e-13   
ref|XP_010088119.1|  Uncharacterized membrane protein                 79.7    2e-13   
gb|EYU26139.1|  hypothetical protein MIMGU_mgv1a022719mg              79.3    2e-13   
ref|XP_007032618.1|  Early-responsive to dehydration stress prote...  79.0    2e-13   
ref|XP_006574918.1|  PREDICTED: uncharacterized membrane protein ...  79.0    2e-13   
emb|CDY40924.1|  BnaC06g30620D                                        79.0    3e-13   
ref|XP_007157718.1|  hypothetical protein PHAVU_002G092500g           79.0    3e-13   
ref|XP_007216321.1|  hypothetical protein PRUPE_ppa019884mg           79.0    3e-13   
ref|XP_006574916.1|  PREDICTED: uncharacterized membrane protein ...  79.0    3e-13   
ref|XP_007032617.1|  Early-responsive to dehydration stress prote...  79.0    3e-13   
ref|XP_006574920.1|  PREDICTED: uncharacterized membrane protein ...  78.6    3e-13   
ref|NP_177104.2|  Early-responsive to dehydration stress protein ...  78.6    3e-13   
gb|AAG60099.1|AC073178_10  unknown protein                            78.6    3e-13   
ref|XP_008221566.1|  PREDICTED: uncharacterized membrane protein ...  78.6    3e-13   
ref|XP_002892546.1|  hypothetical protein ARALYDRAFT_471124           78.6    4e-13   
ref|XP_009397320.1|  PREDICTED: CSC1-like protein RXW8                78.6    4e-13   
gb|EEC76105.1|  hypothetical protein OsI_13363                        78.2    4e-13   
ref|XP_006299849.1|  hypothetical protein CARUB_v10016052mg           78.2    5e-13   
gb|KDP27183.1|  hypothetical protein JCGZ_19882                       78.2    5e-13   
ref|XP_011010302.1|  PREDICTED: CSC1-like protein HYP1                78.2    5e-13   
gb|KJB14676.1|  hypothetical protein B456_002G137000                  77.8    6e-13   
gb|KJB14682.1|  hypothetical protein B456_002G137000                  77.8    6e-13   
gb|KJB14674.1|  hypothetical protein B456_002G137000                  77.8    6e-13   
gb|KHG29773.1|  Membrane protein                                      77.8    6e-13   
gb|KJB14680.1|  hypothetical protein B456_002G137000                  77.8    7e-13   
gb|EEE59847.1|  hypothetical protein OsJ_12422                        77.8    7e-13   
ref|NP_001051134.1|  Os03g0726300                                     77.8    7e-13   
ref|XP_006391015.1|  hypothetical protein EUTSA_v10018196mg           77.8    7e-13   
ref|XP_010943516.1|  PREDICTED: CSC1-like protein RXW8 isoform X1     77.8    7e-13   
gb|KJB14675.1|  hypothetical protein B456_002G137000                  77.8    7e-13   
gb|ABR16200.1|  unknown                                               77.4    7e-13   
ref|XP_010661092.1|  PREDICTED: CSC1-like protein HYP1 isoform X1     77.4    8e-13   
ref|XP_002305383.1|  HYPOTHETICAL protein 1                           77.4    9e-13   
gb|KDO83034.1|  hypothetical protein CISIN_1g0052161mg                71.6    9e-13   
ref|XP_010661094.1|  PREDICTED: CSC1-like protein HYP1 isoform X3     77.0    1e-12   
gb|KEH30799.1|  ERD (early-responsive to dehydration stress) fami...  76.6    1e-12   
gb|KEH30802.1|  ERD (early-responsive to dehydration stress) fami...  76.6    1e-12   
ref|XP_004981918.1|  PREDICTED: uncharacterized membrane protein ...  77.0    1e-12   
ref|XP_010430647.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...  76.6    1e-12   
gb|KEH30798.1|  ERD (early-responsive to dehydration stress) fami...  76.6    1e-12   
ref|XP_010485425.1|  PREDICTED: CSC1-like protein HYP1                76.6    1e-12   
ref|XP_004516572.1|  PREDICTED: uncharacterized membrane protein ...  76.6    1e-12   
gb|KEH30800.1|  ERD (early-responsive to dehydration stress) fami...  76.6    1e-12   
emb|CBI22257.3|  unnamed protein product                              77.0    1e-12   
ref|XP_008230810.1|  PREDICTED: uncharacterized membrane protein ...  76.6    2e-12   
ref|XP_008230811.1|  PREDICTED: phosphate metabolism protein 7 is...  76.3    2e-12   
ref|XP_006482641.1|  PREDICTED: uncharacterized membrane protein ...  76.6    2e-12   
ref|XP_008643732.1|  PREDICTED: uncharacterized protein LOC100382...  76.3    2e-12   
ref|XP_008230809.1|  PREDICTED: phosphate metabolism protein 7-li...  76.3    2e-12   
ref|XP_006300796.1|  hypothetical protein CARUB_v10019875mg           76.6    2e-12   
ref|XP_007217011.1|  hypothetical protein PRUPE_ppa002110mg           76.6    2e-12   
gb|EPS67360.1|  hypothetical protein M569_07415                       72.0    2e-12   
ref|XP_011098667.1|  PREDICTED: CSC1-like protein HYP1 isoform X1     76.3    2e-12   



>gb|ABK96436.1| unknown [Populus trichocarpa x Populus deltoides]
Length=252

 Score =   229 bits (585),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VHGR+I ALV SQ++ LGL+STK AA SAPFLIALPVLT
Sbjct  86   RHQIINVYNQEYESGAAFWPDVHGRVITALVISQLALLGLMSTKEAAQSAPFLIALPVLT  145

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FC GR++ AF KYPLQEA MKDTLERAR+P  NLKAYLQDAY+HPVFK GD DED
Sbjct  146  IWFHRFCNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKAYLQDAYIHPVFKGGDGDED  205

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            D++S+KLE E +LVPTKRQSR+NTPAPSK+SG SSP +
Sbjct  206  DDLSKKLETESVLVPTKRQSRKNTPAPSKISGASSPSL  243



>ref|XP_010450765.1| PREDICTED: protein OSCA1-like [Camelina sativa]
Length=183

 Score =   224 bits (571),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGR+I AL+ SQ+  + LL+TK AA +APFLIALPV+T
Sbjct  18   RHQIINVYNQEYESAAAFWPDVHGRVISALIISQLLLMDLLATKRAALAAPFLIALPVIT  77

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH F KGRYEPAF +YPL+EA MKDTLERAREP LNLK YLQDAY+HPVFK GDDD+D
Sbjct  78   IGFHRFSKGRYEPAFIRYPLEEAMMKDTLERAREPNLNLKGYLQDAYIHPVFKGGDDDDD  137

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
             ++  KLE E I+VPTKRQ RRNTPAPS+VSG SSP +
Sbjct  138  SDVVGKLEDEVIIVPTKRQLRRNTPAPSRVSGESSPSL  175



>ref|XP_006287117.1| hypothetical protein CARUB_v10000278mg [Capsella rubella]
 gb|EOA20015.1| hypothetical protein CARUB_v10000278mg [Capsella rubella]
Length=772

 Score =   239 bits (610),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQ+  +GLL TKHAA++APFLIALPV+T
Sbjct  607  RHQIINVYNQEYESAAAFWPDVHGRIITALIISQLLLMGLLGTKHAASAAPFLIALPVIT  666

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF +YPLQEA MKDTLERAREP LNLK YLQDAYVHPVFK  DDD+D
Sbjct  667  IGFHRFCKGRYEPAFIRYPLQEAMMKDTLERAREPNLNLKGYLQDAYVHPVFKGDDDDDD  726

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
             +M  KLE E I+VPTKRQSRRNTPAPS++SG SSP +
Sbjct  727  SDMVGKLEDEVIIVPTKRQSRRNTPAPSRISGESSPSL  764



>emb|CDP04437.1| unnamed protein product [Coffea canephora]
Length=768

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII A+V SQ+  +GL+STKHAA S PFL+ALP+LT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIISAMVISQLLLMGLMSTKHAALSTPFLLALPILT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            ISFHL+CKGRYEPAF +YPLQEA MKDTLERA+EP LNLKAYLQ+AY+HPVFK GDDDED
Sbjct  662  ISFHLYCKGRYEPAFRRYPLQEAMMKDTLERAKEPNLNLKAYLQNAYIHPVFKGGDDDED  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            ++   +     +LVPTKRQSRRNTP PSKVSG SSP +
Sbjct  722  EDEIIEKLEATVLVPTKRQSRRNTPVPSKVSGDSSPSL  759



>ref|NP_192343.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_849296.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_849297.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 sp|Q9XEA1.1|CSCL5_ARATH RecName: Full=Protein OSCA1; AltName: Full=CSC1-like protein 
At4g04340; AltName: Full=Protein reduced hyperosmolality-induced 
[Ca(2+)]i increase 1 [Arabidopsis thaliana]
 gb|AAD36947.1|AF069441_7 predicted protein of unknown function [Arabidopsis thaliana]
 emb|CAB77902.1| predicted protein of unknown function [Arabidopsis thaliana]
 gb|AAM13208.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82380.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE82381.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE82382.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AIU34613.1| hyperosmolality-gated Ca2+ permeable channel 1.1 [Arabidopsis 
thaliana]
Length=772

 Score =   237 bits (605),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGR+I AL+ SQ+  +GLL TKHAA++APFLIALPV+T
Sbjct  607  RHQIINVYNQEYESAAAFWPDVHGRVITALIISQLLLMGLLGTKHAASAAPFLIALPVIT  666

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGR+EPAF +YPLQEA MKDTLERAREP LNLK YLQDAY+HPVFK GD+D+D
Sbjct  667  IGFHRFCKGRFEPAFVRYPLQEAMMKDTLERAREPNLNLKGYLQDAYIHPVFKGGDNDDD  726

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
             +M  KLE E I+VPTKRQSRRNTPAPS++SG SSP +
Sbjct  727  GDMIGKLENEVIIVPTKRQSRRNTPAPSRISGESSPSL  764



>ref|XP_006387596.1| hypothetical protein POPTR_0796s00200g [Populus trichocarpa]
 gb|ERP46510.1| hypothetical protein POPTR_0796s00200g [Populus trichocarpa]
Length=168

 Score =   220 bits (560),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 132/158 (84%), Gaps = 2/158 (1%)
 Frame = -3

Query  684  QIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTIS  505
            QIINVYNQEYES AAFWP VHGR+I ALV SQ++ +GL+STK AA S PFLIALPVLTI 
Sbjct  2    QIINVYNQEYESGAAFWPDVHGRVITALVISQLALMGLMSTKEAAQSTPFLIALPVLTIW  61

Query  504  FHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk--egddded  331
            FH FC GR++ AF KYPLQEA MKDTLERAR+P  NLKAYLQ AYVHPVFK  + D DED
Sbjct  62   FHRFCNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKAYLQSAYVHPVFKGGDDDIDED  121

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            D +S K+E E +LVPTKRQSRRNTPAPSK+SGGSSP +
Sbjct  122  DLLSGKMETESVLVPTKRQSRRNTPAPSKISGGSSPSL  159



>gb|AAL07154.1| unknown protein [Arabidopsis thaliana]
Length=772

 Score =   235 bits (599),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGR+I AL+ SQ+  +GLL TKHAA++APFLIALPV+T
Sbjct  607  RHQIINVYNQEYESAAAFWPDVHGRVITALIISQLLLMGLLGTKHAASAAPFLIALPVIT  666

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH FCKGR+EPAF +YPLQEA MKDTLERAREP LNLK YLQDAY+HPVFK GD+D+D
Sbjct  667  TGFHRFCKGRFEPAFVRYPLQEAMMKDTLERAREPNLNLKGYLQDAYIHPVFKGGDNDDD  726

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
             +M  KLE E I+VPTKRQSRRNTPAPS++SG SSP +
Sbjct  727  GDMIGKLENEVIIVPTKRQSRRNTPAPSRISGESSPSL  764



>ref|XP_006396700.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
 ref|XP_006396701.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
 gb|ESQ38153.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
 gb|ESQ38154.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
Length=770

 Score =   235 bits (599),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VHGR+I AL+ SQ+  +GLL TKHAA++APFLI LPVLT
Sbjct  605  RHQIINVYNQEYESGAAFWPDVHGRVISALIISQLLLMGLLGTKHAASAAPFLIVLPVLT  664

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF +YPLQEA MKDTLERA+EP LNLK YLQDAY+HPVFK GDDD++
Sbjct  665  IGFHRFCKGRYEPAFVRYPLQEAMMKDTLERAKEPNLNLKGYLQDAYIHPVFKGGDDDDE  724

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
             +M  KLE E ++VPTKRQSRRNTPAPS++SG SSP +
Sbjct  725  SDMLGKLEEEVVIVPTKRQSRRNTPAPSRISGESSPSL  762



>ref|XP_006348154.1| PREDICTED: uncharacterized protein RSN1-like isoform X2 [Solanum 
tuberosum]
Length=703

 Score =   233 bits (594),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 145/166 (87%), Gaps = 3/166 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRIIFAL FSQ+S LGLL TKHA  SAPFLIALPVLT
Sbjct  538  RHQIINVYNQEYESAAAFWPDVHGRIIFALCFSQLSLLGLLGTKHATQSAPFLIALPVLT  597

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            ISFHL+CKGRYEPAFTKYP+QEA+M+DTLE+AREP LNLK YLQ+AYVHPVFK+ D+DED
Sbjct  598  ISFHLYCKGRYEPAFTKYPIQEARMRDTLEQAREPNLNLKGYLQNAYVHPVFKDDDEDED  657

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSS---PDVILEKE  202
            ++   KLE + +LVPTKRQSR NTP PSKVS GSS   PDV++ ++
Sbjct  658  EDFMMKLETDSVLVPTKRQSRMNTPVPSKVSAGSSPSLPDVVIHEQ  703



>ref|XP_002872689.1| hypothetical protein ARALYDRAFT_911697 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48948.1| hypothetical protein ARALYDRAFT_911697 [Arabidopsis lyrata subsp. 
lyrata]
Length=771

 Score =   234 bits (596),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 133/158 (84%), Gaps = 1/158 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGR+I AL+ SQ+  +GLL TKHAA +APFLIALPV+T
Sbjct  607  RHQIINVYNQEYESAAAFWPDVHGRVITALIISQLLLMGLLGTKHAAFAAPFLIALPVIT  666

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF +YPLQEA MKDTLERAREP LNLK YLQDAY+HPVFK GDDD+ 
Sbjct  667  IGFHRFCKGRYEPAFIRYPLQEAMMKDTLERAREPNLNLKGYLQDAYIHPVFKGGDDDDG  726

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            D + +      I+VPTKRQSRRNTPAPS++SG SSP +
Sbjct  727  DMIGKLENEV-IIVPTKRQSRRNTPAPSRISGESSPSL  763



>ref|XP_010422263.1| PREDICTED: LOW QUALITY PROTEIN: protein OSCA1-like [Camelina 
sativa]
Length=772

 Score =   234 bits (596),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGR+I AL+ SQ+  +GLL+TK AA +APFLIALPV+T
Sbjct  607  RHQIINVYNQEYESAAAFWPDVHGRVISALIISQLLLMGLLATKRAALAAPFLIALPVIT  666

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF +YPL+EA MKDTLERAREP LNLK YLQDAY+HPVFK GDDD+D
Sbjct  667  IGFHRFCKGRYEPAFIRYPLEEAMMKDTLERAREPNLNLKGYLQDAYIHPVFKGGDDDDD  726

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
             ++  KLE E I+VPTKRQSRRNTPAPS+VSG SSP +
Sbjct  727  SDVVGKLEDEVIIVPTKRQSRRNTPAPSRVSGESSPSL  764



>ref|XP_010496174.1| PREDICTED: protein OSCA1-like [Camelina sativa]
Length=772

 Score =   234 bits (596),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGR+I AL+ SQ+  +GLL+TK AA +APFLIALPV+T
Sbjct  607  RHQIINVYNQEYESAAAFWPDVHGRVISALIISQLLLMGLLATKRAALAAPFLIALPVIT  666

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF +YPL+EA MKDTLERAREP LNLK YLQDAY+HPVFK GDDD+D
Sbjct  667  IGFHRFCKGRYEPAFIRYPLEEAMMKDTLERAREPNLNLKGYLQDAYIHPVFKGGDDDDD  726

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
             ++  KLE E I+VPTKRQSRRNTPAPS+VSG SSP +
Sbjct  727  SDVVGKLEDEVIIVPTKRQSRRNTPAPSRVSGESSPSL  764



>ref|XP_011095994.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
Length=769

 Score =   233 bits (595),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESA AFWP VHGRIIFALVFSQ+  +GL+STK AA S PFLIALPVLT
Sbjct  606  RHQIINVYNQEYESAGAFWPDVHGRIIFALVFSQLVLMGLMSTKGAAASTPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH FCKGRYEPAF KYPLQEA +KDTLERAREP LNLK YLQ AYVHPVFK  +DDED
Sbjct  666  FFFHRFCKGRYEPAFVKYPLQEAMIKDTLERAREPGLNLKGYLQYAYVHPVFKNDEDDED  725

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDVILEKE  202
            D++  K+E    ++PTKRQSRRNTP PSK+S  SS DV+ EKE
Sbjct  726  DDLHGKIEESITIIPTKRQSRRNTPVPSKISSESSADVVPEKE  768



>ref|XP_006348153.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Solanum 
tuberosum]
Length=767

 Score =   233 bits (594),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 145/166 (87%), Gaps = 3/166 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRIIFAL FSQ+S LGLL TKHA  SAPFLIALPVLT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIIFALCFSQLSLLGLLGTKHATQSAPFLIALPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            ISFHL+CKGRYEPAFTKYP+QEA+M+DTLE+AREP LNLK YLQ+AYVHPVFK+ D+DED
Sbjct  662  ISFHLYCKGRYEPAFTKYPIQEARMRDTLEQAREPNLNLKGYLQNAYVHPVFKDDDEDED  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSS---PDVILEKE  202
            ++   KLE + +LVPTKRQSR NTP PSKVS GSS   PDV++ ++
Sbjct  722  EDFMMKLETDSVLVPTKRQSRMNTPVPSKVSAGSSPSLPDVVIHEQ  767



>ref|XP_008371060.1| PREDICTED: transmembrane protein 63B-like [Malus domestica]
Length=772

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQ+   GLLSTK AA+S PFLIALPVLT
Sbjct  606  RHQIINVYNQEYESAAAFWPDVHGRIITALIISQLLLFGLLSTKEAASSTPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            +SFH +CKGR+EPAFT YPLQEA MKDTLERAREP LNLK YLQ AY+HPVF E D++ED
Sbjct  666  LSFHRYCKGRFEPAFTTYPLQEAMMKDTLERAREPNLNLKGYLQSAYIHPVFHECDEEED  725

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDVILEKE  202
             E  EK E E ++VPTKRQSRRNTP PS+++GGSSP ++  +E
Sbjct  726  HESFEKEESESVIVPTKRQSRRNTPVPSRMTGGSSPSLLDVEE  768



>ref|XP_009108550.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Brassica rapa]
 ref|XP_009108551.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Brassica rapa]
Length=774

 Score =   231 bits (590),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 134/162 (83%), Gaps = 4/162 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGR+I AL+ SQ+  +GLL TKHAA +APFLIALPVLT
Sbjct  606  RHQIINVYNQEYESAAAFWPDVHGRVIAALIISQVLLMGLLGTKHAALAAPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF +YPLQEAKMKDTLE AREP LNLK YLQ AYVHPVFK G+DD+D
Sbjct  666  IGFHRFCKGRYEPAFVRYPLQEAKMKDTLESAREPNLNLKGYLQSAYVHPVFKGGEDDDD  725

Query  330  demsekle----mEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            DE  +        E I+VPTKRQSRRNTPAPS++SG SSP +
Sbjct  726  DEYGDDKLGKFEDEAIIVPTKRQSRRNTPAPSRISGESSPSL  767



>emb|CDY27443.1| BnaC03g64830D [Brassica napus]
Length=775

 Score =   231 bits (589),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 135/163 (83%), Gaps = 5/163 (3%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGR+I AL+ SQ+  +GLL TKHAA +APFLIALPVLT
Sbjct  606  RHQIINVYNQEYESAAAFWPDVHGRVIAALMISQVLLMGLLGTKHAALAAPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF +YPLQEAKMKDTLE AREP LNLK YLQ AYVHPVFK G+DD+D
Sbjct  666  IGFHRFCKGRYEPAFVRYPLQEAKMKDTLESAREPNLNLKGYLQSAYVHPVFKGGEDDDD  725

Query  330  demseklem-----EGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            D+     ++     E I+VPTKRQSRRNTPAPSK+SG SSP +
Sbjct  726  DDDYGDDKLGKFEDEAIIVPTKRQSRRNTPAPSKISGESSPSL  768



>ref|XP_004232686.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
 ref|XP_010316569.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
 ref|XP_010316570.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
Length=767

 Score =   231 bits (588),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRIIFAL FSQ+S LGLLSTKHA  SAPFLIALPVLT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIIFALCFSQLSLLGLLSTKHATQSAPFLIALPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            ISFHL+CKGRYEPAFTKYP+QEA+M+DTLE+AREP LNLK YLQ+AYVHPVFK+ D+DED
Sbjct  662  ISFHLYCKGRYEPAFTKYPIQEARMRDTLEQAREPNLNLKGYLQNAYVHPVFKDDDEDED  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            ++   KLE + +LVPTKRQSR NTP PSKVS GSSP +
Sbjct  722  EDFMMKLENDSVLVPTKRQSRMNTPVPSKVSAGSSPSL  759



>gb|EYU27725.1| hypothetical protein MIMGU_mgv1a001730mg [Erythranthe guttata]
Length=768

 Score =   231 bits (588),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 136/164 (83%), Gaps = 3/164 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWPAVHGRI+FAL+FSQI  +GL+STK A T+ PFLIALP+++
Sbjct  604  RHQIINVYNQEYESAAAFWPAVHGRIMFALIFSQIVLIGLMSTKRAVTTTPFLIALPIMS  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FHLFC+GR+EPAF  YPLQEA MKDTLERAREP LNLK YLQ++YVHPVFK+ +++ED
Sbjct  664  YFFHLFCRGRFEPAFVNYPLQEAMMKDTLERAREPNLNLKGYLQNSYVHPVFKDEEEEED  723

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSS---PDVILE  208
            D+       +  +V TKRQSRRNTPAPSK+SG SS   PDV+ E
Sbjct  724  DDHVNGKYDDNAVVATKRQSRRNTPAPSKMSGASSPSLPDVVPE  767



>ref|XP_006283166.1| hypothetical protein CARUB_v10004197mg [Capsella rubella]
 gb|EOA16064.1| hypothetical protein CARUB_v10004197mg [Capsella rubella]
Length=771

 Score =   231 bits (588),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 132/159 (83%), Gaps = 1/159 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGR+I ALV SQ+  +GLL TKHAA +APFLIALPVLT
Sbjct  606  RHQIINVYNQEYESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk-egddde  334
            I FH FCKGRYEPAF +YPLQEA MKDTLE AREP LNLK YLQ+AY+HPVFK + D D 
Sbjct  666  IGFHHFCKGRYEPAFIRYPLQEAMMKDTLENAREPNLNLKGYLQNAYIHPVFKGDEDGDN  725

Query  333  ddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
             ++   K E E I+VPTKRQSRRNTPAPS++SG SSP +
Sbjct  726  INDKLGKFEDEAIIVPTKRQSRRNTPAPSRISGESSPSL  764



>ref|XP_011086200.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
 ref|XP_011086201.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
 ref|XP_011086202.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
Length=775

 Score =   231 bits (588),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII ALVFSQ+  +GL+STK AA S PFLIALPVLT
Sbjct  606  RHQIINVYNQEYESAAAFWPDVHGRIISALVFSQLVLMGLMSTKGAAQSTPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF +YPLQEA MKDTLERAREP LNLK+YL+ AY+HPVFK  +D E 
Sbjct  666  IWFHRFCKGRYEPAFIRYPLQEAMMKDTLERAREPNLNLKSYLRYAYIHPVFKNDEDGEH  725

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            D+   +   E +LVPTKRQSR+NTPAPS +SG SSP +
Sbjct  726  DDDISEKLDETVLVPTKRQSRKNTPAPSMLSGASSPSL  763



>ref|XP_002317144.2| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE97756.2| early-responsive to dehydration family protein [Populus trichocarpa]
Length=744

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VHGR+I ALV SQ++ LGL+STK AA SAPFLIALPVLT
Sbjct  578  RHQIINVYNQEYESGAAFWPDVHGRVITALVISQLALLGLMSTKEAAQSAPFLIALPVLT  637

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FC GR++ AF KYPLQEA MKDTLERAR+P  NLKAYLQDAY+HPVFK GDDDED
Sbjct  638  IWFHGFCNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKAYLQDAYIHPVFKGGDDDED  697

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            D++S+KLE E +LVPTKRQSR+NTPAPSK+SG SSP +
Sbjct  698  DDLSKKLETESVLVPTKRQSRKNTPAPSKISGASSPSL  735



>ref|XP_010439363.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
 ref|XP_010439364.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
 ref|XP_010439365.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
Length=771

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGR+I ALV SQ+  +GLL TKHAA +APFLIALPVLT
Sbjct  606  RHQIINVYNQEYESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk-egddde  334
            I FH FCKGRYEPAF +YPLQEA MKDTLE AREP LNLK YLQ+AY+HPVFK + DDD+
Sbjct  666  IGFHHFCKGRYEPAFIRYPLQEAMMKDTLETAREPNLNLKGYLQNAYIHPVFKGDEDDDD  725

Query  333  ddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
             D+   K E E I+VPTKRQSRRNTPAPS++SG SSP +
Sbjct  726  IDDKLGKFEDEAIIVPTKRQSRRNTPAPSRISGESSPSL  764



>ref|XP_010434078.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434079.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434080.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434081.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
Length=771

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGR+I ALV SQ+  +GLL TKHAA +APFLIALPVLT
Sbjct  606  RHQIINVYNQEYESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk-egddde  334
            I FH FCKGRYEPAF +YPLQEA MKDTLE AREP LNLK YLQ+AY+HPVFK + DDD+
Sbjct  666  IGFHHFCKGRYEPAFIRYPLQEAMMKDTLETAREPNLNLKGYLQNAYIHPVFKGDEDDDD  725

Query  333  ddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
             D+   K E E I+VPTKRQSRRNTPAPS++SG SSP +
Sbjct  726  IDDKLGKFEDEAIIVPTKRQSRRNTPAPSRISGESSPSL  764



>ref|XP_009613689.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
Length=767

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRI+FAL FSQ+S LGLLSTKHAA SAPFLIALPVLT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIVFALCFSQLSLLGLLSTKHAAQSAPFLIALPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            ISFHLFCKGRYEPAFTKYP+QEA+M+DTLE+AREP  NLK YLQ+AYVHPVFK  D+DED
Sbjct  662  ISFHLFCKGRYEPAFTKYPIQEARMRDTLEQAREPNFNLKGYLQNAYVHPVFKGDDEDED  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            ++   KLE + ++VPTKRQSR NTP PSKVS GSSP +
Sbjct  722  EDFLNKLENDSVIVPTKRQSRLNTPVPSKVSAGSSPSL  759



>ref|XP_006413690.1| hypothetical protein EUTSA_v10024476mg [Eutrema salsugineum]
 gb|ESQ55143.1| hypothetical protein EUTSA_v10024476mg [Eutrema salsugineum]
Length=771

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 133/159 (84%), Gaps = 1/159 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGR+I AL+ SQ+  +GLL TKHAA +APFLIALPVLT
Sbjct  606  RHQIINVYNQEYESAAAFWPDVHGRVITALIISQLLLMGLLGTKHAALAAPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk-egddde  334
            I FH FCKGRYEPAF +YPLQEA MKDTLE AREP LNLK YLQ AYVHPVF+ + DDD+
Sbjct  666  IGFHRFCKGRYEPAFIRYPLQEAMMKDTLESAREPNLNLKGYLQSAYVHPVFRGDEDDDD  725

Query  333  ddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
             D+   K E E I+VPTKRQSRRNTPAPS++SG SSP +
Sbjct  726  IDDKLGKFEDEAIIVPTKRQSRRNTPAPSRISGESSPSL  764



