BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF025E13

Length=709
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625446.1|  PREDICTED: sucrose synthase                        254   4e-75   Nicotiana tomentosiformis
ref|XP_009792656.1|  PREDICTED: sucrose synthase                        253   7e-75   Nicotiana sylvestris
ref|NP_001275286.1|  sucrose synthase                                   249   2e-73   Solanum tuberosum [potatoes]
ref|XP_006345244.1|  PREDICTED: uncharacterized LOC102577594            249   2e-73   Solanum tuberosum [potatoes]
emb|CAA09681.1|  sucrose synthase                                       249   2e-73   Solanum lycopersicum
ref|NP_001234655.1|  sucrose synthase                                   249   3e-73   
gb|AAA97571.1|  sucrose synthase                                        248   4e-73   Solanum tuberosum [potatoes]
sp|P10691.1|SUS1_SOLTU  RecName: Full=Sucrose synthase; AltName: ...    247   2e-72   Solanum tuberosum [potatoes]
gb|ABV02029.1|  sucrose sythase                                         246   5e-72   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_011093886.1|  PREDICTED: sucrose synthase                        245   6e-72   Sesamum indicum [beniseed]
ref|XP_009589756.1|  PREDICTED: sucrose synthase                        244   1e-71   Nicotiana tomentosiformis
gb|AHL84158.1|  sucrose synthase                                        244   1e-71   Nicotiana tabacum [American tobacco]
ref|XP_006353766.1|  PREDICTED: sucrose synthase 2 isoform X2           244   1e-71   
ref|NP_001274911.1|  sucrose synthase 2                                 244   2e-71   Solanum tuberosum [potatoes]
sp|P49039.1|SUS2_SOLTU  RecName: Full=Sucrose synthase; AltName: ...    244   2e-71   Solanum tuberosum [potatoes]
ref|XP_010323602.1|  PREDICTED: sucrose synthase isoform X1             244   2e-71   
ref|NP_001234804.1|  sucrose synthase                                   243   3e-71   
ref|XP_009760458.1|  PREDICTED: sucrose synthase                        243   5e-71   Nicotiana sylvestris
ref|XP_011078145.1|  PREDICTED: sucrose synthase                        243   7e-71   
sp|P49035.1|SUS1_DAUCA  RecName: Full=Sucrose synthase isoform 1;...    241   3e-70   Daucus carota [carrots]
emb|CAI56307.1|  sucrose synthase                                       239   1e-69   Coffea canephora [robusta coffee]
emb|CAJ32596.1|  sucrose synthase                                       239   1e-69   Coffea arabica [arabica coffee]
gb|ABI17891.1|  sucrose synthase                                        237   5e-69   Coffea canephora [robusta coffee]
sp|O49845.1|SUS2_DAUCA  RecName: Full=Sucrose synthase isoform 2;...    235   3e-68   Daucus carota [carrots]
gb|AHL29281.1|  sucrose synthase 1                                      233   2e-67   Camellia sinensis [black tea]
gb|AEN79500.1|  sucrose synthase 1                                      233   2e-67   Phelipanche ramosa
gb|ADA68250.1|  sucrose synthase                                        214   5e-67   Schiedea globosa
gb|ADR00484.1|  sucrose synthase                                        226   5e-67   Arachis hypogaea var. vulgaris [Spanish peanut]
dbj|BAD94975.1|  sucrose-UDP glucosyltransferase                        219   8e-67   Arabidopsis thaliana [mouse-ear cress]
dbj|