>emb|CAA18115.1| putative protein [Arabidopsis thaliana]
 emb|CAB79167.1| putative protein [Arabidopsis thaliana]
Length=697

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 131/159 (82%), Gaps = 1/159 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGR+I ALV SQ+  +GLL TKHAA +APFLIALPVLT
Sbjct  532  RHQIINVYNQEYESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLT  591

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk-egddde  334
            I FH FCKGRYEPAF +YPLQEA MKDTLE AREP LNLK YLQ+AYVHPVFK + DD +
Sbjct  592  IGFHHFCKGRYEPAFIRYPLQEAMMKDTLETAREPNLNLKGYLQNAYVHPVFKGDEDDYD  651

Query  333  ddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
             D+   K E E I+VPTKRQSRRNTPAPS +SG  SP +
Sbjct  652  IDDKLGKFEDEAIIVPTKRQSRRNTPAPSIISGDDSPSL  690



>ref|XP_002867790.1| hypothetical protein ARALYDRAFT_492658 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44049.1| hypothetical protein ARALYDRAFT_492658 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   229 bits (583),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 133/159 (84%), Gaps = 1/159 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGR+I ALV SQ+  +GLL TKHAA +APFLIALPVLT
Sbjct  608  RHQIINVYNQEYESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLT  667

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk-egddde  334
            I FH FCKGRYEPAF +YPLQEA MKDTLE AREP LNLK YLQ+AY+HPVFK + DDD+
Sbjct  668  IGFHHFCKGRYEPAFIRYPLQEAMMKDTLESAREPNLNLKGYLQNAYIHPVFKGDEDDDD  727

Query  333  ddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
             D+   K E E I+VPTKRQSRRNTPAPS++SG  SP +
Sbjct  728  IDDKLGKFEDEAIIVPTKRQSRRNTPAPSRISGEDSPSL  766



>ref|XP_009772257.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
Length=767

 Score =   228 bits (581),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRIIFAL FSQ+S LGLLSTKHAA SAPFLIALPVLT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIIFALCFSQLSLLGLLSTKHAAQSAPFLIALPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            ISFHLFCKGRYEPAFTKYP+QEA+M+DTLE+AREP  NLK YLQ+AYVHPVFK  D+DED
Sbjct  662  ISFHLFCKGRYEPAFTKYPIQEARMRDTLEQAREPNFNLKGYLQNAYVHPVFKGDDEDED  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            ++   KLE + ++VPTKR SR NTP PSKVS GSSP +
Sbjct  722  EDFMNKLETDSVIVPTKRHSRLNTPVPSKVSAGSSPSL  759



>ref|XP_010448929.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448930.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448931.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448932.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448933.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448934.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
Length=771

 Score =   228 bits (581),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 133/159 (84%), Gaps = 1/159 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGR+I ALV SQ+  +GLL TKHAA +APFLIALPVLT
Sbjct  606  RHQIINVYNQEYESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk-egddde  334
            I FH FCKGRYEPAF +YPLQEA MKDTLE AREP LNLK YLQ +Y+HPVFK + +DD+
Sbjct  666  IGFHHFCKGRYEPAFIRYPLQEAMMKDTLETAREPNLNLKGYLQTSYIHPVFKGDEEDDD  725

Query  333  ddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
             D+   K E E I+VPTKRQSRRNTPAPS++SG SSP +
Sbjct  726  IDDKLGKFEDEAIIVPTKRQSRRNTPAPSRISGDSSPSL  764



>gb|KDP20707.1| hypothetical protein JCGZ_21178 [Jatropha curcas]
Length=694

 Score =   227 bits (578),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 138/161 (86%), Gaps = 3/161 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAA+WP VHGR++ AL+ SQ+  +GLLSTK AA S PFLIALP+LT
Sbjct  524  RHQIINVYNQEYESAAAYWPDVHGRVVTALIISQVLMIGLLSTKRAALSTPFLIALPILT  583

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk---egdd  340
            I FH FCKGRYEPAF KYPLQEA M+DTLERAREP LNLK YLQ+AY HPVFK   +GD+
Sbjct  584  IWFHRFCKGRYEPAFVKYPLQEAMMRDTLERAREPNLNLKGYLQNAYAHPVFKEADDGDE  643

Query  339  deddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            DED+ +SEKLE E +LVPTKRQSRRNTPAPS++SG SSP +
Sbjct  644  DEDEILSEKLESESVLVPTKRQSRRNTPAPSRISGASSPSL  684



>dbj|BAD93792.1| hypothetical protein [Arabidopsis thaliana]
Length=771

 Score =   228 bits (581),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 131/159 (82%), Gaps = 1/159 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGR+I ALV SQ+  +GLL TKHAA +APFLIALPVLT
Sbjct  606  RHQIINVYNQEYESAAAFWPDVHGRVIAALVISQLFLMGLLGTKHAALAAPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk-egddde  334
            I FH FCKGRYEPAF +YPLQEA MKDTLE AREP LNLK YLQ+AYVHPVFK + DD +
Sbjct  666  IGFHHFCKGRYEPAFIRYPLQEAMMKDTLETAREPNLNLKGYLQNAYVHPVFKGDEDDYD  725

Query  333  ddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
             D+   K E E I+VPTKRQSRRNTPAPS +SG  SP +
Sbjct  726  IDDKLGKFEDEAIIVPTKRQSRRNTPAPSIISGDDSPSL  764



>ref|NP_193943.2| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001078425.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119027.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119028.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119029.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001190796.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 sp|Q5XEZ5.1|CSC1_ARATH RecName: Full=Calcium permeable stress-gated cation channel 1; 
Short=AtCSC1 [Arabidopsis thaliana]
 gb|AAU94384.1| At4g22120 [Arabidopsis thaliana]
 gb|AAW50707.1| At4g22120 [Arabidopsis thaliana]
 gb|AEE84554.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84555.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84556.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84557.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84558.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84559.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AIU34614.1| hyperosmolality-gated Ca2+ permeable channel 1.2 [Arabidopsis 
thaliana]
Length=771

 Score =   228 bits (581),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 131/159 (82%), Gaps = 1/159 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGR+I ALV SQ+  +GLL TKHAA +APFLIALPVLT
Sbjct  606  RHQIINVYNQEYESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk-egddde  334
            I FH FCKGRYEPAF +YPLQEA MKDTLE AREP LNLK YLQ+AYVHPVFK + DD +
Sbjct  666  IGFHHFCKGRYEPAFIRYPLQEAMMKDTLETAREPNLNLKGYLQNAYVHPVFKGDEDDYD  725

Query  333  ddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
             D+   K E E I+VPTKRQSRRNTPAPS +SG  SP +
Sbjct  726  IDDKLGKFEDEAIIVPTKRQSRRNTPAPSIISGDDSPSL  764



>emb|CDY21297.1| BnaC03g29810D [Brassica napus]
Length=768

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 132/159 (83%), Gaps = 1/159 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQ+  +GLL TK AA +APF+IALPV+T
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIITALIISQLLLMGLLVTKRAALAAPFIIALPVIT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF +YPLQEA MKDTLERA+EP LNLK YLQDAY+HPVFK GD+D+D
Sbjct  662  IGFHRFCKGRYEPAFVRYPLQEAMMKDTLERAKEPNLNLKGYLQDAYIHPVFKGGDNDDD  721

Query  330  demseklemEG-ILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            D+          I+VPTKRQSRRNTPAPS++SG SSP +
Sbjct  722  DDSVLGKLEGEVIIVPTKRQSRRNTPAPSRISGESSPSL  760



>ref|XP_011046977.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
 ref|XP_011046978.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 132/160 (83%), Gaps = 2/160 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VHGR+I ALV SQ++ +GL+STK AA S PFLIALPVLT
Sbjct  606  RHQIINVYNQEYESGAAFWPDVHGRVITALVISQLALMGLMSTKEAAQSTPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH+FC GR++ AF KYPLQEA MKDTLERAR+P  NLKAYLQ AYVHPVFK  DDD D
Sbjct  666  IWFHMFCNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKAYLQSAYVHPVFKVDDDDID  725

Query  330  demsek--lemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            ++      +E E +LVPTKRQSRRNTPAPSK+SGGSSP +
Sbjct  726  EDDLLSGKMETESVLVPTKRQSRRNTPAPSKISGGSSPSL  765



>ref|XP_011046975.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
 ref|XP_011046976.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 132/160 (83%), Gaps = 2/160 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VHGR+I ALV SQ++ +GL+STK AA S PFLIALPVLT
Sbjct  606  RHQIINVYNQEYESGAAFWPDVHGRVITALVISQLALMGLMSTKEAAQSTPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH+FC GR++ AF KYPLQEA MKDTLERAR+P  NLKAYLQ AYVHPVFK  DDD D
Sbjct  666  IWFHMFCNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKAYLQSAYVHPVFKVDDDDID  725

Query  330  demsek--lemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            ++      +E E +LVPTKRQSRRNTPAPSK+SGGSSP +
Sbjct  726  EDDLLSGKMETESVLVPTKRQSRRNTPAPSKISGGSSPSL  765



>ref|XP_011014901.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 132/160 (83%), Gaps = 2/160 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VHGR+I ALV SQ++ +GL+STK AA S PFLIALPVLT
Sbjct  606  RHQIINVYNQEYESGAAFWPDVHGRVITALVISQLALMGLMSTKEAAQSTPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH+FC GR++ AF KYPLQEA MKDTLERAR+P  NLKAYLQ AYVHPVFK  DDD D
Sbjct  666  IWFHMFCNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKAYLQSAYVHPVFKVDDDDID  725

Query  330  demsek--lemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            ++      +E E +LVPTKRQSRRNTPAPSK+SGGSSP +
Sbjct  726  EDDLLSGKMETESVLVPTKRQSRRNTPAPSKISGGSSPSL  765



>ref|XP_009134294.1| PREDICTED: CSC1-like protein At4g04340 [Brassica rapa]
 ref|XP_009134295.1| PREDICTED: CSC1-like protein At4g04340 [Brassica rapa]
 ref|XP_009134297.1| PREDICTED: CSC1-like protein At4g04340 [Brassica rapa]
Length=768

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 131/159 (82%), Gaps = 1/159 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII ALV SQ+  +GLL TK AA +APF+IALPV+T
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIITALVISQLLLMGLLVTKRAALAAPFIIALPVIT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF +YPLQEA MKDTLERA+EP LNLK YLQ+AY+HPVFK GD D+D
Sbjct  662  IGFHRFCKGRYEPAFVRYPLQEAMMKDTLERAKEPNLNLKGYLQEAYIHPVFKGGDGDDD  721

Query  330  demseklemEG-ILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            D+          I+VPTKRQSRRNTPAPS++SG SSP +
Sbjct  722  DDSVLGKLEGEVIIVPTKRQSRRNTPAPSRISGESSPSL  760



>emb|CDX90856.1| BnaA03g25360D [Brassica napus]
Length=768

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 131/159 (82%), Gaps = 1/159 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII ALV SQ+  +GLL TK AA +APF+IALPV+T
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIITALVISQLLLMGLLVTKRAALAAPFIIALPVIT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF +YPLQEA MKDTLERA+EP LNLK YLQ+AY+HPVFK GD D+D
Sbjct  662  IGFHRFCKGRYEPAFVRYPLQEAMMKDTLERAKEPNLNLKGYLQEAYIHPVFKGGDGDDD  721

Query  330  demseklemEG-ILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            D+          I+VPTKRQSRRNTPAPS++SG SSP +
Sbjct  722  DDSVLGKLEGEVIIVPTKRQSRRNTPAPSRISGESSPSL  760



>emb|CDX82907.1| BnaC01g13570D [Brassica napus]
Length=768

 Score =   226 bits (576),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 131/158 (83%), Gaps = 2/158 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGR+I AL+ SQ+  +GLL TKHAA +APFLIALPVLT
Sbjct  606  RHQIINVYNQEYESAAAFWPDVHGRVIAALIISQLLLMGLLGTKHAALAAPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF--kegddd  337
            I FH FCKGRYEPAF +YPLQEAKMKDTLE AREP LNL+ YLQ AYVHPVF   E +DD
Sbjct  666  IGFHHFCKGRYEPAFVRYPLQEAKMKDTLESAREPNLNLRGYLQSAYVHPVFRGDEDEDD  725

Query  336  eddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSP  223
             DD+   K E E I+VPTKRQSRRNTPA S++SG SSP
Sbjct  726  YDDDKLGKFEEEAIIVPTKRQSRRNTPAHSRISGESSP  763



>ref|XP_007026161.1| ERD (early-responsive to dehydration stress) family protein isoform 
1 [Theobroma cacao]
 gb|EOY28783.1| ERD (early-responsive to dehydration stress) family protein isoform 
1 [Theobroma cacao]
Length=771

 Score =   225 bits (574),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 130/158 (82%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQI+ +GLLST  AA S PFLIAL VLT
Sbjct  604  RHQIINVYNQEYESAAAFWPDVHGRIIIALLISQITLIGLLSTMQAAQSTPFLIALAVLT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I F+ FCK RYEPAF +YPLQEA MKDTLERAREP LNLK YL +AYVHPVFKE DDD+ 
Sbjct  664  IWFYRFCKARYEPAFVRYPLQEAMMKDTLERAREPNLNLKPYLHNAYVHPVFKEEDDDDG  723

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            D+   K E E +LVPTKRQSRRNTP PS++SG SSP +
Sbjct  724  DDFMFKSENESVLVPTKRQSRRNTPVPSRISGASSPSL  761



>ref|NP_001291223.1| calcium permeable stress-gated cation channel 1 [Populus euphratica]
 gb|AEL95439.1| early-responsive to dehydration-related protein [Populus euphratica]
Length=772

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VHGR+I ALV SQ++ LGL+STK AA SAPFLIALPVLT
Sbjct  606  RHQIINVYNQEYESGAAFWPDVHGRVITALVISQLALLGLMSTKEAAQSAPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH F  GR++ AF KYPLQEA MKDTLERAR+P  NLKAYLQDAY+HPVFK G DDED
Sbjct  666  IWFHSFSNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKAYLQDAYIHPVFKGGGDDED  725

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSP  223
            D++S+ LE E +LVPTKRQSR+NTP PSK+SG SSP
Sbjct  726  DDLSKILETESVLVPTKRQSRKNTPVPSKISGASSP  761



>ref|XP_011002577.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Populus 
euphratica]
Length=772

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VHGR+I ALV SQ++ LGL+STK AA SAPFLIALPVLT
Sbjct  606  RHQIINVYNQEYESGAAFWPDVHGRVITALVISQLALLGLMSTKEAAQSAPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH F  GR++ AF KYPLQEA MKDTLERAR+P  NLKAYLQDAY+HPVFK G DDED
Sbjct  666  IWFHSFSNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKAYLQDAYIHPVFKGGGDDED  725

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSP  223
            D++S+ LE E +LVPTKRQSR+NTP PSK+SG SSP
Sbjct  726  DDLSKILETESVLVPTKRQSRKNTPVPSKISGASSP  761



>ref|XP_006350470.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Solanum 
tuberosum]
Length=767

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 135/165 (82%), Gaps = 2/165 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVY+Q+YES AAFWP VHGRIIFALVFSQIS LGLLSTK AA SAPFLIALPVLT
Sbjct  602  RHQIINVYHQKYESGAAFWPDVHGRIIFALVFSQISLLGLLSTKRAAQSAPFLIALPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            +SFH FCKGRYEPAFT+YPLQEAK KDT+E+A+E  LNLK YLQ+AY+HPVF+  D+D++
Sbjct  662  LSFHYFCKGRYEPAFTRYPLQEAKRKDTIEQAKESKLNLKYYLQNAYLHPVFRGDDEDDN  721

Query  330  demseklemEG--ILVPTKRQSRRNTPAPSKVSGGSSPDVILEKE  202
            +E           +L+P KRQSR NTPAPS++SG S  +++  +E
Sbjct  722  EEELNDKLESNDIVLIPMKRQSRGNTPAPSRISGASQEEMLQHQE  766



>ref|XP_009135587.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brassica 
rapa]
Length=768

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 130/158 (82%), Gaps = 2/158 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGR+I AL+ SQ+  +GLL TKHAA +APFLIALPVLT
Sbjct  606  RHQIINVYNQEYESAAAFWPDVHGRVISALIISQLLLMGLLGTKHAALAAPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF--kegddd  337
            I FH FCKGRYEPAF +YPLQEAKMKDTLE AREP LNL+ YLQ AYVHPVF   E DDD
Sbjct  666  IGFHHFCKGRYEPAFVRYPLQEAKMKDTLENAREPNLNLRGYLQSAYVHPVFRGDEDDDD  725

Query  336  eddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSP  223
             DD+   K E E I+VPTKRQSRRNTPA S++SG S P
Sbjct  726  YDDDKLGKFEEEAIIVPTKRQSRRNTPAHSRISGESPP  763



>ref|XP_009357605.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Pyrus 
x bretschneideri]
Length=771

 Score =   223 bits (569),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 134/163 (82%), Gaps = 1/163 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQ+   GLLSTK AA+S PFLIALPVLT
Sbjct  606  RHQIINVYNQEYESAAAFWPDVHGRIITALIISQLLLFGLLSTKKAASSTPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            + F  +CKGR+EPAFT YPLQEA MKDTLERAREP LNLK YLQ AY+HPVF +  D+E+
Sbjct  666  LWFRSYCKGRFEPAFTTYPLQEAMMKDTLERAREPNLNLKGYLQSAYIHPVF-QECDEEE  724

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDVILEKE  202
            D   EK E E ++VPTKRQSRRNTP PS+++GGSSP ++  +E
Sbjct  725  DHEFEKDESESVIVPTKRQSRRNTPVPSRMTGGSSPSLLDVEE  767



>ref|XP_009803475.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
 ref|XP_009803477.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
Length=768

 Score =   223 bits (568),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 139/157 (89%), Gaps = 1/157 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ+YES AAFWP VHGRIIFALVFSQ+S LGLL TKHAA SAPFLIALPVLT
Sbjct  602  RHQIINVYNQKYESGAAFWPDVHGRIIFALVFSQLSLLGLLGTKHAAQSAPFLIALPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            ISFH FCKGRYEPAFT+YPLQEA+ KDTLERA+EP LNLKAYLQ+AY+HPVFK  D+DED
Sbjct  662  ISFHKFCKGRYEPAFTRYPLQEARRKDTLERAKEPNLNLKAYLQNAYLHPVFKSDDEDED  721

Query  330  demseklemEG-ILVPTKRQSRRNTPAPSKVSGGSSP  223
            +E  +KLE  G +LVPTKRQSR NTPAPS++S  SSP
Sbjct  722  EEFDDKLESNGTVLVPTKRQSRENTPAPSRMSANSSP  758



>ref|XP_007211353.1| hypothetical protein PRUPE_ppa001728mg [Prunus persica]
 gb|EMJ12552.1| hypothetical protein PRUPE_ppa001728mg [Prunus persica]
Length=773

 Score =   223 bits (568),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGR++ AL+ SQ+   GLLSTK AA S PFLIALPVLT
Sbjct  606  RHQIINVYNQEYESAAAFWPDVHGRVVSALIISQLLLFGLLSTKRAAQSTPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I F+ +CKGR+EPAF  YPLQEA MKDTLERA+EP LNLK YLQ AYVHPVF++ DDDED
Sbjct  666  IWFYRYCKGRFEPAFVTYPLQEAMMKDTLERAKEPNLNLKGYLQSAYVHPVFRDCDDDED  725

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            +E  +K E E ++VPTKR SRRNTP PSK++GGSSP +
Sbjct  726  NESIDKGENESVIVPTKRHSRRNTPVPSKMTGGSSPSL  763



>ref|XP_009357481.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Pyrus x bretschneideri]
Length=772

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQ+   GLLSTK AA S PFLIALPVLT
Sbjct  606  RHQIINVYNQEYESAAAFWPDVHGRIITALIISQLLLFGLLSTKKAAQSTPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            + FH +CKGR+EPAF +YPLQEA MKDTLE+AREP LNLK YLQ AY+HPVFKE DD+ED
Sbjct  666  LWFHRYCKGRFEPAFKRYPLQEAMMKDTLEQAREPNLNLKGYLQSAYIHPVFKECDDEED  725

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSP  223
             E  EK E E ++V TKR SRRNTPAPS+++GGSSP
Sbjct  726  HESFEKGETESVIVATKRHSRRNTPAPSRMTGGSSP  761



>ref|XP_008224710.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Prunus 
mume]
Length=773

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGR++ AL+ SQ+   GLLSTK AA S PFLIALPVLT
Sbjct  606  RHQIINVYNQEYESAAAFWPDVHGRVVSALIISQLLLFGLLSTKEAAQSTPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I F+ +CKGR+EPAF  YPLQEA MKDTLERA+EP LNLK YLQ AYVHPVF++ DDDED
Sbjct  666  IWFYRYCKGRFEPAFVTYPLQEAMMKDTLERAKEPNLNLKGYLQSAYVHPVFRDCDDDED  725

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            +E  +K E E ++VPTKR SRRNTP PS+++GGSSP +
Sbjct  726  NESIDKGENESVIVPTKRHSRRNTPVPSRMTGGSSPSL  763



>ref|XP_002518432.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43819.1| conserved hypothetical protein [Ricinus communis]
Length=773

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 136/166 (82%), Gaps = 3/166 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVY+QEYES AAFWP VHGR+I AL+ SQ+  +GLLSTK AA S PFLI LPVLT
Sbjct  604  RHQIINVYDQEYESGAAFWPDVHGRVITALIISQVLMIGLLSTKRAAQSTPFLIVLPVLT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk---egdd  340
            I FH FCKGRYEPAF KYPLQEA MKDTLERAREP LNLK +LQ+AY HPVFK     DD
Sbjct  664  IWFHRFCKGRYEPAFVKYPLQEAMMKDTLERAREPNLNLKPFLQNAYRHPVFKNDDGDDD  723

Query  339  deddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDVILEKE  202
            DE+D++SEKLE E +LVPTKRQSRRNTP PS++SG SSP +   KE
Sbjct  724  DENDDISEKLETESVLVPTKRQSRRNTPVPSRISGASSPSLSELKE  769



>ref|XP_009619499.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
 ref|XP_009619500.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
Length=768

 Score =   220 bits (561),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 140/157 (89%), Gaps = 1/157 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ+YES AAFWP VHGR+IFALVFSQ+S LGLLSTKHA  SAPFLIALPVLT
Sbjct  602  RHQIINVYNQKYESGAAFWPDVHGRVIFALVFSQLSLLGLLSTKHAVQSAPFLIALPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            ISFH FCKGRYEPAFT+YPLQEA+ KDTLERA+EP LNLKAYLQ+AY+HPVFK  D+DED
Sbjct  662  ISFHKFCKGRYEPAFTRYPLQEARRKDTLERAKEPNLNLKAYLQNAYLHPVFKGDDEDED  721

Query  330  demseklemEG-ILVPTKRQSRRNTPAPSKVSGGSSP  223
            +E+ +KLE  G +LVPTKRQSR NTPAPS++S  SSP
Sbjct  722  EEIDDKLESNGTVLVPTKRQSRENTPAPSRMSANSSP  758



>ref|XP_010539247.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Tarenaya 
hassleriana]
 ref|XP_010539248.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Tarenaya 
hassleriana]
Length=771

 Score =   220 bits (560),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 135/160 (84%), Gaps = 1/160 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VHGRII AL+ SQ+  LGLL TKHAA SAPFLIALPVLT
Sbjct  606  RHQIINVYNQEYESGAAFWPDVHGRIIAALIISQLLLLGLLGTKHAAMSAPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk-egddde  334
            + FH FCKGR+EPAF KYPLQEA MKDTLERAREP LNLK YLQ+AY+HPVFK + DDD+
Sbjct  666  LGFHRFCKGRFEPAFVKYPLQEAMMKDTLERAREPNLNLKGYLQNAYIHPVFKGDEDDDD  725

Query  333  ddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDVI  214
             D+M  KLE E + VPTKRQSRRNTPAPS++SG  SP ++
Sbjct  726  IDDMFGKLEDEAVTVPTKRQSRRNTPAPSRISGEDSPSLL  765



>ref|XP_004231619.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
 ref|XP_010315702.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
Length=765

 Score =   220 bits (560),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVY+QEYES AAFWP VHGRIIFALVFSQIS LGLLSTK AA SAPFLIALPVLT
Sbjct  601  RHQIINVYHQEYESGAAFWPDVHGRIIFALVFSQISLLGLLSTKRAAQSAPFLIALPVLT  660

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            +SFH FCKGRYEPAFT+YPLQEAK KDT+E+A+E  LNLK YLQ AY+HPVF+  D D++
Sbjct  661  LSFHYFCKGRYEPAFTRYPLQEAKRKDTIEQAKESKLNLKYYLQKAYLHPVFRGDDVDDN  720

Query  330  demseklemEGI-LVPTKRQSRRNTPAPSKVSGGSSPDVILEKE  202
            +++++KLE   + L+P KR SR +TP PS++SG S  +++  +E
Sbjct  721  EDVNDKLESNDVELIPMKRHSRGSTPGPSRISGASQEEMLQHQE  764



>gb|KJB69238.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69240.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=610

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 131/158 (83%), Gaps = 2/158 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQ++ +GLL++K AA S PFLIAL VLT
Sbjct  442  RHQIINVYNQEYESAAAFWPDVHGRIIIALLISQVALIGLLTSKKAAQSTPFLIALVVLT  501

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I F+ FCK RYEPAF +YPLQEA MKDTLERAREP LNLK YLQ+AY+HPV    ++DE+
Sbjct  502  IWFYTFCKARYEPAFVRYPLQEAMMKDTLERAREPNLNLKPYLQNAYIHPV--FKEEDEE  559

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            DE   K E E +LVPTKRQSRR+TPAPS++SG SSP +
Sbjct  560  DEFDFKSENESVLVPTKRQSRRSTPAPSRISGASSPSL  597



>gb|KDP30779.1| hypothetical protein JCGZ_13722 [Jatropha curcas]
Length=770

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ YESAAA+WP VHGRII ALV SQ+  +GLLSTKHAA S P L+ LPVLT
Sbjct  602  RHQIINVYNQAYESAAAYWPDVHGRIIVALVVSQLLLMGLLSTKHAAQSTPLLVTLPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FHLFCKGRYEPAF +YPLQEA MKDTLERAREP LNLK++ Q+AY+HPVF  GDD + 
Sbjct  662  IWFHLFCKGRYEPAFVRYPLQEAMMKDTLERAREPNLNLKSFFQNAYIHPVFNGGDDSDH  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDVILEKE  202
            +E++E+LE E +LVPT+RQSRRNTP PS  SG  S   +L ++
Sbjct  722  EEVTEELEKEPVLVPTRRQSRRNTPLPSNRSGSFSSLALLPED  764



>ref|XP_011007190.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011007191.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011007193.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=767

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII A++ SQ+  +GLLSTK AA S P LIALPVLT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLIALPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FHLFCKGRYEPAF +YPLQEA MKDTLERAREP LNLK++LQ+AY+HPVFK  DD + 
Sbjct  662  IWFHLFCKGRYEPAFVRYPLQEAMMKDTLERAREPKLNLKSFLQNAYIHPVFKGEDDSDS  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSS  226
            DE  E+ E E  LVPTKRQSRRNTP PSK    +S
Sbjct  722  DEAPEEFEKEPDLVPTKRQSRRNTPLPSKHGSAAS  756



>ref|XP_008384098.1| PREDICTED: uncharacterized protein RSN1 [Malus domestica]
Length=771

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 130/158 (82%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVY QEYESAAAFWP VHGRII AL+ SQ+   GLLSTK AA S PFLIALPVLT
Sbjct  606  RHQIINVYKQEYESAAAFWPDVHGRIITALIISQLLLFGLLSTKKAAQSTPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            + FH +CKGR+EPAF  +PLQEA MKDTLE+AR+P LNLK YLQ AY+HPVFKE  D+ D
Sbjct  666  LXFHRYCKGRFEPAFKTFPLQEAMMKDTLEQARDPNLNLKGYLQSAYIHPVFKECGDEXD  725

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            +E  +K E E ++V TKRQSRRNTPAPS+++GGSSP +
Sbjct  726  NESLZKSETESVIVATKRQSRRNTPAPSRMTGGSSPSM  763



>ref|XP_009592755.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana tomentosiformis]
 ref|XP_009592756.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana tomentosiformis]
Length=768

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQ+  +GLLSTK A+ S P LI LPVLT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIITALIVSQLLLMGLLSTKGASHSTPLLITLPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FHLFCKGRYEPAF +YPLQEA MKDTLER REP  NLK YLQDAY+HPVFK  +D E 
Sbjct  662  IWFHLFCKGRYEPAFVRYPLQEAVMKDTLERTREPNFNLKEYLQDAYIHPVFKGEEDIES  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSP  223
            D  S+  E+E  LVPTKRQSR NTP PSK SG S P
Sbjct  722  DAASKDGELEPSLVPTKRQSRFNTPLPSKRSGSSPP  757



>ref|XP_010686787.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010686788.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Beta 
vulgaris subsp. vulgaris]
Length=764

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP+VHGRII A+VFSQ+  +GL+ TK AA+S+PFLIALP+LT
Sbjct  602  RHQIINVYNQEYESAAAFWPSVHGRIISAMVFSQLLLMGLIGTKKAASSSPFLIALPILT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGR+EPAF  YPLQEA MKDTLERAR+P  NLK YLQ+AY+HPVFK  DDD+ 
Sbjct  662  IWFHRFCKGRFEPAFKTYPLQEAMMKDTLERARDPNFNLKGYLQNAYIHPVFKSEDDDDI  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSS  226
             +   ++E E  LVPT+RQSRRNTP PSK+S  SS
Sbjct  722  IQNKLEMETE--LVPTRRQSRRNTPVPSKMSHASS  754



>ref|XP_006469645.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X3 [Citrus sinensis]
Length=599

 Score =   215 bits (548),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII ALV SQ+  +GLLSTK AA S P LI LP+LT
Sbjct  442  RHQIINVYNQEYESAAAFWPDVHGRIITALVVSQLLLMGLLSTKEAAQSTPLLITLPILT  501

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF +YPLQEA MKDTLERAREP LNLK++LQ AY+HPVFKE ++ E 
Sbjct  502  IWFHRFCKGRYEPAFVRYPLQEAMMKDTLERAREPNLNLKSFLQIAYIHPVFKEVEECES  561

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSS  226
            D  SE+ + E +L+PTKRQSR NTP PSK SG  +
Sbjct  562  DPASEESDQEPVLIPTKRQSRMNTPLPSKHSGSMT  596



>ref|XP_009772361.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772362.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772364.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772365.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
Length=768

 Score =   218 bits (555),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQ+  +GLLSTK A+ S P LI LPVLT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIITALIVSQLLLMGLLSTKGASHSTPLLITLPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FHLFCKGRYEPAF +YPLQEA MKDTLER REP  NLK YLQDAY+HPVFK  +D E 
Sbjct  662  IWFHLFCKGRYEPAFIRYPLQEAVMKDTLERTREPNFNLKEYLQDAYIHPVFKGEEDIES  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSP  223
            D  SE  ++E  LVPTKRQSR NTP PSK SG S P
Sbjct  722  DAASEDGKLEPSLVPTKRQSRFNTPLPSKRSGSSPP  757



>ref|XP_010099166.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB77038.1| Uncharacterized membrane protein [Morus notabilis]
Length=779

 Score =   218 bits (554),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 128/158 (81%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VH RII AL+ SQ++ LGLL TK  A S P LI LPVLT
Sbjct  606  RHQIINVYNQEYESGAAFWPDVHLRIIIALITSQVALLGLLGTKENAQSTPVLIVLPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I F  FCKGRYE AF KYPLQEA MKDTLERAREP LNLK YLQ AY+HP+FKE +D++D
Sbjct  666  IWFFRFCKGRYESAFVKYPLQEAMMKDTLERAREPHLNLKGYLQVAYIHPIFKESEDEDD  725

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            D +SEK + E  LVPTKRQSRRNTP PSK+SGGSSP +
Sbjct  726  DVVSEKWDTESTLVPTKRQSRRNTPLPSKISGGSSPSM  763



>ref|XP_010035539.1| PREDICTED: CSC1-like protein At3g21620 [Eucalyptus grandis]
 ref|XP_010035541.1| PREDICTED: CSC1-like protein At3g21620 [Eucalyptus grandis]
 gb|KCW46963.1| hypothetical protein EUGRSUZ_K00773 [Eucalyptus grandis]
Length=756

 Score =   217 bits (553),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRIIFA++ SQ+  +GLLSTK AA S P LI LPVLT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIIFAMIISQLLLMGLLSTKEAAQSTPLLITLPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FHLFCKGRYEPAF +YPLQEA MKDTLE+ REP LNLK +LQ AY+HPVFKEGDD + 
Sbjct  662  IGFHLFCKGRYEPAFRRYPLQEAMMKDTLEKVREPNLNLKGFLQTAYIHPVFKEGDDSDS  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGG  232
            D  ++++  E +LVPTKR SRR+TP PSK SG 
Sbjct  722  DSATDEIVEEPVLVPTKRHSRRSTPLPSKHSGS  754



>ref|XP_008459005.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
melo]
 ref|XP_008459006.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
melo]
Length=773

 Score =   218 bits (554),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII+AL+FSQ+  +GLLSTK AA S PFLIALPV+T
Sbjct  606  RHQIINVYNQEYESAAAFWPDVHGRIIYALIFSQVVLMGLLSTKKAAQSTPFLIALPVIT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            ISFHL+CKGRYEPAF +YP+QEA MKDTLERAREP LNLK YL  AY HPVFKE +DD++
Sbjct  666  ISFHLYCKGRYEPAFIRYPIQEAMMKDTLERAREPNLNLKGYLHAAYAHPVFKESEDDDE  725

Query  330  demseklemEGILVPTKRQSRRNTP  256
             E +E  E E +LV TKRQSRRNTP
Sbjct  726  VESNEAFETESVLVATKRQSRRNTP  750



>gb|KJB69243.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=764

 Score =   217 bits (553),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 131/158 (83%), Gaps = 2/158 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQ++ +GLL++K AA S PFLIAL VLT
Sbjct  596  RHQIINVYNQEYESAAAFWPDVHGRIIIALLISQVALIGLLTSKKAAQSTPFLIALVVLT  655

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I F+ FCK RYEPAF +YPLQEA MKDTLERAREP LNLK YLQ+AY+HPV    ++DE+
Sbjct  656  IWFYTFCKARYEPAFVRYPLQEAMMKDTLERAREPNLNLKPYLQNAYIHPV--FKEEDEE  713

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            DE   K E E +LVPTKRQSRR+TPAPS++SG SSP +
Sbjct  714  DEFDFKSENESVLVPTKRQSRRSTPAPSRISGASSPSL  751



>gb|KJB69239.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=772

 Score =   217 bits (553),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 131/158 (83%), Gaps = 2/158 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQ++ +GLL++K AA S PFLIAL VLT
Sbjct  604  RHQIINVYNQEYESAAAFWPDVHGRIIIALLISQVALIGLLTSKKAAQSTPFLIALVVLT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I F+ FCK RYEPAF +YPLQEA MKDTLERAREP LNLK YLQ+AY+HPV    ++DE+
Sbjct  664  IWFYTFCKARYEPAFVRYPLQEAMMKDTLERAREPNLNLKPYLQNAYIHPV--FKEEDEE  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            DE   K E E +LVPTKRQSRR+TPAPS++SG SSP +
Sbjct  722  DEFDFKSENESVLVPTKRQSRRSTPAPSRISGASSPSL  759



>gb|KJB69236.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69242.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69244.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=772

 Score =   217 bits (553),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 131/158 (83%), Gaps = 2/158 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQ++ +GLL++K AA S PFLIAL VLT
Sbjct  604  RHQIINVYNQEYESAAAFWPDVHGRIIIALLISQVALIGLLTSKKAAQSTPFLIALVVLT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I F+ FCK RYEPAF +YPLQEA MKDTLERAREP LNLK YLQ+AY+HPV    ++DE+
Sbjct  664  IWFYTFCKARYEPAFVRYPLQEAMMKDTLERAREPNLNLKPYLQNAYIHPV--FKEEDEE  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            DE   K E E +LVPTKRQSRR+TPAPS++SG SSP +
Sbjct  722  DEFDFKSENESVLVPTKRQSRRSTPAPSRISGASSPSL  759



>ref|XP_002321139.1| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE99454.1| early-responsive to dehydration family protein [Populus trichocarpa]
Length=768

 Score =   217 bits (552),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII A++ SQ+  +GLLSTK AA S P LI LP+LT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPILT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FHLFCKGRYEPAF +YPLQEA MKDTLERAREP LNLK++LQ+AY HPVFK  DD + 
Sbjct  662  IWFHLFCKGRYEPAFVRYPLQEAMMKDTLERAREPNLNLKSFLQNAYSHPVFKGEDDSDS  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGG  232
            DE  E+ E E  LVPTKRQSRRNTP PSK SG 
Sbjct  722  DEAPEEFEKEPDLVPTKRQSRRNTPLPSKHSGS  754



>gb|KHN38468.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=758

 Score =   217 bits (552),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 127/156 (81%), Gaps = 1/156 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRIIFALV SQ+  +GLLSTK AA S P LI LP+LT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIIFALVISQLLLMGLLSTKEAANSTPLLITLPILT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            ISFHL+CKGRYEPAF K+PLQEA MKDTLERAREP  NLK +LQ+AY+HPVFK  DD + 
Sbjct  662  ISFHLYCKGRYEPAFVKHPLQEAMMKDTLERAREPNFNLKEFLQNAYIHPVFKGDDDSDS  721

Query  330  demseklemEG-ILVPTKRQSRRNTPAPSKVSGGSS  226
            D MSE  E +  +LV TKRQSR+NTP PSK SG  S
Sbjct  722  DVMSENWEEQEPVLVQTKRQSRKNTPLPSKHSGSLS  757



>ref|XP_003519463.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Glycine 
max]
Length=760

 Score =   217 bits (552),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 127/156 (81%), Gaps = 1/156 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRIIFALV SQ+  +GLLSTK AA S P LI LP+LT
Sbjct  604  RHQIINVYNQEYESAAAFWPDVHGRIIFALVISQLLLMGLLSTKEAANSTPLLITLPILT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            ISFHL+CKGRYEPAF K+PLQEA MKDTLERAREP  NLK +LQ+AY+HPVFK  DD + 
Sbjct  664  ISFHLYCKGRYEPAFVKHPLQEAMMKDTLERAREPNFNLKEFLQNAYIHPVFKGDDDSDS  723

Query  330  demseklemEG-ILVPTKRQSRRNTPAPSKVSGGSS  226
            D MSE  E +  +LV TKRQSR+NTP PSK SG  S
Sbjct  724  DVMSENWEEQEPVLVQTKRQSRKNTPLPSKHSGSLS  759



>ref|XP_002301612.2| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE80885.2| early-responsive to dehydration family protein [Populus trichocarpa]
Length=763

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII A++ SQ+  +GLLSTK AA S P LI LPVLT
Sbjct  598  RHQIINVYNQEYESAAAFWPDVHGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPVLT  657

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FHLFCKGRYEPAF +YPLQEA MKDTLERA+EP LNLK++LQ+AY+HPVFK  DD + 
Sbjct  658  IWFHLFCKGRYEPAFVRYPLQEAMMKDTLERAKEPNLNLKSFLQNAYIHPVFKGEDDSDS  717

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSS  226
            DE  E+ E E  LVPTKRQSRRNTP PSK    +S
Sbjct  718  DEAPEEFEKEPDLVPTKRQSRRNTPLPSKHGSAAS  752



>ref|XP_003549667.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X1 [Glycine max]
 ref|XP_006600300.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X2 [Glycine max]
 gb|KHN03500.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=775

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 131/161 (81%), Gaps = 3/161 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VH R+I AL+ SQI  +GLL+TK AA+S PFLI LPVLT
Sbjct  604  RHQIINVYNQEYESGAAFWPDVHFRVIIALIVSQIVLMGLLTTKKAASSTPFLIVLPVLT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegd---d  340
            I FH++CKGR+EPAF +YPLQEA MKDTLERA +P  NLKAYLQ+AYVHPVFK      D
Sbjct  664  IWFHIYCKGRFEPAFVRYPLQEAMMKDTLERATDPNFNLKAYLQNAYVHPVFKASLFDED  723

Query  339  deddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            ++++ MS KLE E + VPTKRQSRRNTP PS++SG SSP +
Sbjct  724  EDEEVMSLKLETESLTVPTKRQSRRNTPLPSRISGASSPSL  764



>gb|KCW77011.1| hypothetical protein EUGRSUZ_D01358 [Eucalyptus grandis]
Length=663

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 130/160 (81%), Gaps = 2/160 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VH R+I ALV SQ+   GL++TK AA S PFLIALPVLT
Sbjct  495  RHQIINVYNQEYESAAAFWPDVHRRVIVALVVSQLLLFGLMATKQAANSTPFLIALPVLT  554

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH+FCKGR+EPAF +YPLQEA MKDTLERAREP +NLK++LQ+AY+HPVFK  DDD++
Sbjct  555  IYFHMFCKGRFEPAFVRYPLQEAMMKDTLERAREPHVNLKSFLQNAYLHPVFKSADDDDE  614

Query  330  demsekle--mEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            D+     +   E +LVPTKR SRRNTP PS++S  SSP +
Sbjct  615  DDDDVDEKWDNESVLVPTKRSSRRNTPLPSRISTTSSPSL  654



>ref|XP_006447609.1| hypothetical protein CICLE_v10014378mg [Citrus clementina]
 ref|XP_006469643.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469644.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Citrus sinensis]
 gb|ESR60849.1| hypothetical protein CICLE_v10014378mg [Citrus clementina]
Length=759

 Score =   215 bits (548),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII ALV SQ+  +GLLSTK AA S P LI LP+LT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIITALVVSQLLLMGLLSTKEAAQSTPLLITLPILT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF +YPLQEA MKDTLERAREP LNLK++LQ AY+HPVFKE ++ E 
Sbjct  662  IWFHRFCKGRYEPAFVRYPLQEAMMKDTLERAREPNLNLKSFLQIAYIHPVFKEVEECES  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSS  226
            D  SE+ + E +L+PTKRQSR NTP PSK SG  +
Sbjct  722  DPASEESDQEPVLIPTKRQSRMNTPLPSKHSGSMT  756



>ref|XP_002264502.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655368.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655369.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655370.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 emb|CBI23200.3| unnamed protein product [Vitis vinifera]
Length=771

 Score =   215 bits (548),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VHGRII AL+ SQ+  +GLLSTK AA S PFLIALP+LT
Sbjct  604  RHQIINVYNQEYESGAAFWPDVHGRIIGALIISQLLLMGLLSTKQAAQSTPFLIALPILT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            ISFH +CKGR+EPAF +YPLQEAKMKDTLERAREP LNLK YLQ AY+HPVFK  +DDE+
Sbjct  664  ISFHYYCKGRFEPAFIRYPLQEAKMKDTLERAREPHLNLKGYLQTAYIHPVFKSAEDDEE  723

Query  330  demseklemEGILVPTKRQSRRNTPAP  250
            +E+  K E +  LVPTKRQSRRNTP P
Sbjct  724  EEIHGKWEHDAELVPTKRQSRRNTPLP  750



>gb|KHG01808.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=772

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 130/158 (82%), Gaps = 2/158 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQ++ +GLL++K AA S PFLIAL VLT
Sbjct  604  RHQIINVYNQEYESAAAFWPDVHGRIIIALLISQVALIGLLTSKKAAQSTPFLIALVVLT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I F+  CK RYEPAF +YPLQEA MKDTLERAREP LNLK YLQ+AY+HPV    ++DE+
Sbjct  664  IWFYTLCKARYEPAFVRYPLQEAMMKDTLERAREPNLNLKPYLQNAYIHPV--FKEEDEE  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            DE   K E E +LVPTKRQSRR+TPAPS++SG SSP +
Sbjct  722  DEFDFKSENESVLVPTKRQSRRSTPAPSRISGASSPSL  759



>ref|XP_003616997.1| Transmembrane protein [Medicago truncatula]
 gb|AES99955.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=766

 Score =   214 bits (545),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESA AFWP VHGRI+FALV SQ+  +GLLSTK AA S P LIALPVLT
Sbjct  602  RHQIINVYNQEYESAGAFWPDVHGRIVFALVVSQLLLMGLLSTKEAANSTPLLIALPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKG YEPAFT +PLQEA +KDTLER +EP  NLK +L DAY+HPVF +  D + 
Sbjct  662  IWFHRFCKGSYEPAFTTHPLQEAMVKDTLERTKEPNFNLKDFLHDAYIHPVFNDDGDTDS  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGS  229
            D MS++ + E ++V TKRQSR+NTPAPSK SGGS
Sbjct  722  DVMSQEWKEEPVIVQTKRQSRKNTPAPSKHSGGS  755



>ref|XP_010052882.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Eucalyptus grandis]
 gb|KCW77010.1| hypothetical protein EUGRSUZ_D01358 [Eucalyptus grandis]
Length=774

 Score =   214 bits (545),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 130/160 (81%), Gaps = 2/160 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VH R+I ALV SQ+   GL++TK AA S PFLIALPVLT
Sbjct  606  RHQIINVYNQEYESAAAFWPDVHRRVIVALVVSQLLLFGLMATKQAANSTPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH+FCKGR+EPAF +YPLQEA MKDTLERAREP +NLK++LQ+AY+HPVFK  DDD++
Sbjct  666  IYFHMFCKGRFEPAFVRYPLQEAMMKDTLERAREPHVNLKSFLQNAYLHPVFKSADDDDE  725

Query  330  demsekle--mEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            D+     +   E +LVPTKR SRRNTP PS++S  SSP +
Sbjct  726  DDDDVDEKWDNESVLVPTKRSSRRNTPLPSRISTTSSPSL  765



>dbj|BAF98597.1| CM0545.360.nc [Lotus japonicus]
Length=755

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP +HGRIIFALV SQ+  +GLLSTK AA S P LI LPVLT
Sbjct  602  RHQIINVYNQEYESAAAFWPDIHGRIIFALVISQLLLMGLLSTKEAANSTPLLIILPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FHLFCKGRYEPAF ++PLQEA MKDTLERAREP LN K +LQ+AY+HPVFK  +D + 
Sbjct  662  IWFHLFCKGRYEPAFVQHPLQEAMMKDTLERAREPQLNYKEFLQNAYIHPVFKSDEDSDS  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVS  238
            D MS++ E E +LV TKRQSR+NTP PSK S
Sbjct  722  DVMSQEFEDEPMLVQTKRQSRKNTPLPSKHS  752



>ref|XP_006383869.1| hypothetical protein POPTR_0004s00750g [Populus trichocarpa]
 gb|ERP61666.1| hypothetical protein POPTR_0004s00750g [Populus trichocarpa]
Length=802

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 131/158 (83%), Gaps = 1/158 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VHGRII  LV SQ++ +GLLSTK AA S PFLIALPVLT
Sbjct  637  RHQIINVYNQEYESGAAFWPDVHGRIITGLVISQLALMGLLSTKEAAQSTPFLIALPVLT  696

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FC GR++ AF KYPLQEA MKDTLERAR+P  NLKA L  AYVHP+F +GDDD++
Sbjct  697  IWFHRFCNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKACLHSAYVHPIF-KGDDDDE  755

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            D++S ++E E +LVPTKRQS+RNTP PSK+SGG SP +
Sbjct  756  DDLSVEMETESVLVPTKRQSQRNTPVPSKISGGYSPSL  793



>ref|XP_003529649.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Glycine max]
 ref|XP_006584087.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Glycine max]
 gb|KHN35714.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=777

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 130/162 (80%), Gaps = 4/162 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VH R+I AL+ SQI  +GLL+TK AA+S PFLI LPVLT
Sbjct  604  RHQIINVYNQEYESGAAFWPDVHFRVIIALIVSQIVLMGLLTTKEAASSTPFLIVLPVLT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegd----  343
            I FH++CKGR+EPAF +YPLQEA MKDTLERA +P  NLKAYLQ+AYVHPVFK       
Sbjct  664  IWFHIYCKGRFEPAFVRYPLQEAMMKDTLERATDPNFNLKAYLQNAYVHPVFKASLFDED  723

Query  342  ddeddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            +++++ MS KLE E + VPTKRQSRRNTP  S++SG SSP +
Sbjct  724  EEDEEVMSLKLETESVTVPTKRQSRRNTPLASRISGASSPSL  765



>ref|XP_004166876.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein 
C2G11.09-like [Cucumis sativus]
Length=773

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII+AL+FSQ+  +GLLSTK AA S PFL+ALPV+T
Sbjct  606  RHQIINVYNQEYESAAAFWPDVHGRIIYALIFSQVILMGLLSTKKAAQSTPFLLALPVIT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            ISFHL+CKGRYEPAF +YP+QEA MKDTLERAREP LNLK YL  AY HPV KE ++D++
Sbjct  666  ISFHLYCKGRYEPAFIRYPIQEAMMKDTLERAREPNLNLKGYLHAAYAHPVIKESEEDDE  725

Query  330  demseklemEGILVPTKRQSRRNTP  256
             E +E  E E +LV TKRQSRRNTP
Sbjct  726  VESNEAFETESVLVATKRQSRRNTP  750



>ref|XP_004145433.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
sativus]
 gb|KGN66856.1| hypothetical protein Csa_1G701320 [Cucumis sativus]
Length=773

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII+AL+FSQ+  +GLLSTK AA S PFL+ALPV+T
Sbjct  606  RHQIINVYNQEYESAAAFWPDVHGRIIYALIFSQVILMGLLSTKKAAQSTPFLLALPVIT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            ISFHL+CKGRYEPAF +YP+QEA MKDTLERAREP LNLK YL  AY HPV KE ++D++
Sbjct  666  ISFHLYCKGRYEPAFIRYPIQEAMMKDTLERAREPNLNLKGYLHAAYAHPVIKESEEDDE  725

Query  330  demseklemEGILVPTKRQSRRNTP  256
             E +E  E E +LV TKRQSRRNTP
Sbjct  726  VESNEAFETESVLVATKRQSRRNTP  750



>ref|XP_004151944.1| PREDICTED: uncharacterized protein RSN1-like [Cucumis sativus]
 gb|KGN63220.1| hypothetical protein Csa_2G416110 [Cucumis sativus]
Length=768

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII ALV SQ+  +GLLSTK AA S P LIALP+LT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF +YPLQEA MKDTLERAREP LNLK +LQ+AYVHPVFK  +DD +
Sbjct  662  IWFHRFCKGRYEPAFVRYPLQEAMMKDTLERAREPNLNLKGFLQNAYVHPVFKHDEDDVE  721

Query  330  demseklemEG-ILVPTKRQSRRNTPAPSKVSG  235
             E   +   +   LVPTKRQSRRNTP  SK SG
Sbjct  722  IEADSEDWQQEPALVPTKRQSRRNTPLQSKHSG  754



>ref|XP_004158583.1| PREDICTED: uncharacterized protein RSN1-like [Cucumis sativus]
Length=768

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII ALV SQ+  +GLLSTK AA S P LIALP+LT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF +YPLQEA MKDTLERAREP LNLK +LQ+AYVHPVFK  +DD +
Sbjct  662  IWFHRFCKGRYEPAFVRYPLQEAMMKDTLERAREPNLNLKGFLQNAYVHPVFKHDEDDVE  721

Query  330  demseklemEG-ILVPTKRQSRRNTPAPSKVSG  235
             E   +   +   LVPTKRQSRRNTP  SK SG
Sbjct  722  IEADSEDWQQEPALVPTKRQSRRNTPLQSKHSG  754



>ref|XP_007153987.1| hypothetical protein PHAVU_003G081500g [Phaseolus vulgaris]
 gb|ESW25981.1| hypothetical protein PHAVU_003G081500g [Phaseolus vulgaris]
Length=774

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 125/161 (78%), Gaps = 3/161 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VH RII AL+ SQI  +GLL+TK AA+S PFLI LP+LT
Sbjct  604  RHQIINVYNQEYESGAAFWPDVHFRIILALIVSQIVLMGLLTTKKAASSTPFLIVLPILT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegd---d  340
            I FH +CKGR+E AF KYPLQEA MKDTLERA EP LNLKAYLQ+AYVHPVFK      D
Sbjct  664  IWFHRYCKGRFESAFVKYPLQEAMMKDTLERATEPNLNLKAYLQNAYVHPVFKASLGEDD  723

Query  339  deddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            DED+E          +VPTKRQSR+NTP PS++SG SSP +
Sbjct  724  DEDEEAISLKWETESIVPTKRQSRKNTPLPSRISGASSPSL  764



>ref|XP_006387597.1| hypothetical protein POPTR_0796s00210g [Populus trichocarpa]
 gb|ERP46511.1| hypothetical protein POPTR_0796s00210g [Populus trichocarpa]
Length=696

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 130/158 (82%), Gaps = 1/158 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYN EYES AAFWP VHGRII  LV SQ++ +GLLSTK AA S PFLIALPVLT
Sbjct  531  RHQIINVYNHEYESGAAFWPDVHGRIITGLVISQLALMGLLSTKEAAQSTPFLIALPVLT  590

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FC GR++ AF KYPLQEA MKDTLERAR+P  NLKA L  AYVHP+F +GDDD++
Sbjct  591  IWFHRFCNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKACLHSAYVHPIF-KGDDDDE  649

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            D++S ++E E +LVPTKRQS+RNTP PSK+SGG SP +
Sbjct  650  DDLSVEMETESVLVPTKRQSQRNTPVPSKISGGYSPSL  687



>ref|XP_008455928.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X3 
[Cucumis melo]
Length=629

 Score =   210 bits (535),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII ALV SQ+  +GLLSTK AA S P LIALP+LT
Sbjct  463  RHQIINVYNQEYESAAAFWPDVHGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILT  522

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I F+ FCKGRYEPAF +YPLQEA MKDTLERAREP LNLK +LQ+AYVHPVFK  +DD +
Sbjct  523  IWFNRFCKGRYEPAFVQYPLQEAMMKDTLERAREPNLNLKGFLQNAYVHPVFKHDEDDVE  582

Query  330  demseklemEG-ILVPTKRQSRRNTPAPSKVSG  235
             E   +   +   LVPTKRQSRRNTP  SK SG
Sbjct  583  IETDSEDRQQEPALVPTKRQSRRNTPLQSKHSG  615



>ref|XP_008455926.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X2 
[Cucumis melo]
 ref|XP_008455927.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X2 
[Cucumis melo]
Length=649

 Score =   211 bits (536),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII ALV SQ+  +GLLSTK AA S P LIALP+LT
Sbjct  483  RHQIINVYNQEYESAAAFWPDVHGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILT  542

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I F+ FCKGRYEPAF +YPLQEA MKDTLERAREP LNLK +LQ+AYVHPVFK  +DD +
Sbjct  543  IWFNRFCKGRYEPAFVQYPLQEAMMKDTLERAREPNLNLKGFLQNAYVHPVFKHDEDDVE  602

Query  330  demseklemEG-ILVPTKRQSRRNTPAPSKVSG  235
             E   +   +   LVPTKRQSRRNTP  SK SG
Sbjct  603  IETDSEDRQQEPALVPTKRQSRRNTPLQSKHSG  635



>ref|XP_006467388.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Citrus 
sinensis]
 gb|KDO78338.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
Length=772

 Score =   212 bits (539),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 133/166 (80%), Gaps = 3/166 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ YESAAAFWP VH RII AL+ SQ+  +GLLSTK AA S PFLIALPVLT
Sbjct  606  RHQIINVYNQRYESAAAFWPDVHRRIIAALIISQLLLMGLLSTKKAALSTPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH F K RYE AF KYPLQEA MKDTLERAREP LNLK YL++AY+HPVF +G+DD+D
Sbjct  666  IWFHYFSKDRYESAFVKYPLQEAMMKDTLERAREPNLNLKGYLRNAYIHPVF-KGEDDDD  724

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV--ILEKEP  199
            D +    E E +LV TKRQSRRNTP PSK+SG SSP +  +++++P
Sbjct  725  DALFNNEENENVLVLTKRQSRRNTPVPSKMSGASSPSLPEVVQEDP  770



>gb|EPS60017.1| hypothetical protein M569_14787, partial [Genlisea aurea]
Length=762

 Score =   212 bits (539),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 127/157 (81%), Gaps = 6/157 (4%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAA FWP VHGRII A++FSQ+  +GL+STK AA S PFL+ LPV+T
Sbjct  606  RHQIINVYNQEYESAAEFWPDVHGRIISAMIFSQLVLMGLMSTKGAAASTPFLLVLPVIT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF KYPLQEA M+DTLERAREP  NLK+++++AYVHPVFK  +DD++
Sbjct  666  IFFHRFCKGRYEPAFLKYPLQEAMMRDTLERAREPNFNLKSFMRNAYVHPVFKNDEDDDE  725

Query  330  demsekl------emEGILVPTKRQSRRNTPAPSKVS  238
            +E           +  G++VPTKRQSRR+TPAPSK+S
Sbjct  726  EEDEVGSNRKNGDDDGGVIVPTKRQSRRSTPAPSKIS  762



>ref|XP_011016279.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011016280.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011016281.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=768

 Score =   211 bits (538),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII A++ SQ+  +GLLSTK AA S P LI LPVLT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FHLFCKGRYEPAF +YPLQEA MKDTLERAREP LNLK++LQ+AY HPVFK  DD + 
Sbjct  662  IWFHLFCKGRYEPAFVRYPLQEAMMKDTLERAREPNLNLKSFLQNAYSHPVFKGEDDSDS  721

Query  330  demseklemEGILVPTKRQSRRNTPAP  250
            D   E+ E E  LVPTKRQSRRNTP P
Sbjct  722  DGAPEEFEKEPDLVPTKRQSRRNTPLP  748



>ref|XP_011047222.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047223.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047224.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047225.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=768

 Score =   211 bits (538),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII A++ SQ+  +GLLSTK AA S P LI LP+LT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPILT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FHLFCKGRYEPAF +YPLQEA MKDTLERAREP LNLK++LQ+AY HPVFK  DD + 
Sbjct  662  IWFHLFCKGRYEPAFVRYPLQEAMMKDTLERAREPNLNLKSFLQNAYSHPVFKGEDDSDS  721

Query  330  demseklemEGILVPTKRQSRRNTPAP  250
            DE  E+ E E  LVPTKRQSRRNTP P
Sbjct  722  DEAPEEFEKEPDLVPTKRQSRRNTPLP  748



>ref|XP_010252492.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Nelumbo 
nucifera]
Length=770

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQ+  +GLLSTK AA S P LIALPVLT
Sbjct  606  RHQIINVYNQEYESAAAFWPDVHGRIITALIISQLLLMGLLSTKRAAQSTPLLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCK RYEPAF +YPLQEA MKDTLERAREP LNLK YLQ+AYVHPVF +G+D++ 
Sbjct  666  IWFHRFCKSRYEPAFIRYPLQEAMMKDTLERAREPNLNLKGYLQNAYVHPVF-KGEDEDS  724

Query  330  demseklemEGILVPTKRQSRRNTPAP  250
            D  +E+L+ E +LVPTKRQSRRNTP P
Sbjct  725  DAFTEELQKESVLVPTKRQSRRNTPLP  751



>ref|XP_006447608.1| hypothetical protein CICLE_v10014696mg [Citrus clementina]
 gb|ESR60848.1| hypothetical protein CICLE_v10014696mg [Citrus clementina]
Length=590

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = -3

Query  687  HQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTI  508
            HQ+INVYNQEYESAAAFWP VHGRII AL+ SQ+  +GLLSTK AA S P LI LP+LTI
Sbjct  434  HQVINVYNQEYESAAAFWPDVHGRIITALIVSQLLLMGLLSTKEAAQSTPLLITLPILTI  493

Query  507  SFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddedd  328
             FH FCKGRYEPAF +YPLQEA MKDTLERAREP LNLK++LQ AY+HPVFKE  + E D
Sbjct  494  WFHRFCKGRYEPAFVRYPLQEAMMKDTLERAREPNLNLKSFLQIAYIHPVFKEVQESESD  553

Query  327  emseklemEGILVPTKRQSRRNTPAPSKVSGGSS  226
              SE+ + E +L+PTKRQSR NT  PSK SG  +
Sbjct  554  PASEESDQEPVLIPTKRQSRMNTLLPSKHSGSMT  587



>gb|KHG30770.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=770

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 127/155 (82%), Gaps = 1/155 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ S ++ +GLLSTKH A +AP LI L VLT
Sbjct  604  RHQIINVYNQEYESAAAFWPDVHGRIIIALLVSHVALIGLLSTKHLAQAAPLLITLAVLT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I F+ FCK RYEPAF +YPLQEA MKDTLERAR+   NLK YLQ+AY+HPVF + +D+E+
Sbjct  664  IWFYRFCKARYEPAFVRYPLQEAVMKDTLERARDSNFNLKPYLQNAYIHPVF-KEEDEEE  722

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSS  226
            +E   KLE E +LVPTKRQSRRNTP PSK+SG SS
Sbjct  723  EEEVVKLENESVLVPTKRQSRRNTPVPSKMSGASS  757



>ref|XP_008455922.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
 ref|XP_008455924.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
 ref|XP_008455925.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
Length=768

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII ALV SQ+  +GLLSTK AA S P LIALP+LT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I F+ FCKGRYEPAF +YPLQEA MKDTLERAREP LNLK +LQ+AYVHPVFK  +DD +
Sbjct  662  IWFNRFCKGRYEPAFVQYPLQEAMMKDTLERAREPNLNLKGFLQNAYVHPVFKHDEDDVE  721

Query  330  demseklemEG-ILVPTKRQSRRNTPAPSKVSG  235
             E   +   +   LVPTKRQSRRNTP  SK SG
Sbjct  722  IETDSEDRQQEPALVPTKRQSRRNTPLQSKHSG  754



>gb|KDO39720.1| hypothetical protein CISIN_1g048588mg [Citrus sinensis]
Length=615

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = -3

Query  687  HQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTI  508
            HQ+INVYNQEYESAAAFWP VHGRII AL+ SQ+  +GLLSTK AA S P LI LP+LTI
Sbjct  427  HQVINVYNQEYESAAAFWPDVHGRIITALIVSQLLLMGLLSTKEAAQSTPLLITLPILTI  486

Query  507  SFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddedd  328
             FH FCKGRYEPAF +YPLQEA MKDTLERAREP LNLK++LQ AY+HPVFKE  + E D
Sbjct  487  WFHRFCKGRYEPAFVRYPLQEAMMKDTLERAREPNLNLKSFLQIAYIHPVFKEVQESESD  546

Query  327  emseklemEGILVPTKRQSRRNTPAPSKVSGGSS  226
              SE+ + E +L+PTKRQSR NT  PSK SG  +
Sbjct  547  PASEESDQEPVLIPTKRQSRMNTLLPSKHSGSMT  580



>ref|XP_004491137.1| PREDICTED: uncharacterized protein RSN1-like [Cicer arietinum]
Length=766

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESA AFWP VHGRI+FALV SQ+  +GLLSTK AA S P LI LP+LT
Sbjct  602  RHQIINVYNQEYESAGAFWPDVHGRIVFALVISQLLLMGLLSTKKAANSTPLLITLPILT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKG YEPAF  +PLQEA +KDTLER +EP  NLK +LQ+AY+HPVF   +D + 
Sbjct  662  IWFHRFCKGSYEPAFITHPLQEAMVKDTLERTKEPNFNLKEFLQNAYIHPVFNGDEDTDS  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSP  223
            D MS++ E E + V TKRQSRRNTP PSK SGGS P
Sbjct  722  DVMSKEWEQEPVTVQTKRQSRRNTPMPSKHSGGSLP  757



>gb|KJB57786.1| hypothetical protein B456_009G181100 [Gossypium raimondii]
 gb|KJB57787.1| hypothetical protein B456_009G181100 [Gossypium raimondii]
Length=770

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 127/155 (82%), Gaps = 1/155 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ S ++ +GLLSTKH A +AP LI L V+T
Sbjct  604  RHQIINVYNQEYESAAAFWPDVHGRIIIALLVSHVALIGLLSTKHLAQAAPLLITLAVVT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I F+ FCK RYEPAF +YPLQEA MKDTLERAR+   NLK YLQ+AY+HPVF + ++D++
Sbjct  664  IWFYRFCKARYEPAFVRYPLQEAVMKDTLERARDSNFNLKPYLQNAYIHPVF-KEEEDDE  722

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSS  226
            +E   KLE E +LVPTKRQSRRNTP PSK+SG SS
Sbjct  723  EEEVVKLENESVLVPTKRQSRRNTPVPSKMSGASS  757



>ref|XP_009418442.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
Length=768

 Score =   209 bits (532),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 128/156 (82%), Gaps = 1/156 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII ALV SQ+  LGLLSTK AA S PFLIALP+LT
Sbjct  603  RHQIINVYNQEYESAAAFWPDVHGRIISALVISQLLLLGLLSTKKAADSTPFLIALPILT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCK RYE AF KYP+QEA MKDTLERAREP L+LKAYL +AYVHPVFK+G+D++ 
Sbjct  663  IWFHRFCKNRYESAFVKYPIQEAMMKDTLERAREPNLDLKAYLSNAYVHPVFKDGEDEDS  722

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSP  223
                E+ E+E +LVPTKR SRRNTP PSK  G SSP
Sbjct  723  VATDEEKEVENVLVPTKRASRRNTPVPSKF-GCSSP  757



>ref|XP_011463550.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=718

 Score =   208 bits (529),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 121/153 (79%), Gaps = 0/153 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII ALV SQ+  +GLLSTK AA S P LI LPVLT
Sbjct  552  RHQIINVYNQEYESAAAFWPDVHGRIITALVVSQLLLMGLLSTKEAAQSTPLLITLPVLT  611

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            ISFH FCKGRYEPAF K PLQEA  KDTLE  REP LNLK +LQ AYVHPVFK  DD + 
Sbjct  612  ISFHRFCKGRYEPAFKKNPLQEAMRKDTLEHVREPNLNLKGFLQSAYVHPVFKGADDSDS  671

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGG  232
            D  +E+LE+E  +V TKRQSRRNTP PSK SG 
Sbjct  672  DGAAEELEVEPAVVRTKRQSRRNTPVPSKYSGS  704



>ref|XP_004289181.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=767

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 121/153 (79%), Gaps = 0/153 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII ALV SQ+  +GLLSTK AA S P LI LPVLT
Sbjct  601  RHQIINVYNQEYESAAAFWPDVHGRIITALVVSQLLLMGLLSTKEAAQSTPLLITLPVLT  660

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            ISFH FCKGRYEPAF K PLQEA  KDTLE  REP LNLK +LQ AYVHPVFK  DD + 
Sbjct  661  ISFHRFCKGRYEPAFKKNPLQEAMRKDTLEHVREPNLNLKGFLQSAYVHPVFKGADDSDS  720

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGG  232
            D  +E+LE+E  +V TKRQSRRNTP PSK SG 
Sbjct  721  DGAAEELEVEPAVVRTKRQSRRNTPVPSKYSGS  753



>ref|XP_007217157.1| hypothetical protein PRUPE_ppa001757mg [Prunus persica]
 gb|EMJ18356.1| hypothetical protein PRUPE_ppa001757mg [Prunus persica]
Length=769

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQ+  +GLLSTK AA S P LI LPVLT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIITALIVSQLLLMGLLSTKEAAQSTPLLITLPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKG YEPAF +YPLQEA MKDTLERAREP LNLK +LQ+AY+HPVFK  DD E+
Sbjct  662  IWFHRFCKGCYEPAFIRYPLQEAMMKDTLERAREPNLNLKGFLQNAYIHPVFKGEDDSEN  721

Query  330  demseklemEGILVPTKRQSRRNTPAP  250
            +  +E+ E E  +VPTKRQSRRNTP P
Sbjct  722  EAAAEECEKEPAVVPTKRQSRRNTPLP  748



>ref|XP_004295293.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=772

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 127/160 (79%), Gaps = 5/160 (3%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGR++ AL+ SQ+  +GLLSTK A  S PFL+ LP++T
Sbjct  607  RHQIINVYNQEYESAAAFWPDVHGRVVSALILSQLVLMGLLSTKGAKISTPFLLPLPIMT  666

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            ++F+ +C GRYEPAF +YPLQEAKMKDTLE AREP LNLK YLQ AYVHPVFKE  +D+D
Sbjct  667  VAFYKYCAGRYEPAFVRYPLQEAKMKDTLEHAREPNLNLKGYLQSAYVHPVFKECAEDDD  726

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSS---PD  220
            +E     E   ++V TKRQSRRNTP  SK++GGS+   PD
Sbjct  727  EEEKALYET--VIVATKRQSRRNTPVQSKMTGGSTSPLPD  764



>ref|XP_007049121.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
 gb|EOX93278.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
Length=768

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 117/153 (76%), Gaps = 0/153 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VH RII AL+ SQ+  +GLLSTK AA S P LI LPVLT
Sbjct  602  RHQIINVYNQEYESGAAFWPDVHARIIVALIVSQLLLMGLLSTKEAAQSTPLLITLPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF +YPLQEA MKDTLERAREP LNLK +LQ AY HPVFK  DD E 
Sbjct  662  IWFHRFCKGRYEPAFVRYPLQEAMMKDTLERAREPNLNLKGFLQSAYTHPVFKSADDSES  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGG  232
            D   E+ E E  L+PTKR SRR TP PSK SG 
Sbjct  722  DITMEESEQEPALIPTKRTSRRCTPLPSKHSGS  754



>ref|XP_004293317.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=776

 Score =   206 bits (523),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 129/161 (80%), Gaps = 3/161 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRI+ AL+ SQ+  LGLL+TK AA S PFL+ALPVLT
Sbjct  607  RHQIINVYNQEYESAAAFWPDVHGRILSALLISQLVLLGLLTTKKAAQSTPFLLALPVLT  666

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
             +F+ +C+GR+EPAF +YPLQEAKMKDTLE AREP LNLK YLQ AYVHPVFKE DDD+D
Sbjct  667  FAFYKYCQGRFEPAFVRYPLQEAKMKDTLESAREPNLNLKGYLQSAYVHPVFKECDDDDD  726

Query  330  demseklemEG---ILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            ++     + E    + V TKRQSRRNTP PS+++  S+P +
Sbjct  727  EDHYSFEKYENESCVTVATKRQSRRNTPVPSRMTDQSTPSL  767



>ref|XP_010089460.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB37853.1| Uncharacterized membrane protein [Morus notabilis]
Length=779

 Score =   206 bits (523),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 123/169 (73%), Gaps = 13/169 (8%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VH RII ALV SQ+  +GLLSTK A  S P LI LPVLT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHRRIITALVVSQLLLMGLLSTKEATQSTPLLITLPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPL-------------QEAKMKDTLERAREPTLNLKAYLQDAY  370
            I FH FCKGRYEPAF  YPL             QEA MKDTLERAREP LNLK +LQ+AY
Sbjct  662  IWFHFFCKGRYEPAFVTYPLQLFLLFVSSSAGSQEAMMKDTLERAREPNLNLKGFLQNAY  721

Query  369  VHPVFkegdddeddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSP  223
            VHPVFK  DD + D  +E L+ E  +VPTKRQSRRNTP PSK SG  +P
Sbjct  722  VHPVFKGEDDSDSDAATEDLKEEPAIVPTKRQSRRNTPLPSKQSGPLNP  770



>ref|XP_008229991.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Prunus 
mume]
Length=769

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQ+  +GLLSTK AA S P LI LPVLT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIITALIISQLLLMGLLSTKEAAQSTPLLITLPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKG YEPAF +YPLQEA MKDTLERA EP LNLK++LQ+AY+HPVFK  DD E+
Sbjct  662  IWFHRFCKGCYEPAFIRYPLQEAMMKDTLERATEPNLNLKSFLQNAYIHPVFKGEDDGEN  721

Query  330  demseklemEGILVPTKRQSRRNTPAP  250
            +  +E+ E E  +VPTKRQSRRNTP P
Sbjct  722  ETAAEECEKEPAVVPTKRQSRRNTPLP  748



>ref|XP_006417282.1| hypothetical protein EUTSA_v10006870mg [Eutrema salsugineum]
 gb|ESQ35635.1| hypothetical protein EUTSA_v10006870mg [Eutrema salsugineum]
Length=770

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 121/161 (75%), Gaps = 5/161 (3%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRI  AL+ SQI  +GL+STK AA S PFLIALPVLT
Sbjct  605  RHQIINVYNQEYESAAAFWPDVHGRITSALIISQILLMGLMSTKGAAQSTPFLIALPVLT  664

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH FCKGRYEPAF ++PLQEA +KDTLERAREP+ NLK YLQ AY+HPVFK+ D ++ 
Sbjct  665  FFFHRFCKGRYEPAFLRHPLQEAMIKDTLERAREPSFNLKPYLQKAYIHPVFKDDDYEDS  724

Query  330  demse-----klemEGILVPTKRQSRRNTPAPSKVSGGSSP  223
                        + E + VPTKRQSR+ TPA S  S GSSP
Sbjct  725  RSEISGYCFEDSDEECVTVPTKRQSRKTTPAVSHASRGSSP  765



>ref|XP_010924083.1| PREDICTED: protein OSCA1-like isoform X6 [Elaeis guineensis]
Length=684

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VHGRII AL+ SQ+  LGLLSTK AA S PFLIALP+LT
Sbjct  520  RHQIINVYNQEYESGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILT  579

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCK RYEPAF KYPLQEA MKDTLERA+EP L+LKAYL +AYVHPVFK+GD+D+ 
Sbjct  580  IWFHRFCKSRYEPAFVKYPLQEAMMKDTLERAKEPNLDLKAYLVNAYVHPVFKDGDEDDS  639

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
              + E++  + +LVPTKRQSRRNTPA S+ +G SSP +
Sbjct  640  FSVDEEVVYDNVLVPTKRQSRRNTPAHSRYNGSSSPSL  677



>ref|XP_004507664.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Cicer 
arietinum]
Length=773

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQ+INVYNQ+YESAAAFWP VH R++ AL+ SQ+  +GLL+TK AA+S PFLI LP+LT
Sbjct  604  RHQMINVYNQQYESAAAFWPDVHVRVVIALIVSQLVLMGLLTTKKAASSTPFLIVLPILT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH +CKGR+E AF KYPLQEA MKDTLE+A +P LN+K YLQ AYVHPVFK   DD D
Sbjct  664  IWFHRYCKGRFESAFVKYPLQEAMMKDTLEKATDPNLNIKGYLQHAYVHPVFKASQDDVD  723

Query  330  demsekle--mEGILVPTKRQSRRNTPAPSKVSGGSSPDVI  214
            +E +  L+   E   VPTKR SRRNTP PS++SG SSP ++
Sbjct  724  EEDAISLKWETESATVPTKRHSRRNTPLPSRISGASSPSML  764



>ref|XP_010924080.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X3 [Elaeis guineensis]
Length=732

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VHGRII AL+ SQ+  LGLLSTK AA S PFLIALP+LT
Sbjct  568  RHQIINVYNQEYESGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILT  627

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCK RYEPAF KYPLQEA MKDTLERA+EP L+LKAYL +AYVHPVFK+GD+D+ 
Sbjct  628  IWFHRFCKSRYEPAFVKYPLQEAMMKDTLERAKEPNLDLKAYLVNAYVHPVFKDGDEDDS  687

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
              + E++  + +LVPTKRQSRRNTPA S+ +G SSP +
Sbjct  688  FSVDEEVVYDNVLVPTKRQSRRNTPAHSRYNGSSSPSL  725



>ref|XP_010924079.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Elaeis guineensis]
Length=745

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VHGRII AL+ SQ+  LGLLSTK AA S PFLIALP+LT
Sbjct  581  RHQIINVYNQEYESGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILT  640

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCK RYEPAF KYPLQEA MKDTLERA+EP L+LKAYL +AYVHPVFK+GD+D+ 
Sbjct  641  IWFHRFCKSRYEPAFVKYPLQEAMMKDTLERAKEPNLDLKAYLVNAYVHPVFKDGDEDDS  700

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
              + E++  + +LVPTKRQSRRNTPA S+ +G SSP +
Sbjct  701  FSVDEEVVYDNVLVPTKRQSRRNTPAHSRYNGSSSPSL  738



>ref|XP_003555683.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoformX1 
[Glycine max]
 ref|XP_006605689.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Glycine max]
Length=774

 Score =   203 bits (517),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 127/161 (79%), Gaps = 3/161 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VH RI+ AL+ SQI  +GLL+TK AA+S PFLI LP+LT
Sbjct  604  RHQIINVYNQEYESGAAFWPDVHFRIVMALIVSQIVLMGLLTTKKAASSTPFLIVLPILT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH +CKGR+E AF K+PLQEA MKDTLERA EP LNLK YLQ+AYVHPVFK+  DD+D
Sbjct  664  IWFHRYCKGRFESAFVKFPLQEAMMKDTLERATEPNLNLKGYLQNAYVHPVFKDSMDDDD  723

Query  330  de---mseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            DE   +S  LE E + V TKRQSRRNTP PSK +  SSP +
Sbjct  724  DEEDRLSIDLETESVTVRTKRQSRRNTPLPSKNNDASSPSL  764



>ref|XP_010924075.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010924076.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010924077.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
Length=766

 Score =   203 bits (517),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VHGRII AL+ SQ+  LGLLSTK AA S PFLIALP+LT
Sbjct  602  RHQIINVYNQEYESGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCK RYEPAF KYPLQEA MKDTLERA+EP L+LKAYL +AYVHPVFK+GD+D+ 
Sbjct  662  IWFHRFCKSRYEPAFVKYPLQEAMMKDTLERAKEPNLDLKAYLVNAYVHPVFKDGDEDDS  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
              + E++  + +LVPTKRQSRRNTPA S+ +G SSP +
Sbjct  722  FSVDEEVVYDNVLVPTKRQSRRNTPAHSRYNGSSSPSL  759



>gb|KHN28986.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=774

 Score =   203 bits (517),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 127/161 (79%), Gaps = 3/161 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VH RI+ AL+ SQI  +GLL+TK AA+S PFLI LP+LT
Sbjct  604  RHQIINVYNQEYESGAAFWPDVHFRIVMALIVSQIVLMGLLTTKKAASSTPFLIVLPILT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH +CKGR+E AF K+PLQEA MKDTLERA EP LNLK YLQ+AYVHPVFK+  DD+D
Sbjct  664  IWFHRYCKGRFESAFVKFPLQEAMMKDTLERATEPNLNLKGYLQNAYVHPVFKDSMDDDD  723

Query  330  de---mseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            DE   +S  LE E + V TKRQSRRNTP PSK +  SSP +
Sbjct  724  DEEDRLSIDLETESVTVRTKRQSRRNTPLPSKNNDASSPSL  764



>ref|XP_008363487.1| PREDICTED: uncharacterized protein RSN1-like [Malus domestica]
Length=567

 Score =   201 bits (510),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQ+  +GLLSTK AA S P LI LPVLT
Sbjct  399  RHQIINVYNQEYESAAAFWPDVHGRIITALIVSQLLLMGLLSTKEAAQSTPLLITLPVLT  458

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF ++PLQEA MKDTLER REP LN+K +LQ+AY+HPVFK  DD E+
Sbjct  459  IWFHXFCKGRYEPAFIRHPLQEAMMKDTLERTREPNLNMKGFLQNAYIHPVFKGEDDSEN  518

Query  330  demseklemEGILVPTKRQSRRNTPAP  250
               +++ E E  +V TKR SRRNTP P
Sbjct  519  XAPAQEFEKEPXVVLTKRSSRRNTPMP  545



>ref|XP_010924081.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X4 [Elaeis guineensis]
Length=726

 Score =   203 bits (516),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VHGRII AL+ SQ+  LGLLSTK AA S PFLIALP+LT
Sbjct  562  RHQIINVYNQEYESGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILT  621

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCK RYEPAF KYPLQEA MKDTLERA+EP L+LKAYL +AYVHPVFK+GD+D+ 
Sbjct  622  IWFHRFCKSRYEPAFVKYPLQEAMMKDTLERAKEPNLDLKAYLVNAYVHPVFKDGDEDDS  681

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
              + E++  + +LVPTKRQSRRNTPA S+ +G SSP +
Sbjct  682  FSVDEEVVYDNVLVPTKRQSRRNTPAHSRYNGSSSPSL  719



>ref|XP_007141612.1| hypothetical protein PHAVU_008G210700g [Phaseolus vulgaris]
 gb|ESW13606.1| hypothetical protein PHAVU_008G210700g [Phaseolus vulgaris]
Length=755

 Score =   203 bits (516),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRIIFALV SQ+  +GLLSTK AA S P LI LPVLT
Sbjct  604  RHQIINVYNQEYESAAAFWPDVHGRIIFALVISQLLLMGLLSTKEAANSTPLLITLPVLT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            ISFHL+CKGRY+PAF K+PLQEA MKDTLERAREP  NLK +LQ AY+HPVFK  DD + 
Sbjct  664  ISFHLYCKGRYQPAFIKHPLQEAMMKDTLERAREPNFNLKEFLQSAYIHPVFKGDDDSDS  723

Query  330  demseklemEG-ILVPTKRQSRRNT  259
            + MSEK E +  ++V TKRQSRRNT
Sbjct  724  EVMSEKWEEQEPVVVQTKRQSRRNT  748



>ref|XP_010546606.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546613.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546622.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546631.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
Length=776

 Score =   203 bits (517),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 121/150 (81%), Gaps = 1/150 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AA+WP VHGRII AL+ SQI  +GL+STK AA S PFLIALP+LT
Sbjct  605  RHQIINVYNQEYESGAAYWPDVHGRIITALIISQILLMGLMSTKKAAQSTPFLIALPILT  664

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkeg-ddde  334
            + FH FCKGRYEPAF +YPLQEA +KDTLERAREP L+LK YLQ AY+HPVFK+  +D  
Sbjct  665  LGFHRFCKGRYEPAFIRYPLQEAMIKDTLERAREPNLDLKPYLQKAYIHPVFKDEGEDRF  724

Query  333  ddemseklemEGILVPTKRQSRRNTPAPSK  244
            DD + +  + + ++VPTKRQSRR TPA S 
Sbjct  725  DDMLEKSEDDKCLIVPTKRQSRRTTPAVSN  754



>gb|EPS71959.1| hypothetical protein M569_02795, partial [Genlisea aurea]
Length=761

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 119/155 (77%), Gaps = 3/155 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSA-PFLIALPVL  514
            RHQIINVYNQ YESAAAFWP VHGRIIF+LVFSQI  LGLLS+K AA  A PFLIALP+L
Sbjct  606  RHQIINVYNQVYESAAAFWPGVHGRIIFSLVFSQIVLLGLLSSKGAAQEATPFLIALPIL  665

Query  513  TISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddd-  337
            TI FH+ CKGRYEPAF +YPLQEA +KDTLE+ RE  LNLK YL+DAYVHPVFK  D + 
Sbjct  666  TIWFHIVCKGRYEPAFIRYPLQEAMIKDTLEKTRERNLNLKKYLRDAYVHPVFKNDDAND  725

Query  336  -eddemseklemEGILVPTKRQSRRNTPAPSKVSG  235
                +  +    +  LVPTKRQSRR+TP PS  S 
Sbjct  726  DHGYDYDDDSTKDNNLVPTKRQSRRSTPVPSIASN  760



>ref|XP_006363038.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363039.1| PREDICTED: uncharacterized protein RSN1-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006363040.1| PREDICTED: uncharacterized protein RSN1-like isoform X3 [Solanum 
tuberosum]
Length=768

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 120/156 (77%), Gaps = 0/156 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQ+  +GLLSTK A+ S P LI LP+LT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIITALIVSQLLLMGLLSTKEASKSTPLLITLPILT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH+FCKGRYEPAF +YPLQE   KDTL+R +EP  +LK +LQ+AY+HPVFK   D E 
Sbjct  662  IWFHIFCKGRYEPAFVRYPLQETVRKDTLDRTKEPNFDLKEFLQNAYIHPVFKGEVDSEI  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSP  223
            D  SE  E+E  LV TKRQSR NTP PSK SG S P
Sbjct  722  DAASEDGELEPSLVQTKRQSRFNTPLPSKRSGSSPP  757



>gb|EMS56194.1| Uncharacterized membrane protein C2G11.09 [Triticum urartu]
Length=612

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 121/158 (77%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP+VHGRII AL+ SQ+  LGLLSTK A  S P L+ LPV+T
Sbjct  446  RHQIINVYNQEYESAAAFWPSVHGRIITALIVSQLLFLGLLSTKGAGQSTPVLLVLPVVT  505

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH +CK RYEPAF +YPLQEA  KDTLERAREP  +LK YL  AY+HPVFK  DDDE 
Sbjct  506  FYFHKYCKNRYEPAFVEYPLQEAMRKDTLERAREPGFDLKTYLASAYIHPVFKGDDDDEK  565

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
              M ++ E + +LV TKRQSRRNTP PS+ +G  +P +
Sbjct  566  FSMMDEAEADQVLVATKRQSRRNTPVPSRHNGSEAPSL  603



>gb|EYU33878.1| hypothetical protein MIMGU_mgv1a018274mg [Erythranthe guttata]
Length=770

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 123/156 (79%), Gaps = 5/156 (3%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII ALVFSQ+  +GL+STK  A S P LIALPVLT
Sbjct  607  RHQIINVYNQEYESAAAFWPGVHGRIISALVFSQLVLMGLMSTKGNAQSTPILIALPVLT  666

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF +YPLQEA MKDTLER+REP LN+K+YL+ AY+HPVFK  D+D++
Sbjct  667  IWFHRFCKGRYEPAFIRYPLQEAMMKDTLERSREPNLNVKSYLEYAYIHPVFKNEDEDDE  726

Query  330  demse-----klemEGILVPTKRQSRRNTPAPSKVS  238
            DE        KL    +LVPTKR SRR+T  PSK S
Sbjct  727  DEYEGECNNGKLLDGSVLVPTKRHSRRHTHDPSKFS  762



>ref|XP_003610472.1| Membrane protein, putative [Medicago truncatula]
 ref|XP_003619262.1| Membrane protein, putative [Medicago truncatula]
 gb|AES92669.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=774

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 125/162 (77%), Gaps = 3/162 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VH R+I AL+ SQI  +GLL+TK AA+S PFLI LP+LT
Sbjct  604  RHQIINVYNQEYESGAAFWPDVHFRVIIALLVSQIVLMGLLTTKKAASSTPFLIVLPILT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkeg---dd  340
            I FH +CKGR+E AF K+PLQEA MKDTLERA EP LN+K YLQ AYVHPVFK     D 
Sbjct  664  IWFHRYCKGRFESAFVKFPLQEAMMKDTLERATEPNLNVKGYLQHAYVHPVFKASHDDDA  723

Query  339  deddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDVI  214
            DE+D MS K E E   V TKRQSRR+TP PS+ SG SSP ++
Sbjct  724  DEEDAMSLKWETESATVATKRQSRRSTPLPSRFSGASSPSML  765



>ref|XP_003569164.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brachypodium 
distachyon]
 ref|XP_010231890.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brachypodium 
distachyon]
Length=768

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP+VHGRII AL+ SQ+  LGLLSTK A  S P L+ LPV+T
Sbjct  602  RHQIINVYNQEYESAAAFWPSVHGRIITALIISQLLFLGLLSTKGAGQSTPVLLVLPVVT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH +CK RYEPAF +YPLQEA  KDTLERAREP  +LK YL  AY+HPVFK  DDDE 
Sbjct  662  FYFHKYCKNRYEPAFVEYPLQEAMRKDTLERAREPGFDLKTYLASAYIHPVFKGDDDDEK  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
              M++++E + +LV TKRQSRRNTP PS+ +G  SP +
Sbjct  722  FSMADEVEADQVLVATKRQSRRNTPVPSRHNGSESPSL  759



>ref|XP_010548889.1| PREDICTED: CSC1-like protein At3g21620 [Tarenaya hassleriana]
Length=764

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 120/157 (76%), Gaps = 2/157 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQ+INVYNQEYESA AFWP VHGRII ALV SQ+  +GLLSTK AA S P LI LPVLT
Sbjct  605  RHQVINVYNQEYESAGAFWPDVHGRIIAALVVSQLLLMGLLSTKQAAQSTPLLITLPVLT  664

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH+FC+GRYEPAF KYPLQEA +KDTLE+ REP LNLKA+L +AY HPVFK  +++ +
Sbjct  665  IWFHVFCRGRYEPAFVKYPLQEAMIKDTLEKTREPNLNLKAFLGNAYAHPVFKAAENERE  724

Query  330  demseklemEGI--LVPTKRQSRRNTPAPSKVSGGSS  226
            +   E+   E    LVPTKR SR NTP PSK SG  S
Sbjct  725  ETGLEETRPERTPELVPTKRGSRMNTPLPSKHSGSVS  761



>ref|XP_008799225.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Phoenix dactylifera]
Length=762

 Score =   201 bits (511),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWPAVHGRII AL+ SQ+  LGLLSTK AA S P LIALP+LT
Sbjct  602  RHQIINVYNQEYESGAAFWPAVHGRIICALIISQLLLLGLLSTKQAAQSTPLLIALPILT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            ISFH FCK RYEPAF KYPLQEA MKDTLE AREP L+LK+YL +AY+HPVFK+ +DD++
Sbjct  662  ISFHRFCKNRYEPAFVKYPLQEAMMKDTLEHAREPNLDLKSYLLNAYIHPVFKDEEDDDN  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSP  223
              M E+ E +  LVPTKRQSR+NTPA SK  G SSP
Sbjct  722  FSMGEEREYDNTLVPTKRQSRKNTPAQSKYGGSSSP  757



>ref|XP_003542161.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Glycine 
max]
 gb|KHN42234.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=774

 Score =   201 bits (511),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 125/161 (78%), Gaps = 3/161 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VH RI+ AL+ SQI  +GLL+TK AA+S PFL+ LP+LT
Sbjct  604  RHQIINVYNQEYESGAAFWPDVHFRIVMALLVSQIVLMGLLTTKKAASSTPFLVVLPILT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegd---d  340
            I FH +CKGR+E AF K+PLQEA MKDTLER  EP LNLK YLQ+AYVHPVFK+     D
Sbjct  664  IWFHRYCKGRFESAFVKFPLQEAMMKDTLERTTEPNLNLKGYLQNAYVHPVFKDSMDDDD  723

Query  339  deddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            DE+D +S  LE E + V TKRQSRRNTP PSK +  SSP +
Sbjct  724  DEEDILSMDLETESVTVRTKRQSRRNTPLPSKNNDASSPSL  764



>ref|XP_008803557.1| PREDICTED: LOW QUALITY PROTEIN: calcium permeable stress-gated 
cation channel 1-like [Phoenix dactylifera]
Length=767

 Score =   201 bits (510),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VHGRII AL+ SQ+  LGLLSTK AA S PFLIALP+LT
Sbjct  602  RHQIINVYNQEYESGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCK RYEPAF KYPLQEA MKDTLERA+EP L+LKAYL +AY+HPVFK+G++D+ 
Sbjct  662  IWFHRFCKSRYEPAFVKYPLQEAMMKDTLERAKEPNLDLKAYLINAYIHPVFKDGEEDDS  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
              + ++ E + +LVPTKRQSRR+TPA SK +G SSP +
Sbjct  722  FAVGDEREYDNVLVPTKRQSRRSTPAHSKYNGSSSPSL  759



>ref|XP_004243535.1| PREDICTED: CSC1-like protein At3g21620 [Solanum lycopersicum]
 ref|XP_010323863.1| PREDICTED: CSC1-like protein At3g21620 [Solanum lycopersicum]
Length=767

 Score =   200 bits (509),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 120/156 (77%), Gaps = 2/156 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQ+  +GLLSTK A+ S P LI LP+LT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHGRIITALIVSQLLLMGLLSTKEASKSTPLLITLPILT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH+FCKGR+EPAF +YPLQE   KDTLER +EP  NLK +LQ+AY+HPVFK   D E 
Sbjct  662  IWFHIFCKGRFEPAFVRYPLQETVRKDTLERTKEPNFNLKEFLQNAYIHPVFKGEVDSEI  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSP  223
            D  SE  ++E  LV TKRQSR NTP PSK   GSSP
Sbjct  722  DAASEDGDLEPSLVQTKRQSRFNTPLPSK--RGSSP  755



>ref|XP_002457968.1| hypothetical protein SORBIDRAFT_03g023990 [Sorghum bicolor]
 gb|EES03088.1| hypothetical protein SORBIDRAFT_03g023990 [Sorghum bicolor]
Length=768

 Score =   200 bits (508),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 120/158 (76%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP+VHGRII AL+ SQ   LGLLSTK A  S P L+ LPV+T
Sbjct  602  RHQIINVYNQEYESAAAFWPSVHGRIITALIVSQFLLLGLLSTKGAGQSTPVLLVLPVVT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH +CK RYEP F K PLQEA  KDTLERAREP  +LK YL +AY+HPVFK  +DDE 
Sbjct  662  FYFHKYCKNRYEPTFVKCPLQEAMKKDTLERAREPGFDLKGYLMNAYIHPVFKGDEDDEK  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
              ++++ E E +LV TKRQSRRNTP PSK +G  SP +
Sbjct  722  FSIADEPETEQVLVATKRQSRRNTPVPSKYNGSESPSL  759



>gb|EMT27455.1| Putative membrane protein [Aegilops tauschii]
Length=816

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP+VHGRII AL+ SQ+  LGLLSTK A  S P L+ LPV+T
Sbjct  650  RHQIINVYNQEYESAAAFWPSVHGRIITALIVSQLLFLGLLSTKGAGQSTPVLLVLPVVT  709

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH +CK RYEPAF +YPLQEA  KDTLERAREP  +LK YL  AY+HPVFK GDDDE 
Sbjct  710  FYFHKYCKNRYEPAFVEYPLQEAMRKDTLERAREPGFDLKTYLASAYIHPVFKGGDDDEK  769

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
              M ++ E + +LV TKRQSRRNTP PS+ +G  +P +
Sbjct  770  FSMMDEAEADQVLVATKRQSRRNTPVPSRHNGSEAPSL  807



>ref|XP_011046982.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Populus euphratica]
Length=672

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 122/155 (79%), Gaps = 4/155 (3%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWPAVHGR+I ALV +Q+  +GLLSTK A++S PFLIALPVLT
Sbjct  503  RHQIINVYNQEYESGAAFWPAVHGRVITALVIAQLLMMGLLSTKQASSSTPFLIALPVLT  562

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH+FC GRY+ AF KYPLQEA MKD+LERA  P  N K+YL+ AYVHPVFK   +D+D
Sbjct  563  IWFHVFCNGRYKSAFVKYPLQEAMMKDSLERASSPNFNFKSYLEKAYVHPVFKGNGNDDD  622

Query  330  ----demseklemEGILVPTKRQSRRNTPAPSKVS  238
                   +++ + E +LVPT+RQS+RN+PA S+ +
Sbjct  623  YEQYLSENQEADAENVLVPTRRQSQRNSPAVSRAA  657



>ref|XP_010657219.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657220.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657221.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657222.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657223.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657224.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 emb|CBI28840.3| unnamed protein product [Vitis vinifera]
Length=766

 Score =   198 bits (504),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 122/158 (77%), Gaps = 4/158 (3%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VH RII ALV SQ+  +GLLSTK AA S P LIALPVLT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVHMRIIVALVVSQLLLMGLLSTKQAAQSTPLLIALPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF +YPLQEA MKDTLER REP LNLK YL++AY HP+FK GDDD +
Sbjct  662  IWFHFFCKGRYEPAFVRYPLQEAMMKDTLERVREPNLNLKGYLREAYFHPIFKAGDDDSE  721

Query  330  demseklemEGI--LVPTKRQSRRNTPAPSKVSGGSSP  223
             + + ++EM     LVPTKR SRR+TP  S   G  +P
Sbjct  722  MDEANEVEMVQKPELVPTKRHSRRHTPMSS--IGSDAP  757



>gb|KHG22816.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=649

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 126/164 (77%), Gaps = 2/164 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAA+WP VH RII AL+ SQ+  +GLLSTK AA+S P LI LPVLT
Sbjct  483  RHQIINVYNQEYESAAAYWPDVHLRIIVALIVSQLLLMGLLSTKEAASSTPLLITLPVLT  542

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF + PLQEA MKDTLERAREP LNLK +LQ+AY+HPVFK  DDD+ 
Sbjct  543  IWFHRFCKGRYEPAFVRNPLQEAMMKDTLERAREPNLNLKGFLQNAYIHPVFKSADDDKI  602

Query  330  demseklemEGILVPTKRQSRRNTPAPSK--VSGGSSPDVILEK  205
            D + E+ E E  L+ TKR S+R+TP  SK   S  SSP+   E+
Sbjct  603  DVVMEEWEEEPSLIATKRTSKRSTPLSSKHGRSSFSSPEANKER  646



>ref|XP_006644293.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006644294.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X2 [Oryza brachyantha]
Length=769

 Score =   197 bits (502),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 121/159 (76%), Gaps = 1/159 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP+V+GRII AL+ SQ   LGLLSTK A  S P L+ LPV+T
Sbjct  602  RHQIINVYNQEYESAAAFWPSVNGRIIVALIVSQFLLLGLLSTKGAGQSTPVLLVLPVVT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              F+ +CK RYEPAF +YPLQEA  KDTLERAREP L+LKAYL +AYVHPVFK G DD++
Sbjct  662  FYFYKYCKNRYEPAFVEYPLQEAMRKDTLERAREPGLDLKAYLMNAYVHPVFKGGGDDDE  721

Query  330  demsekl-emEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
                    E E +LV TKRQSRRNTP PSK +G  SP +
Sbjct  722  RFSMSDEPEAEQVLVATKRQSRRNTPVPSKHNGSESPSL  760



>ref|XP_011046979.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
 ref|XP_011046980.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
 ref|XP_011046981.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
Length=775

 Score =   197 bits (502),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 122/156 (78%), Gaps = 4/156 (3%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWPAVHGR+I ALV +Q+  +GLLSTK A++S PFLIALPVLT
Sbjct  606  RHQIINVYNQEYESGAAFWPAVHGRVITALVIAQLLMMGLLSTKQASSSTPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH+FC GRY+ AF KYPLQEA MKD+LERA  P  N K+YL+ AYVHPVFK   +D+D
Sbjct  666  IWFHVFCNGRYKSAFVKYPLQEAMMKDSLERASSPNFNFKSYLEKAYVHPVFKGNGNDDD  725

Query  330  ----demseklemEGILVPTKRQSRRNTPAPSKVSG  235
                   +++ + E +LVPT+RQS+RN+PA S+ + 
Sbjct  726  YEQYLSENQEADAENVLVPTRRQSQRNSPAVSRAAS  761



>ref|XP_009148626.1| PREDICTED: CSC1-like protein At1g11960 [Brassica rapa]
Length=768

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 117/159 (74%), Gaps = 5/159 (3%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESA  FWP VHGRII AL+ SQ+  LGL+STK AA S PFLIALPVLT
Sbjct  605  RHQIINVYNQEYESAGRFWPDVHGRIISALIISQVLLLGLMSTKGAAQSTPFLIALPVLT  664

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH FCKGRYEPAF ++PLQEA +KDTLE+AREP  NLK YL+ AY+HPVFK+ + ++ 
Sbjct  665  FFFHRFCKGRYEPAFLRHPLQEAMIKDTLEQAREPNFNLKPYLKKAYIHPVFKDDEYEDV  724

Query  330  demse-----klemEGILVPTKRQSRRNTPAPSKVSGGS  229
                        + E + VPTKRQSR  TPA S  SGGS
Sbjct  725  RSEVSGYYLGDTDEECVTVPTKRQSRITTPAASHASGGS  763



>emb|CDX98089.1| BnaA06g08400D [Brassica napus]
Length=768

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 117/159 (74%), Gaps = 5/159 (3%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESA  FWP VHGRII AL+ SQ+  LGL+STK AA S PFLIALPVLT
Sbjct  605  RHQIINVYNQEYESAGRFWPDVHGRIISALIISQVLLLGLMSTKGAAQSTPFLIALPVLT  664

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH FCKGRYEPAF ++PLQEA +KDTLE+AREP  NLK YL+ AY+HPVFK+ + ++ 
Sbjct  665  FFFHRFCKGRYEPAFLRHPLQEAMIKDTLEQAREPNFNLKPYLKKAYIHPVFKDDEYEDV  724

Query  330  demse-----klemEGILVPTKRQSRRNTPAPSKVSGGS  229
                        + E + VPTKRQSR  TPA S  SGGS
Sbjct  725  RSEVSGYYLGDTDEECVTVPTKRQSRITTPAASHASGGS  763



>ref|XP_009113086.1| PREDICTED: CSC1-like protein At1g62320 [Brassica rapa]
Length=779

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 120/158 (76%), Gaps = 3/158 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAA+WP VHGRII AL+ SQI  +GL+STK  A S PFL+ LP+LT
Sbjct  605  RHQIINVYNQEYESAAAYWPDVHGRIISALIISQILLIGLMSTKGKAQSTPFLVILPILT  664

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYE AF   PLQEA +KDTLERAREP LNLK +LQ+AY+HPVFK+ + ++D
Sbjct  665  IGFHRFCKGRYESAFVVNPLQEAMIKDTLERAREPNLNLKGFLQNAYIHPVFKDEECEDD  724

Query  330  demseklemEG---ILVPTKRQSRRNTPAPSKVSGGSS  226
            +      + +    ++VPTKRQSRR T   S  +GGSS
Sbjct  725  EYEELIEDSDDENCVVVPTKRQSRRTTATSSNPNGGSS  762



>emb|CDY12941.1| BnaA09g13330D [Brassica napus]
Length=779

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 120/158 (76%), Gaps = 3/158 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAA+WP VHGRII AL+ SQI  +GL+STK  A S PFL+ LP+LT
Sbjct  605  RHQIINVYNQEYESAAAYWPDVHGRIISALIISQILLIGLMSTKGKAQSTPFLVILPILT  664

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYE AF   PLQEA +KDTLERAREP LNLK +LQ+AY+HPVFK+ + ++D
Sbjct  665  IGFHRFCKGRYESAFVVNPLQEAMIKDTLERAREPNLNLKGFLQNAYIHPVFKDEECEDD  724

Query  330  demseklemEG---ILVPTKRQSRRNTPAPSKVSGGSS  226
            +      + +    ++VPTKRQSRR T   S  +GGSS
Sbjct  725  EYEELIEDSDDENCVVVPTKRQSRRTTATSSNPNGGSS  762



>ref|XP_010921296.1| PREDICTED: calcium permeable stress-gated cation channel 1 isoform 
X1 [Elaeis guineensis]
Length=760

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VHGRII AL+ SQ+  LGLLSTKHA+ S P LIALP+LT
Sbjct  602  RHQIINVYNQEYESGAAFWPDVHGRIITALIISQLLLLGLLSTKHASQSTPLLIALPILT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCK RYEPAF  YPLQEA MKDT+E+AREP L+LKAYL +AY+HPVFK+G+DD++
Sbjct  662  IWFHRFCKNRYEPAFVIYPLQEAMMKDTVEQAREPNLDLKAYLLNAYIHPVFKDGEDDDN  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSP  223
              + E+ E +  LVPTKRQSRRNTPA SK  G SSP
Sbjct  722  FSIGEEQEYDNTLVPTKRQSRRNTPAHSKCDGSSSP  757



>emb|CDY30043.1| BnaC05g09770D [Brassica napus]
Length=768

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 117/159 (74%), Gaps = 5/159 (3%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESA  FWP VHGRII AL+ SQ+  LGL+STK AA S PFL+ALPVLT
Sbjct  605  RHQIINVYNQEYESAGRFWPDVHGRIISALIISQVLLLGLMSTKGAAQSTPFLVALPVLT  664

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH FCKGRYEPAF ++PLQEA +KDTLE+AREP  NLK YL+ AY+HPVFK+ + ++ 
Sbjct  665  FFFHRFCKGRYEPAFLRHPLQEAMIKDTLEQAREPNFNLKPYLKKAYIHPVFKDDEYEDV  724

Query  330  demse-----klemEGILVPTKRQSRRNTPAPSKVSGGS  229
                        + E + VPTKRQSR  TPA S  SGGS
Sbjct  725  RSEVSGYYLGDTDDECVTVPTKRQSRITTPAASHASGGS  763



>ref|XP_010493595.1| PREDICTED: LOW QUALITY PROTEIN: CSC1-like protein At1g11960 [Camelina 
sativa]
Length=779

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 118/161 (73%), Gaps = 6/161 (4%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES A FWP VHGRII AL+ SQ+  +GLLSTK AA S PFL+ LP+LT
Sbjct  615  RHQIINVYNQEYESGARFWPDVHGRIIAALIISQVLLMGLLSTKGAAQSTPFLLVLPILT  674

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkeg-----  346
              FH FCKGRYEPAF ++PL+EA +KDTLE+AREP  NLK YLQ AY+HPVFK+      
Sbjct  675  FFFHRFCKGRYEPAFLRHPLKEAMVKDTLEKAREPNFNLKPYLQKAYIHPVFKDDHYEDS  734

Query  345  -dddeddemseklemEGILVPTKRQSRRNTPAPSKVSGGSS  226
              DD      E  + E + VPTKRQSR NTPA S VS GSS
Sbjct  735  RFDDMSSYCGEDSDDECVTVPTKRQSRLNTPAASHVSRGSS  775



>ref|XP_006306821.1| hypothetical protein CARUB_v10008363mg [Capsella rubella]
 gb|EOA39719.1| hypothetical protein CARUB_v10008363mg [Capsella rubella]
Length=771

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 118/161 (73%), Gaps = 6/161 (4%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES A FWP VHGRII AL+ SQ+  +GL+STK AA S PFL+ LP+LT
Sbjct  605  RHQIINVYNQEYESGARFWPDVHGRIISALMISQVLLMGLMSTKGAAQSTPFLLVLPILT  664

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF------ke  349
              FH FCKGRYEPAF ++PL+EA +KDTLE+AR+P  NLK YLQ AY+HPVF        
Sbjct  665  FFFHRFCKGRYEPAFLRHPLKEAMVKDTLEKARDPYFNLKPYLQKAYIHPVFRDDHFEDS  724

Query  348  gdddeddemseklemEGILVPTKRQSRRNTPAPSKVSGGSS  226
              D+     +E  + + + VPTKRQSR+NTPAPS  S GSS
Sbjct  725  RFDEISSYRAEDSDEDCVTVPTKRQSRKNTPAPSHASRGSS  765



>dbj|BAK03311.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=767

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 119/158 (75%), Gaps = 1/158 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP+VHGRII AL+ SQ+  LGLLSTK A  S P L+ LPV+T
Sbjct  602  RHQIINVYNQEYESAAAFWPSVHGRIITALIVSQLLFLGLLSTKGAGQSTPVLLVLPVVT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH +CK RYEPAF +YPLQEA  KDTLERAREP  +LK YL  AY+HPVFK  DD++ 
Sbjct  662  FYFHKYCKNRYEPAFVEYPLQEAMRKDTLERAREPGFDLKTYLASAYIHPVFKGEDDEKF  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
              M E    + +LV TKRQSRRNTP PS+ +G  +P +
Sbjct  722  SMMDEGEADQ-VLVATKRQSRRNTPVPSRNNGSEAPSM  758



>ref|XP_007145950.1| hypothetical protein PHAVU_006G000300g [Phaseolus vulgaris]
 gb|ESW17944.1| hypothetical protein PHAVU_006G000300g [Phaseolus vulgaris]
Length=773

 Score =   195 bits (496),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 118/157 (75%), Gaps = 3/157 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VH RII AL+ SQI  +GLL+TK AA+S PFLI LP+LT
Sbjct  604  RHQIINVYNQEYESGAAFWPDVHFRIILALIVSQIVLMGLLTTKKAASSTPFLIVLPILT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH +CKGR+E AF K+PLQEA MKDTLERA EP LNLK YLQ+AYVHP+FK+  ++E 
Sbjct  664  IWFHRYCKGRFESAFVKFPLQEAMMKDTLERAIEPNLNLKGYLQNAYVHPIFKDSMEEET  723

Query  330  demsekle---mEGILVPTKRQSRRNTPAPSKVSGGS  229
            DE          E  +V TKRQSR+NTP PS  +  S
Sbjct  724  DEEEILGMEFETESAIVRTKRQSRKNTPLPSTNNASS  760



>ref|XP_006383870.1| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|ERP61667.1| early-responsive to dehydration family protein [Populus trichocarpa]
Length=775

 Score =   195 bits (495),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 121/156 (78%), Gaps = 4/156 (3%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWPAVHGR+I ALV +Q+  +GLLSTK A+++ PFLIALPVLT
Sbjct  606  RHQIINVYNQEYESGAAFWPAVHGRVITALVIAQLLMMGLLSTKQASSTTPFLIALPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk----egd  343
            I FH+FC GRY+ AF KYPLQEA MKD+LERA  P  N ++YL+ AYVHPVFK    + D
Sbjct  666  IWFHVFCNGRYKSAFVKYPLQEAMMKDSLERASSPNFNFRSYLEKAYVHPVFKGDGNDDD  725

Query  342  ddeddemseklemEGILVPTKRQSRRNTPAPSKVSG  235
             ++    +++ + E +LVPT+R SRRN+PA S+ + 
Sbjct  726  YEQYLSENQEADAENVLVPTRRHSRRNSPAVSRAAS  761



>gb|KJB10672.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=608

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAA+WP VH RII AL+ SQ+  +GLLSTK AA+S P LI LP+LT
Sbjct  442  RHQIINVYNQEYESAAAYWPDVHLRIIVALIVSQLLLMGLLSTKEAASSTPLLITLPILT  501

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF + PLQEA MKDTLERAREP LNLK +LQ+AY+HPVFK  D D+ 
Sbjct  502  IWFHRFCKGRYEPAFVRNPLQEAMMKDTLERAREPNLNLKGFLQNAYIHPVFKSADGDKI  561

Query  330  demseklemEGILVPTKRQSRRNTP  256
            D   E+ E E  L+ TKR S+R+TP
Sbjct  562  DVAMEEWEEEPSLIATKRTSKRSTP  586



>gb|KJB10674.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=729

 Score =   192 bits (488),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAA+WP VH RII AL+ SQ+  +GLLSTK AA+S P LI LP+LT
Sbjct  563  RHQIINVYNQEYESAAAYWPDVHLRIIVALIVSQLLLMGLLSTKEAASSTPLLITLPILT  622

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF + PLQEA MKDTLERAREP LNLK +LQ+AY+HPVFK  D D+ 
Sbjct  623  IWFHRFCKGRYEPAFVRNPLQEAMMKDTLERAREPNLNLKGFLQNAYIHPVFKSADGDKI  682

Query  330  demseklemEGILVPTKRQSRRNTP  256
            D   E+ E E  L+ TKR S+R+TP
Sbjct  683  DVAMEEWEEEPSLIATKRTSKRSTP  707



>gb|KJB10673.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=768

 Score =   192 bits (488),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAA+WP VH RII AL+ SQ+  +GLLSTK AA+S P LI LP+LT
Sbjct  602  RHQIINVYNQEYESAAAYWPDVHLRIIVALIVSQLLLMGLLSTKEAASSTPLLITLPILT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF + PLQEA MKDTLERAREP LNLK +LQ+AY+HPVFK  D D+ 
Sbjct  662  IWFHRFCKGRYEPAFVRNPLQEAMMKDTLERAREPNLNLKGFLQNAYIHPVFKSADGDKI  721

Query  330  demseklemEGILVPTKRQSRRNTP  256
            D   E+ E E  L+ TKR S+R+TP
Sbjct  722  DVAMEEWEEEPSLIATKRTSKRSTP  746



>ref|NP_001043256.1| Os01g0534900 [Oryza sativa Japonica Group]
 dbj|BAD87679.1| putative ERD4 protein [Oryza sativa Japonica Group]
 dbj|BAF05170.1| Os01g0534900 [Oryza sativa Japonica Group]
 dbj|BAG96168.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70822.1| hypothetical protein OsI_02298 [Oryza sativa Indica Group]
 gb|EEE54743.1| hypothetical protein OsJ_02101 [Oryza sativa Japonica Group]
 gb|AIU34628.1| hyperosmolality-gated Ca2+ permeable channel 1.1 [Oryza sativa]
Length=768

 Score =   192 bits (488),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP+VHGRII AL+ SQ+  LGLLSTK A  S P L+ LPV+T
Sbjct  602  RHQIINVYNQEYESAAAFWPSVHGRIIVALIVSQLLLLGLLSTKGAGQSTPVLLVLPVVT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              F+ +CK RYEPAF +YPLQ+A  KDTLERAREP  +LK YL +AY+HPVFK  +DDE 
Sbjct  662  FYFYKYCKNRYEPAFVEYPLQDAMRKDTLERAREPGFDLKGYLMNAYIHPVFKGDEDDEK  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
              +S++ E E +LV TKRQSRRNTP PSK +G  SP +
Sbjct  722  FSISDEPEAEQVLVATKRQSRRNTPVPSKYNGSESPSL  759



>ref|XP_002892667.1| hypothetical protein ARALYDRAFT_312226 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68926.1| hypothetical protein ARALYDRAFT_312226 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   192 bits (488),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 114/154 (74%), Gaps = 6/154 (4%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAA FWP VHGRII AL+ SQI  +GLLSTK AA S PFL+ LP+LT
Sbjct  607  RHQIINVYNQEYESAARFWPDVHGRIISALIISQILLMGLLSTKGAAQSTPFLLVLPILT  666

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH FCKGRYEPAF ++PL+EA +KDTLERAREP  NLK YLQ AY+HPVFK+ D ++ 
Sbjct  667  FFFHRFCKGRYEPAFLRHPLKEAMVKDTLERAREPNFNLKPYLQKAYIHPVFKDNDYEDS  726

Query  330  demsek------lemEGILVPTKRQSRRNTPAPS  247
                         + E + VPTKRQSR NTPA S
Sbjct  727  RFDEISGYCIEDSDDECVTVPTKRQSRINTPAVS  760



>gb|KJB42871.1| hypothetical protein B456_007G171500 [Gossypium raimondii]
Length=788

 Score =   192 bits (487),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVY+QEYESAAAFWP VH R++ AL+ SQ+  +GLLSTK A+ S P LI LPVLT
Sbjct  623  RHQIINVYHQEYESAAAFWPDVHVRVVAALIVSQLLLMGLLSTKEASQSTPLLITLPVLT  682

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF +YPLQEA MKDTLERA+E  LNLK +LQ+AY+HPVFK  D+ + 
Sbjct  683  ICFHRFCKGRYEPAFVRYPLQEAMMKDTLERAKEANLNLKGFLQNAYIHPVFKSADESDS  742

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGS  229
            +  SE       LV TKR S+R TP PSK  GGS
Sbjct  743  ESESEWERSPA-LVATKRTSKRFTPMPSK-DGGS  774



>gb|KJB42870.1| hypothetical protein B456_007G171500 [Gossypium raimondii]
Length=768

 Score =   192 bits (487),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVY+QEYESAAAFWP VH R++ AL+ SQ+  +GLLSTK A+ S P LI LPVLT
Sbjct  603  RHQIINVYHQEYESAAAFWPDVHVRVVAALIVSQLLLMGLLSTKEASQSTPLLITLPVLT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEPAF +YPLQEA MKDTLERA+E  LNLK +LQ+AY+HPVFK  D+ + 
Sbjct  663  ICFHRFCKGRYEPAFVRYPLQEAMMKDTLERAKEANLNLKGFLQNAYIHPVFKSADESDS  722

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGS  229
            +  SE       LV TKR S+R TP PSK  GGS
Sbjct  723  ESESEWERSPA-LVATKRTSKRFTPMPSK-DGGS  754



>ref|NP_001056508.1| Os05g0594700 [Oryza sativa Japonica Group]
 gb|AAV59379.1| putative early-responsive to dehydration stress protein (ERD4) 
[Oryza sativa Japonica Group]
 dbj|BAF18422.1| Os05g0594700 [Oryza sativa Japonica Group]
 gb|EAY99267.1| hypothetical protein OsI_21231 [Oryza sativa Indica Group]
 dbj|BAG93571.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AIU34629.1| hyperosmolality-gated Ca2+ permeable channel 1.2 [Oryza sativa]
Length=766

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 125/165 (76%), Gaps = 3/165 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ+YES A FWP+VHGRII AL+ SQ+  +GLLSTK    + P L+ LPVLT
Sbjct  602  RHQIINVYNQQYESGAQFWPSVHGRIIIALIVSQLLLIGLLSTKGFEETTPVLVVLPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              F+ +CK R+EPAF + PLQEA  KDTLERAREPT +LKAYL +AY+HPVFK  +++++
Sbjct  662  FWFYKYCKNRFEPAFVRNPLQEAMRKDTLERAREPTFDLKAYLANAYLHPVFKGREEEDN  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSS---PDVILEK  205
              +SE + ME ++VPTKRQSRRNTPA SK  G  +   P+ + E+
Sbjct  722  MSISEDVGMEEVIVPTKRQSRRNTPAQSKYEGSDTLSLPETVHER  766



>gb|EEE64912.1| hypothetical protein OsJ_19772 [Oryza sativa Japonica Group]
Length=893

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ+YES A FWP+VHGRII AL+ SQ+  +GLLSTK    + P L+ LPVLT
Sbjct  602  RHQIINVYNQQYESGAQFWPSVHGRIIIALIVSQLLLIGLLSTKGFEETTPVLVVLPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              F+ +CK R+EPAF + PLQEA  KDTLERAREPT +LKAYL +AY+HPVFK  +++++
Sbjct  662  FWFYKYCKNRFEPAFVRNPLQEAMRKDTLERAREPTFDLKAYLANAYLHPVFKGREEEDN  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSS  226
              +SE + ME ++VPTKRQSRRNTPA SK  G  +
Sbjct  722  MSISEDVGMEEVIVPTKRQSRRNTPAQSKYEGSDT  756


 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 94/128 (73%), Gaps = 3/128 (2%)
 Frame = -3

Query  579  LGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTL  400
            +GLLSTK    + P L+ LPVLT  F+ +CK R+EPAF + PLQEA  KDTLERAREPT 
Sbjct  766  IGLLSTKGFEETTPVLVVLPVLTFWFYKYCKNRFEPAFVRNPLQEAMRKDTLERAREPTF  825

Query  399  NLKAYLQDAYVHPVFkegdddeddemseklemEGILVPTKRQSRRNTPAPSKVSGGSS--  226
            +LKAYL +AY+HPVFK  +++++  +SE + ME ++VPTKRQSRRNTPA SK  G  +  
Sbjct  826  DLKAYLANAYLHPVFKGREEEDNMSISEDVGMEEVIVPTKRQSRRNTPAQSKYEGSDTLS  885

Query  225  -PDVILEK  205
             P+ + E+
Sbjct  886  LPETVHER  893



>ref|XP_008363043.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein 
C2G11.09-like [Malus domestica]
Length=660

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            R QIINVYNQEYESAAAFWP VHGRII AL+ SQ+  +GLLSTK AA S P LI LPVLT
Sbjct  495  RRQIINVYNQEYESAAAFWPDVHGRIITALIVSQLLLMGLLSTKEAAXSTPLLITLPVLT  554

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRY+PAF ++PLQEA MKDTLE  REP LNLK +LQ+AY+HPVFK  DD ++
Sbjct  555  IWFHRFCKGRYKPAFIRHPLQEAMMKDTLECTREPNLNLKXFLQNAYIHPVFKSEDDSKN  614

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVS  238
            D  +++ E E  +V TK  SRRNTP P+ ++
Sbjct  615  DAPAQEFEKEPAVVLTKCSSRRNTPMPANIA  645



>ref|XP_010458617.1| PREDICTED: CSC1-like protein At1g11960 [Camelina sativa]
Length=772

 Score =   189 bits (481),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 112/156 (72%), Gaps = 6/156 (4%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES A FWP VHGRII AL+ SQ+  +GLLSTK AA S PFL+ LP+LT
Sbjct  605  RHQIINVYNQEYESGARFWPDVHGRIISALIISQVLLMGLLSTKGAAQSTPFLLVLPILT  664

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF------ke  349
              FH FCKGRYEPAF ++PL++A +KDTLE+AREP  NLK YLQ AY+HPVF        
Sbjct  665  FFFHRFCKGRYEPAFLRHPLKDAMVKDTLEKAREPNFNLKPYLQKAYIHPVFRDDHYEDS  724

Query  348  gdddeddemseklemEGILVPTKRQSRRNTPAPSKV  241
              DD      E  + E + VPTKRQSR NTPA S V
Sbjct  725  RFDDMSSYCVEDSDDECVTVPTKRQSRLNTPAASHV  760



>ref|XP_010476146.1| PREDICTED: CSC1-like protein At1g11960 [Camelina sativa]
Length=772

 Score =   189 bits (480),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 112/156 (72%), Gaps = 6/156 (4%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES A FWP VHGRII AL+ SQ+  +GLLSTK AA S PFL+ LP+LT
Sbjct  605  RHQIINVYNQEYESGARFWPDVHGRIIAALIISQVLLMGLLSTKGAAQSTPFLLVLPILT  664

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF------ke  349
              FH FCKGRYEPAF ++PL++A +KDTLE+AREP  NLK YLQ AY+HPVF        
Sbjct  665  FFFHRFCKGRYEPAFLRHPLKDAMVKDTLEKAREPNFNLKPYLQKAYIHPVFRDDHYEDS  724

Query  348  gdddeddemseklemEGILVPTKRQSRRNTPAPSKV  241
              DD      E  + E + VPTKRQSR NTPA S V
Sbjct  725  RFDDISSYCVEDSDDECVTVPTKRQSRLNTPAASHV  760



>emb|CDY19541.1| BnaC09g13620D [Brassica napus]
Length=779

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 113/147 (77%), Gaps = 3/147 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAA+WP VHGRII AL+ SQI  +GL+STK  A S PFL+ LP+LT
Sbjct  605  RHQIINVYNQEYESAAAYWPDVHGRIISALIISQILLIGLMSTKGKAQSTPFLVILPILT  664

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYE AF   PLQE+ +KDTLERAREP LNLK +LQ+AY+HPVFK+ + ++D
Sbjct  665  IGFHRFCKGRYESAFVVNPLQESMIKDTLERAREPNLNLKGFLQNAYIHPVFKDEECEDD  724

Query  330  demseklemEG---ILVPTKRQSRRNT  259
                   + +    ++VPTKRQSRR T
Sbjct  725  QYEELNEDSDDENCVVVPTKRQSRRTT  751



>gb|AAC17615.1| Similar to hypothetical protein HYP1 gb|Z97338 from A. thaliana 
[Arabidopsis thaliana]
Length=783

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 114/154 (74%), Gaps = 6/154 (4%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAA FWP VHGRII AL+ +QI  +GLLSTK AA S PFL+ LP++T
Sbjct  617  RHQIINVYNQEYESAARFWPDVHGRIISALIIAQILLMGLLSTKGAAQSTPFLLFLPIIT  676

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH +CKGRYEPAF ++PL+EA +KDTLERAREP  NLK YLQ AY+HPVFK+ D ++ 
Sbjct  677  FFFHRYCKGRYEPAFLRHPLKEAMVKDTLERAREPNFNLKPYLQKAYIHPVFKDNDYEDS  736

Query  330  demsek------lemEGILVPTKRQSRRNTPAPS  247
                         + E + VPTKRQSR NTPA S
Sbjct  737  RFDEISGYCIEDSDEECVTVPTKRQSRINTPAVS  770



>ref|XP_008673458.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
Length=768

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 118/158 (75%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP+VHGRII AL+ SQ+  LGLLSTK A  S P L+ LPV+T
Sbjct  602  RHQIINVYNQEYESAAAFWPSVHGRIITALIVSQLLLLGLLSTKGAGQSTPVLLVLPVVT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH +C  RY+P F K PLQEA  KDTLERAREP  +LK YL +AY+HPVFK   DD+ 
Sbjct  662  FYFHKYCNNRYKPTFVKCPLQEAMKKDTLERAREPGFDLKGYLMNAYIHPVFKGDGDDDK  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
              + ++ E E +LV TKRQSRRNTP PSK +G  SP +
Sbjct  722  FSVVDQPEAEQVLVATKRQSRRNTPVPSKYNGSESPSL  759



>ref|NP_172660.5| putative ERD4 protein [Arabidopsis thaliana]
 sp|B5TYT3.1|CSCL7_ARATH RecName: Full=CSC1-like protein At1g11960 [Arabidopsis thaliana]
 gb|ACI01072.1| putative membrane protein [Arabidopsis thaliana]
 gb|AEE28821.1| putative ERD4 protein [Arabidopsis thaliana]
 gb|AIU34615.1| hyperosmolality-gated Ca2+ permeable channel 1.3 [Arabidopsis 
thaliana]
Length=771

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 114/154 (74%), Gaps = 6/154 (4%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAA FWP VHGRII AL+ +QI  +GLLSTK AA S PFL+ LP++T
Sbjct  605  RHQIINVYNQEYESAARFWPDVHGRIISALIIAQILLMGLLSTKGAAQSTPFLLFLPIIT  664

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH +CKGRYEPAF ++PL+EA +KDTLERAREP  NLK YLQ AY+HPVFK+ D ++ 
Sbjct  665  FFFHRYCKGRYEPAFLRHPLKEAMVKDTLERAREPNFNLKPYLQKAYIHPVFKDNDYEDS  724

Query  330  demsek------lemEGILVPTKRQSRRNTPAPS  247
                         + E + VPTKRQSR NTPA S
Sbjct  725  RFDEISGYCIEDSDEECVTVPTKRQSRINTPAVS  758



>ref|XP_008675529.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
 ref|XP_008675530.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
 tpg|DAA59084.1| TPA: hypothetical protein ZEAMMB73_475653 [Zea mays]
Length=768

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 119/158 (75%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP+VHGRII AL+ SQ+  LGLLSTK A  S P L+ LPV+T
Sbjct  602  RHQIINVYNQEYESAAAFWPSVHGRIITALIVSQLLLLGLLSTKGAGQSTPVLLVLPVVT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH +C  RY+P F K PLQEA  KDTLERAREP  +LK YL +AY+HPVFK   DD+ 
Sbjct  662  FYFHKYCNNRYKPTFVKCPLQEAMKKDTLERAREPGFDLKGYLMNAYIHPVFKGDGDDDK  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
              ++++ E E +LV TKRQSRRNTP PSK +G  SP +
Sbjct  722  FSVADEPEAEQVLVATKRQSRRNTPVPSKYNGSESPSL  759



>ref|XP_006654880.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Oryza 
brachyantha]
Length=770

 Score =   187 bits (474),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 119/160 (74%), Gaps = 3/160 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ+YES A FWP+VHGRII AL+ SQ+  +GLLSTK    S P L+ LPVLT
Sbjct  602  RHQIINVYNQQYESGAQFWPSVHGRIIVALIVSQLLLIGLLSTKGFEESTPVLLVLPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              F+ +CK R+EPAF + PLQEA  KDT+ERAREPT +LKAYL +AY+HPVFK  +++E 
Sbjct  662  FWFYKYCKNRFEPAFVRNPLQEAMRKDTVERAREPTFDLKAYLTNAYLHPVFKSNEEEEK  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSS---PD  220
              +SE + ME ++VPTKRQSRR TP  SK  G  +   PD
Sbjct  722  MSISEDIGMEEVIVPTKRQSRRTTPVQSKYEGSDTLSLPD  761



>emb|CDP11354.1| unnamed protein product [Coffea canephora]
Length=777

 Score =   186 bits (473),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQI+NVYNQEYESAAAFWP VHGRII AL+ SQ+  LGLLSTK A+ S PFLI LPVLT
Sbjct  611  RHQIMNVYNQEYESAAAFWPDVHGRIIIALIVSQLLLLGLLSTKDASQSTPFLITLPVLT  670

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I F  +CKGRYEPAF +YPLQ+A MKD L R REP +NLK YL+ AY+HPVFK GDD E+
Sbjct  671  ICFDRYCKGRYEPAFVRYPLQQAMMKDILNRTREPNVNLKDYLRSAYIHPVFKAGDDYEN  730

Query  330  demseklemEGILVPTKRQSRRNTP  256
            + +SE  E E  LVPTKRQSRR+TP
Sbjct  731  NLVSEDEEQEPTLVPTKRQSRRSTP  755



>ref|XP_010418218.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010418219.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010418220.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
Length=780

 Score =   186 bits (472),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 114/160 (71%), Gaps = 5/160 (3%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQI  LGL+STK    S PFL+ L +LT
Sbjct  605  RHQIINVYNQEYESAAAFWPDVHGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAILT  664

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH FCKGRYE AF   PLQEA +KDTLERAREP +NLK +LQ+AY+HPVFK+ + ++D
Sbjct  665  FVFHRFCKGRYESAFVINPLQEAMIKDTLERAREPNMNLKGFLQNAYIHPVFKDEEFEDD  724

Query  330  demseklemEG----ILVPTKRQS-RRNTPAPSKVSGGSS  226
                   E       ++VPTKR   RR T A S VSGG S
Sbjct  725  QFDEGLTEDSDDEDCVVVPTKRHRPRRKTVASSNVSGGLS  764



>ref|XP_010430277.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430278.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430279.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430280.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430281.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
Length=780

 Score =   186 bits (472),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 114/160 (71%), Gaps = 5/160 (3%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQI  LGL+STK    S PFL+ L +LT
Sbjct  605  RHQIINVYNQEYESAAAFWPDVHGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAILT  664

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH FCKGRYE AF   PLQEA +KDTLERAREP +NLK +LQ+AY+HPVFK+ + ++D
Sbjct  665  FVFHRFCKGRYESAFVINPLQEAMIKDTLERAREPNMNLKGFLQNAYIHPVFKDEEFEDD  724

Query  330  demseklemEG----ILVPTKRQS-RRNTPAPSKVSGGSS  226
                   E       ++VPTKR   RR T A S VSGG S
Sbjct  725  QFDEGLTEDSDDEDCVVVPTKRHRPRRKTVASSNVSGGLS  764



>sp|F4HYR3.2|CSCL6_ARATH RecName: Full=CSC1-like protein At1g62320 [Arabidopsis thaliana]
 gb|AAF70851.1|AC003113_18 F24O1.4 [Arabidopsis thaliana]
Length=778

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 117/157 (75%), Gaps = 2/157 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ+YESA AFWP VHGRII AL+ SQI  LGL+STK    S PFL+ L +LT
Sbjct  605  RHQIINVYNQKYESAGAFWPDVHGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAILT  664

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH FCKGRYE AF   PLQEA +KDTLERAREP LNLK +LQ+AYVHPVFK+ +D ++
Sbjct  665  FGFHRFCKGRYESAFVINPLQEAMIKDTLERAREPNLNLKGFLQNAYVHPVFKDEEDSDE  724

Query  330  demseklemEG-ILVPTKRQ-SRRNTPAPSKVSGGSS  226
            + + E  + E  ++V TKRQ SRR T A S  S GSS
Sbjct  725  EGLIEDSDDEDCVVVQTKRQRSRRTTVASSNASRGSS  761



>ref|XP_006843810.1| hypothetical protein AMTR_s00007p00254340 [Amborella trichopoda]
 gb|ERN05485.1| hypothetical protein AMTR_s00007p00254340 [Amborella trichopoda]
Length=763

 Score =   185 bits (469),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 117/149 (79%), Gaps = 1/149 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQ+INVYNQEYES AAFWP VHGRII ALV SQ+  LGLLSTK AA S P L+ALPVLT
Sbjct  602  RHQVINVYNQEYESGAAFWPDVHGRIITALVISQLLLLGLLSTKLAAQSTPLLLALPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCK R+E AF K+PL+EA +KDTLERA +P LNLK YL +AY+HPVFK G++ + 
Sbjct  662  IWFHRFCKDRFESAFVKFPLEEAMIKDTLERATDPNLNLKGYLSNAYIHPVFKGGEESDS  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSK  244
              +++  + E  LVPTKRQSR NTP PSK
Sbjct  722  VSLADIEQDEA-LVPTKRQSRMNTPQPSK  749



>ref|XP_008808245.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Phoenix dactylifera]
Length=759

 Score =   184 bits (467),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVY+QEYES AAFWP VH R+I A++ SQ++ +GL+STK    + P LIALP+LT
Sbjct  603  RHQIINVYDQEYESGAAFWPDVHRRLIIAMIISQLTLMGLMSTKDPKHATPVLIALPILT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH +CK R+EPAF K+PLQEA +KDTLERA++P LNL++YLQDAYVHPVF   D +  
Sbjct  663  IWFHKYCKSRFEPAFVKFPLQEAVVKDTLERAKDPNLNLRSYLQDAYVHPVFHSKDIERL  722

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
              + E+      LVPTKR S R+TP  SK    +  ++
Sbjct  723  VAIDEEENNP--LVPTKRNSNRSTPGGSKYGSEAGSEI  758



>emb|CDY32438.1| BnaC03g42220D [Brassica napus]
Length=756

 Score =   183 bits (465),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESA AFWP VH RI+ AL+ SQ+  +GLLSTKHA+ S P L  LPVLT
Sbjct  603  RHQIINVYNQEYESAGAFWPDVHRRIVIALIVSQLLLMGLLSTKHASRSTPLLFILPVLT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEP F +YPLQ+A +KDTLER +EP LNLK +LQ+AYVHPVFK  D+ +D
Sbjct  663  IGFHRFCKGRYEPVFVRYPLQDAMVKDTLERTKEPNLNLKTFLQNAYVHPVFKAADNVKD  722

Query  330  demseklemEGI--LVPTKRQSRRNTPAPS  247
            + + E+   +    LV TKR S+R+T   S
Sbjct  723  EMVVEEPRADQTPDLVATKRSSKRHTSGSS  752



>emb|CDY48898.1| BnaA03g36370D [Brassica napus]
Length=756

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESA AFWP VH R++ AL+ SQ+  +GLLSTKHA+ S P L  LPVLT
Sbjct  603  RHQIINVYNQEYESAGAFWPDVHRRVVIALIVSQLLLMGLLSTKHASRSTPLLFILPVLT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEP F +YPLQ+A +KDTLER +EP LNLK +LQ+AYVHPVFK  D+ +D
Sbjct  663  IGFHRFCKGRYEPVFVRYPLQDAMVKDTLERTKEPNLNLKTFLQNAYVHPVFKAADNVKD  722

Query  330  demseklemEGI--LVPTKRQSRRNTPAPS  247
            + + E+   +    LV TKR S+R+T   S
Sbjct  723  EMVVEEPRADQTPDLVATKRSSKRHTSGSS  752



>ref|XP_009135761.1| PREDICTED: CSC1-like protein At3g21620 [Brassica rapa]
Length=756

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESA AFWP VH R++ AL+ SQ+  +GLLSTKHA+ S P L  LPVLT
Sbjct  603  RHQIINVYNQEYESAGAFWPDVHRRVVIALIVSQLLLMGLLSTKHASRSTPLLFILPVLT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRYEP F +YPLQ+A +KDTLER +EP LNLK +LQ+AYVHPVFK  D+ +D
Sbjct  663  IGFHRFCKGRYEPVFVRYPLQDAMVKDTLERTKEPNLNLKTFLQNAYVHPVFKAADNVKD  722

Query  330  demseklemEGI--LVPTKRQSRRNTPAPS  247
            + + E+   +    LV TKR S+R+T   S
Sbjct  723  EMVVEEPRADQTPDLVATKRSSKRHTSGSS  752



>ref|XP_006300401.1| hypothetical protein CARUB_v10019839mg [Capsella rubella]
 gb|EOA33299.1| hypothetical protein CARUB_v10019839mg [Capsella rubella]
Length=774

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 113/159 (71%), Gaps = 10/159 (6%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQI  LGL+STK    S PFL+ L +LT
Sbjct  605  RHQIINVYNQEYESAAAFWPDVHGRIITALIISQILLLGLMSTKGKVQSTPFLLVLSILT  664

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH  CKGRYE AF   PLQEA +KDTLERAREP LNLK +LQ+AY+HPVFK+ + +ED
Sbjct  665  FGFHRICKGRYESAFVINPLQEAMIKDTLERAREPNLNLKGFLQNAYIHPVFKDEEYEED  724

Query  330  demseklemEG----ILVPTKRQSRRNTPAPSKVSGGSS  226
            D+     E       ++VPTKRQ       P + SGGSS
Sbjct  725  DQFERLTEDSDDEDCVVVPTKRQK------PRRTSGGSS  757



>ref|XP_006850790.1| hypothetical protein AMTR_s00025p00102970 [Amborella trichopoda]
 gb|ERN12371.1| hypothetical protein AMTR_s00025p00102970 [Amborella trichopoda]
Length=765

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 112/149 (75%), Gaps = 1/149 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAA+FWP VHGRI+ A+V SQ+  +GL+ST+ AA S   LI LP+LT
Sbjct  604  RHQIINVYNQEYESAASFWPDVHGRIVTAMVISQLVLMGLVSTRGAAQSTTVLIPLPILT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FHL CK R+E AF K+PLQEA MKDTLERA EP LNLK YLQDAY+HPVFK G+    
Sbjct  664  IWFHLVCKSRFESAFVKFPLQEAMMKDTLERATEPNLNLKVYLQDAYIHPVFKGGNGHHQ  723

Query  330  demseklemEGILVPTKRQSRRNTPAPSK  244
             +   + E    LVPTKR S+ +TPA SK
Sbjct  724  PKPGFEEETNP-LVPTKRHSQLSTPALSK  751



>emb|CDP03600.1| unnamed protein product [Coffea canephora]
Length=756

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 109/149 (73%), Gaps = 2/149 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVY+Q+YES A FWP VH RII ALV SQ+  +GLLSTK AA S P LI LPVLT
Sbjct  603  RHQIINVYDQKYESGAKFWPDVHRRIIVALVISQLLLMGLLSTKKAANSTPLLIVLPVLT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FHLFCKGR+E AF K+PLQ+A +KDTLERA EP LNLKAYL DAY+HPVFK    D+ 
Sbjct  663  IWFHLFCKGRFESAFVKFPLQDAMVKDTLERATEPNLNLKAYLHDAYIHPVFKCVQLDKP  722

Query  330  demseklemEGILVPTKRQSRRNTPAPSK  244
              + ++      LV TKR SRR++   S 
Sbjct  723  KAVDDEENNP--LVATKRNSRRDSKTGSD  749



>ref|XP_004968885.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Setaria 
italica]
Length=768

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 120/158 (76%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP+VHGRII AL+ SQ+  LGLLSTK A  S P L+ LPV+T
Sbjct  602  RHQIINVYNQEYESAAAFWPSVHGRIITALIISQLLLLGLLSTKGAGQSTPVLLVLPVVT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH +CK RYEP F K PLQEA  KDTLERAREP  +LK YL +AY+HPVFK  DDDE 
Sbjct  662  FYFHKYCKNRYEPTFVKCPLQEAMKKDTLERAREPGFDLKGYLMNAYIHPVFKVDDDDEK  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
              ++ + E E +LV TKRQSRRNTP PSK +G  SP +
Sbjct  722  FSIAGEPEAEQVLVATKRQSRRNTPVPSKYNGSESPSL  759



>ref|XP_011046985.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Populus euphratica]
Length=1186

 Score =   184 bits (466),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VHGRII  LV SQ++ +GLL TK AA S PFLI+LPVLT
Sbjct  606  RHQIINVYNQEYESGAAFWPDVHGRIITGLVISQLALMGLLGTKEAAQSTPFLISLPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  355
            I FH+FC GR++ AF KYPLQEA MKDTLERAR+P  NLK+YL  AYVHP+F
Sbjct  666  IWFHMFCNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKSYLHSAYVHPIF  717



>ref|XP_011046984.1| PREDICTED: uncharacterized protein LOC105141455 isoform X1 [Populus 
euphratica]
Length=1759

 Score =   184 bits (466),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VHGRII  LV SQ++ +GLL TK AA S PFLI+LPVLT
Sbjct  606  RHQIINVYNQEYESGAAFWPDVHGRIITGLVISQLALMGLLGTKEAAQSTPFLISLPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  355
            I FH+FC GR++ AF KYPLQEA MKDTLERAR+P  NLK+YL  AYVHP+F
Sbjct  666  IWFHMFCNGRHKSAFVKYPLQEAMMKDTLERARDPNFNLKSYLHSAYVHPIF  717



>ref|NP_001147493.1| LOC100281102 [Zea mays]
 gb|ACG27714.1| HYP1 [Zea mays]
Length=768

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ+YESAA FWP+VHGRII AL+ SQ+  LGL+ST     + P L+ LPVLT
Sbjct  602  RHQIINVYNQQYESAAQFWPSVHGRIITALIVSQLLLLGLMSTNDFEQTTPVLLVLPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              F+ +CK R+EPAF + PLQEA  KDTLERAREP L+LKAYL ++Y+HPVFK  + D+ 
Sbjct  662  FGFYKYCKNRFEPAFVRNPLQEAMKKDTLERAREPNLDLKAYLANSYLHPVFKGDEGDDR  721

Query  330  demsekl--emEGILVPTKRQSRRNTPAPSKVSGGSSPDVI  214
              + +      E ++VPTKR SRR TPA SK  G  S  V+
Sbjct  722  YSVMDDDGWMEEEVIVPTKRHSRRTTPAQSKHEGSDSLSVL  762



>ref|XP_010255871.1| PREDICTED: CSC1-like protein At4g02900 [Nelumbo nucifera]
Length=759

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 110/157 (70%), Gaps = 2/157 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVY+Q+YESAAAFWP VH R+I  ++ SQ+  +GLLSTK A  S P L+ LP+LT
Sbjct  602  RHQIINVYDQKYESAAAFWPDVHWRLIIGMIISQLLLMGLLSTKDAELSTPLLVVLPILT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH  CK R+E AF K+PLQ+A +KDTLERA EP LNLK YLQDAY+HPVFK+   +  
Sbjct  662  IWFHRICKNRFESAFVKFPLQDAMVKDTLERATEPNLNLKNYLQDAYIHPVFKDNQIEVP  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPD  220
              + E       LVPT+R S RNTP  SK S   S +
Sbjct  722  TAIYEDENNP--LVPTRRTSNRNTPGESKRSSEISSE  756



>gb|AFW81357.1| HYP1 isoform 1 [Zea mays]
 gb|AFW81358.1| HYP1 isoform 2 [Zea mays]
Length=768

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ+YESAA FWP+VHGRII AL+ SQ+  LGL+ST     + P L+ LPVLT
Sbjct  602  RHQIINVYNQQYESAAQFWPSVHGRIITALIVSQLLLLGLMSTNDFEQTTPVLLVLPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              F+ +CK R+EPAF + PLQEA  KDTLERAREP L+LKAYL ++Y+HPVFK  + D+ 
Sbjct  662  FGFYKYCKNRFEPAFVRNPLQEAMKKDTLERAREPNLDLKAYLANSYLHPVFKGDEGDDR  721

Query  330  demsekl--emEGILVPTKRQSRRNTPAPSKVSGGSSPDVI  214
              + +      E ++VPTKR SRR TPA SK  G  S  V+
Sbjct  722  YSVMDDDGWMEEEVIVPTKRHSRRTTPAQSKHEGSDSLSVL  762



>ref|XP_010038117.1| PREDICTED: CSC1-like protein At4g02900 [Eucalyptus grandis]
 gb|KCW49929.1| hypothetical protein EUGRSUZ_K03391 [Eucalyptus grandis]
Length=756

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 113/151 (75%), Gaps = 2/151 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQ+INVY+Q+YES AAFWP V  R+I  +V SQ+  +GL+STK A +S P LI LP+LT
Sbjct  603  RHQVINVYDQKYESGAAFWPDVQRRLIIGMVISQLLLMGLMSTKGAKSSTPLLIVLPILT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FHLFCKGR+E AF K+PLQ+A +KDTLERA EP LNLKAYL DAYVHPVF+ G+ ++ 
Sbjct  663  IWFHLFCKGRFESAFVKFPLQDAMVKDTLERATEPNLNLKAYLHDAYVHPVFRGGELEKP  722

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVS  238
              + E+      LVPTKR SRR++   S VS
Sbjct  723  AVIDEEENNP--LVPTKRMSRRSSKYGSDVS  751



>ref|XP_009396325.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
Length=762

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 119/158 (75%), Gaps = 2/158 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP V+ RII AL+ SQ+  LGLLSTKHAA S P LI LPVLT
Sbjct  602  RHQIINVYNQEYESAAAFWPDVNRRIITALIISQLLLLGLLSTKHAAISTPLLIPLPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCK RYEPAF KYPLQEA MKDTL+  REP L++KAYL +AY HPVF   + + +
Sbjct  662  IWFHRFCKNRYEPAFVKYPLQEAIMKDTLDHVREPNLDMKAYLLNAYTHPVF--KNGETE  719

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
            D++    E E ILVPTKRQSR+ T  PSK    SSP +
Sbjct  720  DKVPGDEEFENILVPTKRQSRKGTSVPSKFGCSSSPSL  757



>ref|XP_002870239.1| hypothetical protein ARALYDRAFT_493346 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46498.1| hypothetical protein ARALYDRAFT_493346 [Arabidopsis lyrata subsp. 
lyrata]
Length=761

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 113/157 (72%), Gaps = 1/157 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQ+INVYNQ+YESA  FWP VH R++ ALV SQ+  +GLLSTKHA+ S PFL+ LP+LT
Sbjct  605  RHQVINVYNQKYESAGKFWPDVHRRVVTALVVSQLLLMGLLSTKHASKSTPFLLVLPLLT  664

Query  510  ISFHLFCKGRYEPAFTKYPL-QEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddde  334
            I FH+ CK RY+PAF  YPL QEA +KDTL+R REP  NLKA+L+DAY HP F+ G+D E
Sbjct  665  IGFHMHCKNRYQPAFVTYPLQQEAMIKDTLDRIREPNFNLKAFLRDAYAHPEFRVGEDPE  724

Query  333  ddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSP  223
             +E  E       LV TKR S RNTP PSK S    P
Sbjct  725  PEEKLESDMSPPELVATKRGSWRNTPLPSKQSCRDIP  761



>ref|XP_002440380.1| hypothetical protein SORBIDRAFT_09g030770 [Sorghum bicolor]
 gb|EES18810.1| hypothetical protein SORBIDRAFT_09g030770 [Sorghum bicolor]
Length=766

 Score =   178 bits (452),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 113/160 (71%), Gaps = 2/160 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ+YESAA FWP+VHGRII AL+ SQ+  LGL+ST     S P L+ LPVLT
Sbjct  602  RHQIINVYNQQYESAAQFWPSVHGRIITALIVSQLLLLGLMSTNDFEQSTPVLLVLPVLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              F+ +CK R+EPAF + PLQEA  KDTLERAREP  +LKAYL ++Y+HPVFK  + D+ 
Sbjct  662  FWFYKYCKNRFEPAFVRNPLQEAMKKDTLERAREPNFDLKAYLANSYLHPVFKGDEGDDR  721

Query  330  demsekl--emEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
              + +      E ++VPTKR SRR TPA SK  G  S  V
Sbjct  722  YSVVDDEGWMEEEVIVPTKRHSRRTTPAQSKHEGSDSLSV  761



>ref|XP_010473449.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010473450.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010473451.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
Length=779

 Score =   178 bits (451),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 109/148 (74%), Gaps = 4/148 (3%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VHGRII AL+ SQI  LGL+STK    S PFL+ L +LT
Sbjct  605  RHQIINVYNQEYESAAAFWPDVHGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAILT  664

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH FCKGRYE AF   PLQEA +KDTLERAREP LNLK +LQ+AY+HPVFK+ + ++D
Sbjct  665  FVFHRFCKGRYESAFVINPLQEAMIKDTLERAREPNLNLKGFLQNAYIHPVFKDEEFEDD  724

Query  330  demseklemEG---ILVPTKRQS-RRNT  259
                   + +    ++VPTKRQ  RR T
Sbjct  725  QFEGLTEDSDDEDCVVVPTKRQRPRRKT  752



>ref|XP_006654360.1| PREDICTED: uncharacterized protein C354.08c-like [Oryza brachyantha]
Length=767

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 111/155 (72%), Gaps = 2/155 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVY Q+YES A FWP V  R++ AL+ SQI  LGLLST+ A  S   LI LPVL+
Sbjct  603  RHQIINVYTQQYESGAQFWPDVQRRLVIALIVSQILLLGLLSTQEAEKSTVTLIPLPVLS  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGR+EPAF K+PLQ+A +KDTLERA +PTLNL+ YL+DAYVHPVF + D  E 
Sbjct  663  IWFHHFCKGRFEPAFIKFPLQDAMVKDTLERANDPTLNLREYLKDAYVHPVFHKNDIYEL  722

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSS  226
              + E+ +    LV TKRQSR NTP  SK +  S 
Sbjct  723  VAIDEEEKNP--LVATKRQSRMNTPVDSKFNSSSG  755



>gb|EYU46618.1| hypothetical protein MIMGU_mgv1a001779mg [Erythranthe guttata]
Length=760

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVY+Q+YES AAFWPAVH R+I  LV SQ   LGLLSTK  A + PFLIALPVLT
Sbjct  603  RHQIINVYDQKYESGAAFWPAVHRRVIIGLVISQFLLLGLLSTKRIAKATPFLIALPVLT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  355
            I FH FCKGR+E AF K+PLQ+  +KDTLERA EP LNLKAYLQD+Y+HPVF
Sbjct  663  IWFHRFCKGRFESAFVKFPLQDTMVKDTLERATEPNLNLKAYLQDSYLHPVF  714



>ref|XP_006406250.1| hypothetical protein EUTSA_v10020132mg [Eutrema salsugineum]
 gb|ESQ47703.1| hypothetical protein EUTSA_v10020132mg [Eutrema salsugineum]
Length=757

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 111/150 (74%), Gaps = 2/150 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESA +FWP VH R++ AL+ SQ+  +GLLSTK AA S P L  LPVLT
Sbjct  603  RHQIINVYNQEYESAGSFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGRY+P F  YPLQ+A +KDTLER REP LNLK +LQ+AYVHPVFK  D+  +
Sbjct  663  IGFHRFCKGRYQPVFVTYPLQDAMVKDTLERTREPNLNLKTFLQNAYVHPVFKAADNIGN  722

Query  330  demseklemEGI--LVPTKRQSRRNTPAPS  247
            + + E+ + +    LV TKR SRR+  + S
Sbjct  723  EMVVEEPQPDRTPDLVATKRGSRRHVSSGS  752



>ref|XP_011079804.1| PREDICTED: CSC1-like protein At4g02900 [Sesamum indicum]
 ref|XP_011079805.1| PREDICTED: CSC1-like protein At4g02900 [Sesamum indicum]
Length=765

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 113/157 (72%), Gaps = 4/157 (3%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVY+Q YESAAAFWP VH R++  LV SQ+  +GLLSTK  A S P L+ LPVLT
Sbjct  603  RHQIINVYDQNYESAAAFWPDVHRRVVIGLVISQLLLMGLLSTKSIAKSTPVLLILPVLT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCKGR+E AF K+PLQ+A +KDTLERA EP LNLKAYLQDAYVHPVF+  + ++ 
Sbjct  663  IWFHRFCKGRFESAFVKFPLQDAVVKDTLERATEPNLNLKAYLQDAYVHPVFRTIEIEKA  722

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPD  220
              + E+      LV TKR SR +  A +  + G +P+
Sbjct  723  AAVDEEENNP--LVETKRNSRMSKSAST--ASGITPE  755



>ref|XP_009395092.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009395094.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009395095.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
Length=768

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VHGRII AL+ SQ+  LGLLSTKHAA S P L+ LPVLT
Sbjct  603  RHQIINVYNQEYESGAAFWPDVHGRIITALIISQLLLLGLLSTKHAANSTPLLLVLPVLT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            ISFH FCK RYEPAF KYPLQEA MKDTLE A EP L+L+AYL +AYVHP+FK+ DDD+ 
Sbjct  663  ISFHRFCKNRYEPAFVKYPLQEAMMKDTLEHATEPNLDLRAYLLNAYVHPLFKDEDDDDS  722

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
                 + E E  LVPTKRQS++NTP PSK +G SSP +
Sbjct  723  FSGGGEQEYETKLVPTKRQSQKNTPVPSKYNGSSSPSL  760



>ref|XP_009147362.1| PREDICTED: CSC1-like protein At4g15430 isoform X2 [Brassica rapa]
Length=761

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 108/148 (73%), Gaps = 0/148 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQ+INVYNQ YESA  FWP VH R++ AL+ SQ+  +GLLSTK A+ S PFL+ LPVLT
Sbjct  605  RHQVINVYNQNYESAGKFWPDVHRRVVTALIVSQLLLMGLLSTKQASKSTPFLLVLPVLT  664

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH+ CK RY+PAF +Y LQEA +KDTLER REP LNLKA+ ++AY HP F+ G+D E 
Sbjct  665  IGFHMHCKCRYQPAFVRYSLQEAMIKDTLERTREPNLNLKAFFRNAYAHPEFRVGEDLEL  724

Query  330  demseklemEGILVPTKRQSRRNTPAPS  247
            +   EK      LV TKR S RNTP PS
Sbjct  725  EMAVEKPNKTPELVATKRGSWRNTPLPS  752



>ref|XP_009147329.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
 ref|XP_009147337.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
 ref|XP_009147346.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
 ref|XP_009147353.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
Length=762

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 108/148 (73%), Gaps = 0/148 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQ+INVYNQ YESA  FWP VH R++ AL+ SQ+  +GLLSTK A+ S PFL+ LPVLT
Sbjct  606  RHQVINVYNQNYESAGKFWPDVHRRVVTALIVSQLLLMGLLSTKQASKSTPFLLVLPVLT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH+ CK RY+PAF +Y LQEA +KDTLER REP LNLKA+ ++AY HP F+ G+D E 
Sbjct  666  IGFHMHCKCRYQPAFVRYSLQEAMIKDTLERTREPNLNLKAFFRNAYAHPEFRVGEDLEL  725

Query  330  demseklemEGILVPTKRQSRRNTPAPS  247
            +   EK      LV TKR S RNTP PS
Sbjct  726  EMAVEKPNKTPELVATKRGSWRNTPLPS  753



>ref|NP_001055457.1| Os05g0393800 [Oryza sativa Japonica Group]
 gb|AAT93895.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17371.1| Os05g0393800 [Oryza sativa Japonica Group]
 dbj|BAG91241.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AIU34630.1| hyperosmolality-gated Ca2+ permeable channel 1.3 [Oryza sativa]
Length=767

 Score =   176 bits (445),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ+YES A FWP V  R++ AL+ SQI  LGLLST+ A  S   L+ LPVL+
Sbjct  603  RHQIINVYNQQYESGAQFWPDVQRRLVIALIVSQILLLGLLSTQEAEKSTVALLPLPVLS  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH  CKGR+EPAF K+PLQ+A +KDTLERA +PTLNL+ YL+DAYVHPVF++ D  E 
Sbjct  663  IWFHYVCKGRFEPAFIKFPLQDAMVKDTLERANDPTLNLREYLKDAYVHPVFQKNDIYEF  722

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPD  220
              + E+ +    +V TKRQSR NTP  SK +  S  +
Sbjct  723  AGIDEEEKNP--MVATKRQSRMNTPVDSKFNSSSGTN  757



>gb|EAY97938.1| hypothetical protein OsI_19855 [Oryza sativa Indica Group]
 gb|EEE63624.1| hypothetical protein OsJ_18441 [Oryza sativa Japonica Group]
Length=783

 Score =   176 bits (445),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ+YES A FWP V  R++ AL+ SQI  LGLLST+ A  S   L+ LPVL+
Sbjct  619  RHQIINVYNQQYESGAQFWPDVQRRLVIALIVSQILLLGLLSTQEAEKSTVALLPLPVLS  678

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH  CKGR+EPAF K+PLQ+A +KDTLERA +PTLNL+ YL+DAYVHPVF++ D  E 
Sbjct  679  IWFHYVCKGRFEPAFIKFPLQDAMVKDTLERANDPTLNLREYLKDAYVHPVFQKNDIYEF  738

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPD  220
              + E+ +    +V TKRQSR NTP  SK +  S  +
Sbjct  739  AGIDEEEKNP--MVATKRQSRMNTPVDSKFNSSSGTN  773



>ref|XP_010466416.1| PREDICTED: CSC1-like protein At3g21620 isoform X2 [Camelina sativa]
Length=682

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESA AFWP VH R++ AL+ SQ+  +GLLSTK AA S P L  LPVLT
Sbjct  528  RHQIINVYNQEYESAGAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLT  587

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  355
            I FH FCKGRY+P F +YPLQ+A +KDTLER REP LNLK +LQ+AY HPVF
Sbjct  588  IGFHKFCKGRYQPVFVRYPLQDAMVKDTLERTREPNLNLKPFLQNAYAHPVF  639



>ref|XP_010488177.1| PREDICTED: CSC1-like protein At3g21620 isoform X2 [Camelina sativa]
Length=682

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESA AFWP VH R++ AL+ SQ+  +GLLSTK AA S P L  LPVLT
Sbjct  528  RHQIINVYNQEYESAGAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLT  587

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  355
            I FH FCKGRY+P F +YPLQ+A +KDTLER REP LNLK +LQ+AY HPVF
Sbjct  588  IGFHKFCKGRYQPVFVRYPLQDAMVKDTLERTREPNLNLKPFLQNAYAHPVF  639



>ref|XP_003568506.1| PREDICTED: CSC1-like protein At4g02900 [Brachypodium distachyon]
Length=767

 Score =   175 bits (444),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ+YES   FWP V  RI+ AL+ SQI  LGLLST+ A  S   L+ LPVLT
Sbjct  603  RHQIINVYNQQYESGGLFWPDVQRRIVAALIVSQILLLGLLSTQEAEKSTVSLLPLPVLT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH  CKGR+EPA+ K+PLQEA +KDTLERA +PTLNL+ YL+DAYVHPVF++ D  E 
Sbjct  663  IWFHYVCKGRFEPAYIKFPLQEAMVKDTLERANDPTLNLRDYLKDAYVHPVFQKNDLYEL  722

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPD  220
              M E+ +    LV T+RQSR NTP  SK +  S  +
Sbjct  723  VAMDEEEKNP--LVATRRQSRMNTPVESKFNSSSGTN  757



>ref|XP_006299035.1| hypothetical protein CARUB_v10015172mg [Capsella rubella]
 gb|EOA31933.1| hypothetical protein CARUB_v10015172mg [Capsella rubella]
Length=756

 Score =   175 bits (444),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESA AFWP VH R++ ALV SQ+  +GLLSTK AA S P L  LPVLT
Sbjct  603  RHQIINVYNQEYESAGAFWPDVHRRVVIALVVSQLLLMGLLSTKRAARSTPLLFILPVLT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  355
            I FH FCKGRY+P F +YPLQ+A +KDTLER REP LNLK +LQ+AY HPVF
Sbjct  663  IGFHKFCKGRYQPVFVRYPLQDAMVKDTLERIREPNLNLKPFLQNAYAHPVF  714



>ref|XP_010488175.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Camelina sativa]
 ref|XP_010488176.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Camelina sativa]
Length=757

 Score =   175 bits (443),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESA AFWP VH R++ AL+ SQ+  +GLLSTK AA S P L  LPVLT
Sbjct  603  RHQIINVYNQEYESAGAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  355
            I FH FCKGRY+P F +YPLQ+A +KDTLER REP LNLK +LQ+AY HPVF
Sbjct  663  IGFHKFCKGRYQPVFVRYPLQDAMVKDTLERTREPNLNLKPFLQNAYAHPVF  714



>ref|XP_010466415.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Camelina sativa]
Length=757

 Score =   175 bits (443),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESA AFWP VH R++ AL+ SQ+  +GLLSTK AA S P L  LPVLT
Sbjct  603  RHQIINVYNQEYESAGAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  355
            I FH FCKGRY+P F +YPLQ+A +KDTLER REP LNLK +LQ+AY HPVF
Sbjct  663  IGFHKFCKGRYQPVFVRYPLQDAMVKDTLERTREPNLNLKPFLQNAYAHPVF  714



>gb|KDO68804.1| hypothetical protein CISIN_1g0209791mg, partial [Citrus sinensis]
Length=156

 Score =   164 bits (414),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 107/155 (69%), Gaps = 5/155 (3%)
 Frame = -3

Query  681  IINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISF  502
            +INVY+Q YES AAFWP VH RII  L+ SQ+  +GLLST+ A  S P LI LPV+TI F
Sbjct  1    VINVYDQIYESGAAFWPDVHRRIIINLIISQLLLMGLLSTRKADKSTPLLILLPVITIWF  60

Query  501  HLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddem  322
            H++CKGR+EPAF  +PLQEA +KDTLERA EP LNL+ YLQDAYVHPVFK   +     +
Sbjct  61   HVYCKGRFEPAFVTFPLQEAMVKDTLERATEPNLNLRTYLQDAYVHPVFKGIQEQNPPAV  120

Query  321  seklemEGILVPTKRQ----SRRNTPAPSKVSGGS  229
             E+ +    LV TKR+    S+  + A SK   G+
Sbjct  121  EEEEDSSP-LVATKRRNWNASKNESDASSKAGSGT  154



>ref|XP_009404947.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=718

 Score =   175 bits (443),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 124/158 (78%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VH RII AL+ SQ+  LGLLSTKHA  S P L+ LPVLT
Sbjct  553  RHQIINVYNQEYESGAAFWPDVHRRIITALIISQLLLLGLLSTKHAVNSTPLLLVLPVLT  612

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCK RYEPAF K+PLQEA MKDTLE AREP L+L+AYL + YVHPVFK+G+DD+ 
Sbjct  613  IWFHRFCKNRYEPAFVKFPLQEAMMKDTLEHAREPNLDLRAYLLNTYVHPVFKDGEDDDS  672

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
                 + E E +LVPTKRQSR+NTP PSK +G SSP +
Sbjct  673  FSDDGEQECENVLVPTKRQSRKNTPVPSKYNGSSSPSL  710



>ref|XP_009404922.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009404929.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009404937.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=768

 Score =   175 bits (443),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 124/158 (78%), Gaps = 0/158 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VH RII AL+ SQ+  LGLLSTKHA  S P L+ LPVLT
Sbjct  603  RHQIINVYNQEYESGAAFWPDVHRRIITALIISQLLLLGLLSTKHAVNSTPLLLVLPVLT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FCK RYEPAF K+PLQEA MKDTLE AREP L+L+AYL + YVHPVFK+G+DD+ 
Sbjct  663  IWFHRFCKNRYEPAFVKFPLQEAMMKDTLEHAREPNLDLRAYLLNTYVHPVFKDGEDDDS  722

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  217
                 + E E +LVPTKRQSR+NTP PSK +G SSP +
Sbjct  723  FSDDGEQECENVLVPTKRQSRKNTPVPSKYNGSSSPSL  760



>ref|NP_188799.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 sp|Q9LVE4.1|CSCL4_ARATH RecName: Full=CSC1-like protein At3g21620 [Arabidopsis thaliana]
 dbj|BAB02357.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76531.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AIU34617.1| hyperosmolality-gated Ca2+ permeable channel 1.5 [Arabidopsis 
thaliana]
Length=756

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 107/144 (74%), Gaps = 2/144 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VH R++ AL+ SQ+  +GLLSTK AA S P L  LPVLT
Sbjct  603  RHQIINVYNQEYESAAAFWPDVHRRVVIALIVSQLLLMGLLSTKKAARSTPLLFILPVLT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FC+GRY+P F  YPLQ+A +KDTLER REP LNLK +LQ+AY HPVFK  D+  +
Sbjct  663  IGFHKFCQGRYQPIFVTYPLQDAMVKDTLERMREPNLNLKTFLQNAYAHPVFKAADNLAN  722

Query  330  demseklemEGI--LVPTKRQSRR  265
            + + E+   +    LV TKR SRR
Sbjct  723  EMVVEEPAPDKTPDLVATKRGSRR  746



>dbj|BAD94445.1| hypothetical protein [Arabidopsis thaliana]
Length=756

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 107/144 (74%), Gaps = 2/144 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESAAAFWP VH R++ AL+ SQ+  +GLLSTK AA S P L  LPVLT
Sbjct  603  RHQIINVYNQEYESAAAFWPDVHRRVVIALIVSQLLLMGLLSTKKAARSTPLLFILPVLT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FC+GRY+P F  YPLQ+A +KDTLER REP LNLK +LQ+AY HPVFK  D+  +
Sbjct  663  IGFHKFCQGRYQPIFVTYPLQDAMVKDTLERMREPNLNLKTFLQNAYAHPVFKAADNLAN  722

Query  330  demseklemEGI--LVPTKRQSRR  265
            + + E+   +    LV TKR SRR
Sbjct  723  EMVVEEPAPDKTPDLVATKRGSRR  746



>ref|XP_009393118.1| PREDICTED: CSC1-like protein At4g02900 [Musa acuminata subsp. 
malaccensis]
Length=758

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 109/149 (73%), Gaps = 4/149 (3%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVY QEYESAAAFWP V  R+I A++ SQ+  +GL+STKH + + P L+ LP+LT
Sbjct  603  RHQIINVYTQEYESAAAFWPDVIRRVIIAMIISQLLLMGLMSTKHGSLTVPILV-LPLLT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH++CK R+EPAF K+PLQ+A +KDTLERA EP LNL+AYLQDAYVHP F     ++ 
Sbjct  662  IWFHIYCKSRFEPAFIKFPLQDAMVKDTLERATEPHLNLRAYLQDAYVHPDF---HSEDV  718

Query  330  demseklemEGILVPTKRQSRRNTPAPSK  244
            +      E    LVPT R SRR+TP  SK
Sbjct  719  EHPMIIEEENNTLVPTIRTSRRSTPGESK  747



>ref|XP_002885454.1| hypothetical protein ARALYDRAFT_342312 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61713.1| hypothetical protein ARALYDRAFT_342312 [Arabidopsis lyrata subsp. 
lyrata]
Length=756

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 108/144 (75%), Gaps = 2/144 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQ+INVYNQEYESAAAFWP VH R++ AL+ SQ+  +GLLSTK AA S P L  LPVLT
Sbjct  603  RHQVINVYNQEYESAAAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH FC+GRY+P F +YPLQ+A +KDTLER REP LNLK +LQ+AY HPVFK  D+  +
Sbjct  663  IGFHKFCQGRYQPIFVRYPLQDAMVKDTLERMREPNLNLKTFLQNAYAHPVFKAADNLAN  722

Query  330  demsek--lemEGILVPTKRQSRR  265
            + + E+   +    LV TKR SRR
Sbjct  723  EMVVEEPHPDRTPDLVATKRGSRR  746



>ref|XP_006285697.1| hypothetical protein CARUB_v10007167mg [Capsella rubella]
 gb|EOA18595.1| hypothetical protein CARUB_v10007167mg [Capsella rubella]
Length=763

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 114/154 (74%), Gaps = 3/154 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQ+INVYNQ+YESA  FWP VH R++ AL+ SQ+  +GLLSTKHA+ S P L+ LP+LT
Sbjct  605  RHQVINVYNQKYESAGKFWPDVHRRVVTALIVSQLLLMGLLSTKHASKSTPLLLVLPMLT  664

Query  510  ISFHLFCKGRYEPAFTKYPL-QEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddde  334
            I FH+ CK RY+PAF  YPL QEA +KDTLER REP LNLKA+L+DAY HP F+ G+D +
Sbjct  665  IGFHIHCKCRYQPAFVTYPLQQEAMIKDTLERTREPNLNLKAFLRDAYAHPEFRVGEDID  724

Query  333  ddemseklemEGI--LVPTKRQSRRNTPAPSKVS  238
            ++    K + +    LV T+R S RNTP PSK S
Sbjct  725  EEMGMTKAKSDMSPELVATRRGSWRNTPLPSKNS  758



>ref|XP_010231849.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Brachypodium distachyon]
Length=703

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 110/161 (68%), Gaps = 1/161 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ YES A FWP+VH RII AL+ SQ+  LGLLSTK    S P LI LP+LT
Sbjct  536  RHQIINVYNQRYESGAQFWPSVHLRIIVALIVSQLLLLGLLSTKDFEESTPALIVLPILT  595

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH +CK RYEPAF + PLQEA  KDTLERAREP  +LKAYL DAY+HPVFK   D  D
Sbjct  596  FWFHRYCKNRYEPAFVRNPLQEAMRKDTLERAREPNFDLKAYLADAYLHPVFKSDLDGVD  655

Query  330  demsekl-emEGILVPTKRQSRRNTPAPSKVSGGSSPDVIL  211
                      E ++V TKRQSRR TP  SK  G SS  ++L
Sbjct  656  KFYVADDPGAEEVIVATKRQSRRTTPVQSKHDGSSSDRLLL  696



>ref|XP_003569103.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Brachypodium 
distachyon]
Length=768

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 110/161 (68%), Gaps = 1/161 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ YES A FWP+VH RII AL+ SQ+  LGLLSTK    S P LI LP+LT
Sbjct  601  RHQIINVYNQRYESGAQFWPSVHLRIIVALIVSQLLLLGLLSTKDFEESTPALIVLPILT  660

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH +CK RYEPAF + PLQEA  KDTLERAREP  +LKAYL DAY+HPVFK   D  D
Sbjct  661  FWFHRYCKNRYEPAFVRNPLQEAMRKDTLERAREPNFDLKAYLADAYLHPVFKSDLDGVD  720

Query  330  demsekl-emEGILVPTKRQSRRNTPAPSKVSGGSSPDVIL  211
                      E ++V TKRQSRR TP  SK  G SS  ++L
Sbjct  721  KFYVADDPGAEEVIVATKRQSRRTTPVQSKHDGSSSDRLLL  761



>ref|XP_006854105.1| hypothetical protein AMTR_s00048p00143150 [Amborella trichopoda]
 gb|ERN15572.1| hypothetical protein AMTR_s00048p00143150 [Amborella trichopoda]
Length=760

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VHGRII +L+ SQ   LGLLSTK AA S P LI LPVLT
Sbjct  605  RHQIINVYNQEYESVAAFWPHVHGRIIASLLISQFLLLGLLSTKKAADSTPLLIVLPVLT  664

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  355
            I FH +CK R+EPAF KYPL+EA  +DT+ERA EP LNL AYL DAY+HP+F
Sbjct  665  IWFHKYCKSRFEPAFRKYPLEEAMARDTMERAEEPNLNLMAYLADAYLHPIF  716



>ref|XP_008373502.1| PREDICTED: uncharacterized protein RSN1 [Malus domestica]
Length=805

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 114/163 (70%), Gaps = 3/163 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ YESAAAFWP VH RI+ +L+ SQ+  +GLLSTK AA S P L+ LP+LT
Sbjct  604  RHQIINVYNQRYESAAAFWPQVHSRIVASLLISQLLLMGLLSTKKAANSTPLLVVLPILT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            +SFH FCK R+EPAF KYPL EA  KDT+ER  EP LN+K+YL DAY+HP+F+  +++  
Sbjct  664  LSFHKFCKYRFEPAFRKYPLXEAMAKDTMERTAEPDLNMKSYLADAYLHPIFRSFEEEPP  723

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDVILEKE  202
             E  ++L    +    K+Q+R  TP  SK+S  S P  +   E
Sbjct  724  FEEEQELVEVRV---DKQQTRIATPITSKLSSHSPPHYVHHTE  763



>ref|XP_010110412.1| Uncharacterized protein RSN1 [Morus notabilis]
 gb|EXC26244.1| Uncharacterized protein RSN1 [Morus notabilis]
Length=365

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ+YESAAAFWP VH RII +L  SQ+  +GLLSTK AA S P L+ LP+LT
Sbjct  161  RHQIINVYNQQYESAAAFWPHVHTRIIASLFISQLLLMGLLSTKKAANSTPLLVVLPILT  220

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  355
            I+FH +CK R+EPAF KYPL+EA  KDT ERA EP LNLKAYL DAY+HP+F
Sbjct  221  IAFHKYCKHRFEPAFRKYPLEEAMAKDTAERAAEPDLNLKAYLADAYLHPIF  272



>ref|XP_010510410.1| PREDICTED: CSC1-like protein At3g21620 [Camelina sativa]
Length=757

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYESA AFWP VH R++ AL+ SQ+  +GLLSTK AA S P L  LPVLT
Sbjct  603  RHQIINVYNQEYESAGAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  355
            I FH FCKGR++P F +YPLQ+A +KDTLER REP LNLK +LQ+AY HPVF
Sbjct  663  IGFHKFCKGRHQPVFVRYPLQDAMVKDTLERTREPNLNLKPFLQNAYAHPVF  714



>gb|EMS50375.1| Transmembrane protein 63B [Triticum urartu]
Length=749

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ YES A FWP VH RII AL+ SQ+  LGLLSTK    + P L+ALPVLT
Sbjct  586  RHQIINVYNQRYESGAQFWPNVHLRIITALIVSQLLFLGLLSTKGLEEATPALLALPVLT  645

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH +CK RYEPAF + PLQ+   KDTLERARE   +LKAYL DAY+HPVF + ++   
Sbjct  646  IWFHKYCKHRYEPAFVRNPLQDVMRKDTLERARERNFDLKAYLADAYLHPVF-KSNEAGK  704

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDVILE  208
              +++    E ++VPTKRQSRR TP  S+  GGS    ++E
Sbjct  705  FYVADDPGAEAVIVPTKRQSRRITPVQSE-DGGSGRLNLME  744



>ref|XP_002441130.1| hypothetical protein SORBIDRAFT_09g021010 [Sorghum bicolor]
 gb|EES19560.1| hypothetical protein SORBIDRAFT_09g021010 [Sorghum bicolor]
Length=768

 Score =   172 bits (437),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 115/158 (73%), Gaps = 5/158 (3%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVY+Q YES A FWP VH R+I AL+ SQI  LGLLST+ A  S   L+ LPVL+
Sbjct  603  RHQIINVYSQRYESGAQFWPDVHMRLIIALIVSQILLLGLLSTQEAEKSTVALLPLPVLS  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH  CKGR+EPAF K+PLQ+A +KDTLE AR+PTLNL+ YL+ AYVHPVF++ D  + 
Sbjct  663  IWFHHVCKGRFEPAFVKFPLQDAMVKDTLELARDPTLNLREYLKGAYVHPVFQKNDIYKV  722

Query  330  demseklemEGILVPTKRQSRRNTPAPSKV---SGGSS  226
              M E+ +    +V TKRQSR NTP  SK+   SGG++
Sbjct  723  VAMDEEEKNP--IVVTKRQSRMNTPGGSKLNSSSGGTN  758



>dbj|BAJ96091.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=768

 Score =   172 bits (436),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 111/157 (71%), Gaps = 2/157 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ+YES A FWP VHGRI+ ALV SQ+  +GLLST+ A  S   L+ LPVLT
Sbjct  604  RHQIINVYNQQYESGAQFWPDVHGRIVTALVISQVLLIGLLSTQEAEQSTVALLPLPVLT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I F   CKGR+EPA+ K+PLQEA +KDTL+RA +P LNL+ YL+DAYVHPVF+ GD  E 
Sbjct  664  IWFRYVCKGRFEPAYIKFPLQEAMVKDTLQRANDPMLNLREYLKDAYVHPVFRSGDVYEL  723

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPD  220
              M E+      LV TKR+SR  TP  SK +  S  +
Sbjct  724  LAMDEEENPH--LVATKRRSRMTTPVDSKFNSSSGTN  758



>ref|XP_004962175.1| PREDICTED: uncharacterized protein RSN1-like [Setaria italica]
Length=767

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 111/157 (71%), Gaps = 2/157 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ+YES A FWP VH R+I AL+ SQI  LGLLST+ A  S   L+ LPVL+
Sbjct  603  RHQIINVYNQQYESGAQFWPDVHMRLIIALIVSQILLLGLLSTQEAEKSTVALLPLPVLS  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH  CKGR+EPAF K+PLQ+A +KDTLERA +PTLNL+ YL+ AYVHPVF++ D  + 
Sbjct  663  IWFHYVCKGRFEPAFVKFPLQDAMVKDTLERAHDPTLNLRDYLKGAYVHPVFQKNDIYQL  722

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPD  220
              + E+ +    LV TKRQ R  TP  SK +  S  +
Sbjct  723  VAIDEEEKNP--LVVTKRQPRMTTPGGSKFNSSSGTN  757



>ref|XP_008451390.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X1 [Cucumis melo]
 ref|XP_008451391.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X1 [Cucumis melo]
Length=761

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 105/149 (70%), Gaps = 2/149 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ+YES AAFWP VH R+I  L+ +Q+  +GL S + A  S+ FL+ALP+LT
Sbjct  602  RHQIINVYNQKYESGAAFWPHVHRRVIIGLILAQLLLMGLFSMREAEKSSLFLVALPILT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I  H FCKGR+E AF K+PLQ+A +KDTLE+A EP L+LKAYL+DAYVHPVF       +
Sbjct  662  IWVHKFCKGRFESAFVKFPLQDAMVKDTLEKATEPNLDLKAYLKDAYVHPVF--KSSSIE  719

Query  330  demseklemEGILVPTKRQSRRNTPAPSK  244
              +    E    LVPTKR S R +  PS+
Sbjct  720  QTLLIDDEENNTLVPTKRTSHRGSKLPSE  748



>ref|XP_008451392.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X2 [Cucumis melo]
Length=759

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 105/149 (70%), Gaps = 2/149 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ+YES AAFWP VH R+I  L+ +Q+  +GL S + A  S+ FL+ALP+LT
Sbjct  602  RHQIINVYNQKYESGAAFWPHVHRRVIIGLILAQLLLMGLFSMREAEKSSLFLVALPILT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I  H FCKGR+E AF K+PLQ+A +KDTLE+A EP L+LKAYL+DAYVHPVF       +
Sbjct  662  IWVHKFCKGRFESAFVKFPLQDAMVKDTLEKATEPNLDLKAYLKDAYVHPVF--KSSSIE  719

Query  330  demseklemEGILVPTKRQSRRNTPAPSK  244
              +    E    LVPTKR S R +  PS+
Sbjct  720  QTLLIDDEENNTLVPTKRTSHRGSKLPSE  748



>ref|XP_008238126.1| PREDICTED: uncharacterized protein RSN1 [Prunus mume]
Length=799

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 112/164 (68%), Gaps = 10/164 (6%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ YESAAAFWP VH RII +LV SQ+  +GLLSTK AA S PFL+ LP+LT
Sbjct  604  RHQIINVYNQHYESAAAFWPQVHSRIIASLVISQLLLMGLLSTKKAANSTPFLVVLPILT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            +SFH +CK R+EPAF +YPL+EA  KDT+ER  EP LNLK+YL DAY+HP+F+  ++ E 
Sbjct  664  LSFHKYCKYRFEPAFREYPLEEAMAKDTMERTAEPDLNLKSYLADAYLHPIFRSFEEQEL  723

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDVILEKEP  199
             E+             K Q+   TP  S++S  S P  + +  P
Sbjct  724  VEVRI----------DKHQTHAATPITSELSSPSPPHYVHQTPP  757



>ref|XP_002973564.1| hypothetical protein SELMODRAFT_442177 [Selaginella moellendorffii]
 gb|EFJ25224.1| hypothetical protein SELMODRAFT_442177 [Selaginella moellendorffii]
Length=759

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 108/156 (69%), Gaps = 3/156 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQ+INVY+ EYESAAAFWP +H RII +L+  QI+  G+ + K AA S P LI LP++T
Sbjct  604  RHQVINVYDPEYESAAAFWPHIHNRIIVSLLVEQITLFGVFAGKRAAASTPLLIGLPIMT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH +CK R+EPAF KYPL+EA  KD ++RA  P  N+K YLQ++Y+HPVF   D +E+
Sbjct  664  IVFHYYCKNRFEPAFRKYPLEEAMSKDIVDRATHPNWNIKTYLQNSYMHPVF--KDSEEE  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSP  223
             +          LVPTKR SR NTPAPS  +G  SP
Sbjct  722  MDEEGFDAERSTLVPTKRSSRSNTPAPS-ANGEESP  756



>ref|XP_010664612.1| PREDICTED: CSC1-like protein At1g32090 isoform X2 [Vitis vinifera]
Length=624

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQ+INVYNQ+YES AAFWP VH RII +L+ SQ+  +GLLSTK AA S P LIALP+LT
Sbjct  456  RHQVINVYNQQYESGAAFWPHVHSRIIASLLISQLLLMGLLSTKKAANSTPLLIALPILT  515

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  355
            ++FH +CK R+EPAF KYPL+EA  KDT+ER  EP LN+KAYL DAY+HP+F
Sbjct  516  LTFHKYCKNRFEPAFRKYPLEEAMAKDTMERTTEPNLNIKAYLADAYLHPIF  567



>ref|XP_006444131.1| hypothetical protein CICLE_v10024532mg [Citrus clementina]
 ref|XP_006479761.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Citrus sinensis]
 gb|ESR57371.1| hypothetical protein CICLE_v10024532mg [Citrus clementina]
Length=760

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQ+INVY+Q YES AAFWP VH RII  L+ SQ+  +GLLST+ A  S P LI LPV+T
Sbjct  602  RHQVINVYDQIYESGAAFWPDVHRRIIINLIISQLLLMGLLSTRKADKSTPLLILLPVIT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  355
            I FH++CKGR+EPAF  +PLQEA +KDTLERA EP LNL+ YLQDAYVHPVF
Sbjct  662  IWFHVYCKGRFEPAFVTFPLQEAMVKDTLERATEPNLNLRTYLQDAYVHPVF  713



>ref|XP_006479762.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Citrus sinensis]
Length=760

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQ+INVY+Q YES AAFWP VH RII  L+ SQ+  +GLLST+ A  S P LI LPV+T
Sbjct  602  RHQVINVYDQIYESGAAFWPDVHRRIIINLIISQLLLMGLLSTRKADKSTPLLILLPVIT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  355
            I FH++CKGR+EPAF  +PLQEA +KDTLERA EP LNL+ YLQDAYVHPVF
Sbjct  662  IWFHVYCKGRFEPAFVTFPLQEAMVKDTLERATEPNLNLRTYLQDAYVHPVF  713



>ref|XP_002886475.1| F24O1.4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62734.1| F24O1.4 [Arabidopsis lyrata subsp. lyrata]
Length=778

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVY+Q+YESAAAFWP VHGRII AL+ SQI  LGL+STK    S PFL+ L ++T
Sbjct  605  RHQIINVYDQKYESAAAFWPDVHGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAIVT  664

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  355
              FH FCKGRYE AF   PLQEA +KDTLERA+EP LNLK +LQ+AY+HPVF
Sbjct  665  FGFHRFCKGRYESAFVINPLQEAMIKDTLERAKEPNLNLKGFLQNAYIHPVF  716



>ref|XP_010326353.1| PREDICTED: CSC1-like protein At4g02900 [Solanum lycopersicum]
Length=751

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 114/149 (77%), Gaps = 3/149 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVY+Q+YES AAFWP VH RI+  LV SQ+  LGLLSTK+ + S P +IALPVLT
Sbjct  603  RHQIINVYDQKYESGAAFWPDVHRRILTGLVISQLLLLGLLSTKNISKSTPVMIALPVLT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH+FCKGRYE AF K+PLQ+A +KDTLERA EPTLNLKAYL+ AYVHPVFK  + D  
Sbjct  663  IWFHIFCKGRYESAFVKFPLQDAMVKDTLERATEPTLNLKAYLKTAYVHPVFKGVELDRP  722

Query  330  demseklemEGILVPTKRQSRRNTPAPSK  244
              + ++      LVPTKR SRRN+ + S+
Sbjct  723  SAVDDEENNP--LVPTKR-SRRNSKSHSE  748



>ref|XP_004293316.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=734

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQI+NVY+QEYES AAFWP VHGRI+ AL+ SQ+  LGLLSTK AA + PFL+ LPV T
Sbjct  607  RHQIVNVYSQEYESGAAFWPDVHGRIVCALIISQLILLGLLSTKRAALATPFLLVLPVST  666

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  355
            I F+ +C  R+EPAF +YPLQEAKMKD LE AR+P LN++ YLQ AYVHPVF
Sbjct  667  IVFYKYCADRFEPAFVRYPLQEAKMKDDLEHARDPDLNVRDYLQSAYVHPVF  718



>ref|XP_002273732.1| PREDICTED: CSC1-like protein At1g32090 isoform X1 [Vitis vinifera]
 emb|CBI23272.3| unnamed protein product [Vitis vinifera]
Length=772

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQ+INVYNQ+YES AAFWP VH RII +L+ SQ+  +GLLSTK AA S P LIALP+LT
Sbjct  604  RHQVINVYNQQYESGAAFWPHVHSRIIASLLISQLLLMGLLSTKKAANSTPLLIALPILT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  355
            ++FH +CK R+EPAF KYPL+EA  KDT+ER  EP LN+KAYL DAY+HP+F
Sbjct  664  LTFHKYCKNRFEPAFRKYPLEEAMAKDTMERTTEPNLNIKAYLADAYLHPIF  715



>ref|XP_010261636.1| PREDICTED: CSC1-like protein At1g32090 [Nelumbo nucifera]
Length=780

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQEYES AAFWP VH RII +L+ S +  +GLLSTK AA S P L+ LP+LT
Sbjct  604  RHQIINVYNQEYESVAAFWPHVHSRIIASLLISHLLLMGLLSTKXAANSTPLLVVLPILT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  355
            + FH +CK R+EPAF KYPL+EA  KDT+ERA EP LNLKAYL DAY+HP+F
Sbjct  664  LWFHKYCKSRFEPAFRKYPLEEAMAKDTMERASEPNLNLKAYLADAYLHPIF  715



>ref|XP_006391905.1| hypothetical protein EUTSA_v10023297mg [Eutrema salsugineum]
 gb|ESQ29191.1| hypothetical protein EUTSA_v10023297mg [Eutrema salsugineum]
Length=766

 Score =   169 bits (429),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 109/149 (73%), Gaps = 3/149 (2%)
 Frame = -3

Query  666  NQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCK  487
            +QEYESAAA+WP VHGRII AL+ SQI  +GL+S+K  A S PFL+ LP+LTI FH FCK
Sbjct  604  HQEYESAAAYWPDVHGRIISALIISQILLIGLMSSKGKAQSTPFLVVLPILTIGFHRFCK  663

Query  486  GRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemsekle  307
            GRYE AF   PLQEA +KDTLERA+EP LNLK +LQ+AY+HPVFK+ + ++D       +
Sbjct  664  GRYESAFVINPLQEAMIKDTLERAKEPNLNLKVFLQNAYIHPVFKDEEYEDDRFEESTED  723

Query  306  mEG---ILVPTKRQSRRNTPAPSKVSGGS  229
             +    ++V TKR+SRR T A +   GGS
Sbjct  724  SDNENCVVVQTKRRSRRTTEASNNAIGGS  752



>ref|XP_002975592.1| hypothetical protein SELMODRAFT_150725 [Selaginella moellendorffii]
 gb|EFJ23221.1| hypothetical protein SELMODRAFT_150725 [Selaginella moellendorffii]
Length=759

 Score =   169 bits (428),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 108/156 (69%), Gaps = 3/156 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQ+INVY+ EYESAAAFWP +H RII +L+  QI+  G+ + K AA S P LI LP++T
Sbjct  604  RHQVINVYDPEYESAAAFWPHIHNRIIVSLLVEQITLFGVFAGKRAAASTPLLIGLPIMT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH +CK R+EPAF KYPL+EA  KD ++RA  P  N+K YLQ++Y+HPVF   D +E+
Sbjct  664  IVFHYYCKNRFEPAFRKYPLEEAMSKDIVDRATHPNWNIKTYLQNSYMHPVF--KDSEEE  721

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSP  223
             +          LVPTK+ SR NTPAPS  +G  SP
Sbjct  722  MDEEGFDAERSTLVPTKKSSRSNTPAPS-ANGEESP  756



>ref|XP_004960982.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Setaria 
italica]
Length=768

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 113/165 (68%), Gaps = 3/165 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ+YES A FWP+VHGRII AL+ SQ+  LGLLSTK    + P L+ LPVLT
Sbjct  603  RHQIINVYNQQYESGAQFWPSVHGRIITALIVSQLLLLGLLSTKGLEEATPVLLVLPVLT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              F  +CK RYEPAF + PLQEA  KDTLERAREP  +LKAYL ++Y+HPVFK  D D+D
Sbjct  663  FWFFKYCKHRYEPAFVRNPLQEAMRKDTLERAREPNFDLKAYLANSYLHPVFKGTDHDDD  722

Query  330  demsekl---emEGILVPTKRQSRRNTPAPSKVSGGSSPDVILEK  205
               +        E +LVPTKR SRR TPA SK  G      + EK
Sbjct  723  RYSTVDDDGWMEEEVLVPTKRHSRRTTPAQSKYDGSDGLSSVPEK  767



>ref|XP_009373514.1| PREDICTED: CSC1-like protein At1g32090 [Pyrus x bretschneideri]
 ref|XP_009373515.1| PREDICTED: CSC1-like protein At1g32090 [Pyrus x bretschneideri]
 ref|XP_009373516.1| PREDICTED: CSC1-like protein At1g32090 [Pyrus x bretschneideri]
Length=805

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ YESAAAFWP VH RI+ +L+ SQ+  +GLLSTK AA S P L+ LP+LT
Sbjct  604  RHQIINVYNQRYESAAAFWPQVHSRIVASLLISQLLLMGLLSTKKAANSTPLLVVLPILT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  355
            +SFH FCK R+EPAF KYPL+EA  KDT+ER  EP LN+K+YL DAY+HP+F
Sbjct  664  LSFHKFCKYRFEPAFRKYPLEEAMAKDTMERTAEPDLNMKSYLADAYLHPIF  715



>ref|XP_007210357.1| hypothetical protein PRUPE_ppa001580mg [Prunus persica]
 gb|EMJ11556.1| hypothetical protein PRUPE_ppa001580mg [Prunus persica]
Length=799

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 111/164 (68%), Gaps = 10/164 (6%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ YESAAAFWP VH RII +LV SQ+  +GLLSTK AA S PFL+ LP+LT
Sbjct  604  RHQIINVYNQHYESAAAFWPQVHSRIIASLVISQLLLMGLLSTKKAANSTPFLVVLPILT  663

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            +SFH +CK R+EPAF +YPL+EA  KD +ER  EP LNLK+YL DAY+HP+F+  ++ E 
Sbjct  664  LSFHKYCKYRFEPAFREYPLEEAMAKDAMERTAEPDLNLKSYLADAYLHPIFRSFEEQEL  723

Query  330  demseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDVILEKEP  199
             E+             K Q+   TP  S++S  S P  + +  P
Sbjct  724  VEVRI----------DKHQTHAATPITSELSSPSPPHYVHQTPP  757



>ref|XP_002271834.1| PREDICTED: CSC1-like protein At4g02900 [Vitis vinifera]
Length=756

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVY+Q+YES AAFWP+VH R+I  L+ SQ+  +GLL+TK  + S PFLI LPVLT
Sbjct  603  RHQIINVYDQKYESGAAFWPSVHQRVIIGLMISQLLLMGLLNTKDFSKSTPFLIVLPVLT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  355
              FH FC GR+E AF ++PLQEA +KDTLERA EP LNLK YLQDAY+HPVF
Sbjct  663  FWFHRFCNGRFESAFVRFPLQEAMVKDTLERATEPNLNLKNYLQDAYIHPVF  714



>emb|CBI32349.3| unnamed protein product [Vitis vinifera]
Length=766

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVY+Q+YES AAFWP+VH R+I  L+ SQ+  +GLL+TK  + S PFLI LPVLT
Sbjct  613  RHQIINVYDQKYESGAAFWPSVHQRVIIGLMISQLLLMGLLNTKDFSKSTPFLIVLPVLT  672

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  355
              FH FC GR+E AF ++PLQEA +KDTLERA EP LNLK YLQDAY+HPVF
Sbjct  673  FWFHRFCNGRFESAFVRFPLQEAMVKDTLERATEPNLNLKNYLQDAYIHPVF  724



>gb|AFW78070.1| hypothetical protein ZEAMMB73_829601 [Zea mays]
Length=748

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 107/148 (72%), Gaps = 2/148 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVY Q YES A FWP VH R+I AL+ SQI  LGLLST+ A  S   L+ LPVL+
Sbjct  603  RHQIINVYTQHYESGAQFWPDVHMRLIIALIVSQILLLGLLSTQEAEKSTVALLPLPVLS  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH  CKGR+EPAF K+PLQ+A +KDTLERA +PTLNL+ YL+ AYVHPVF++ D  + 
Sbjct  663  IWFHYVCKGRFEPAFVKFPLQDAMVKDTLERAHDPTLNLREYLKGAYVHPVFQKNDIYKV  722

Query  330  demseklemEGILVPTKRQSRRNTPAPS  247
              + E+ +    +V TKRQSR N PA S
Sbjct  723  IAVDEEEKNP--MVVTKRQSRMNAPAGS  748



>ref|XP_006355875.1| PREDICTED: uncharacterized protein C354.08c-like [Solanum tuberosum]
Length=751

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVY+Q+YES A+FWP VH RI+  LV SQ+  LGLLSTK+ + S P +IALPVLT
Sbjct  603  RHQIINVYDQKYESGASFWPDVHRRILTGLVISQLLLLGLLSTKNISKSTPVMIALPVLT  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  355
            I FH+FCKGRYE AF K+PLQ+A +KDTLERA EPTLNLKAYL+DAYVHPVF
Sbjct  663  IWFHIFCKGRYESAFVKFPLQDAMVKDTLERATEPTLNLKAYLKDAYVHPVF  714



>emb|CDY32032.1| BnaA03g60360D [Brassica napus]
Length=796

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 107/144 (74%), Gaps = 3/144 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ+YESAAA+WP VHGRII AL+ SQ+  +GL+STK  A S PFL+ LP+LT
Sbjct  606  RHQIINVYNQKYESAAAYWPDVHGRIISALIISQLLLIGLMSTKGKAQSTPFLVVLPILT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH FCK RYE  F   PLQEA +KD++ERAREP LNLK +L++AY+HPVFK+ + ++D
Sbjct  666  FCFHRFCKDRYESVFVINPLQEAMIKDSMERAREPNLNLKRFLKNAYIHPVFKDKEYEDD  725

Query  330  demseklemEG---ILVPTKRQSR  268
                   + +    ++VPTK QS+
Sbjct  726  LHEELIEDSDDENCVVVPTKHQSQ  749



>ref|XP_008649660.1| PREDICTED: LOW QUALITY PROTEIN: calcium permeable stress-gated 
cation channel 1-like [Zea mays]
Length=768

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 106/146 (73%), Gaps = 2/146 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVY Q YES A FWP VH R+I AL+ SQI  LGLLST+ A  S   L+ LPVL+
Sbjct  603  RHQIINVYTQHYESGAQFWPDVHMRLIIALIVSQILLLGLLSTQEAEKSTVALLPLPVLS  662

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I FH  CKGR+EPAF K+PLQ+A +KDTLERA +PTLNL+ YL+ AYVHPVF++ D  + 
Sbjct  663  IWFHYVCKGRFEPAFVKFPLQDAMVKDTLERAHDPTLNLREYLKGAYVHPVFQKNDIYKV  722

Query  330  demseklemEGILVPTKRQSRRNTPA  253
              + E+ +    +V TKRQSR N PA
Sbjct  723  IAVDEEEKNP--MVVTKRQSRMNAPA  746



>ref|XP_009123383.1| PREDICTED: CSC1-like protein At1g62320 [Brassica rapa]
Length=762

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 107/144 (74%), Gaps = 3/144 (2%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ+YESAAA+WP VHGRI+ AL+ SQ+  +GL+STK  A S PFL+ LP+LT
Sbjct  606  RHQIINVYNQKYESAAAYWPDVHGRIVSALIISQLLLIGLMSTKGKAQSTPFLVVLPILT  665

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
              FH FCK RYE  F   PLQEA +KD++ERAREP LNLK +L++AY+HPVFK+ + ++D
Sbjct  666  FCFHRFCKDRYESVFVINPLQEAMIKDSMERAREPNLNLKRFLKNAYIHPVFKDKEYEDD  725

Query  330  demseklemEG---ILVPTKRQSR  268
                   + +    ++VPTK QS+
Sbjct  726  LHEELIEDSDDENCVVVPTKHQSQ  749



>ref|XP_008451393.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X3 [Cucumis melo]
Length=745

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = -3

Query  690  RHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLT  511
            RHQIINVYNQ+YES AAFWP VH R+I  L+ +Q+  +GL S + A  S+ FL+ALP+LT
Sbjct  602  RHQIINVYNQKYESGAAFWPHVHRRVIIGLILAQLLLMGLFSMREAEKSSLFLVALPILT  661

Query  510  ISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddded  331
            I  H FCKGR+E AF K+PLQ+A +KDTLE+A EP L+LKAYL+DAYVHPVF       +
Sbjct  662  IWVHKFCKGRFESAFVKFPLQDAMVKDTLEKATEPNLDLKAYLKDAYVHPVF--KSSSIE  719

Query  330  demseklemEGILVPTKRQSRR  265
              +    E    LVPTKR S R
Sbjct  720  QTLLIDDEENNTLVPTKRTSHR  741



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520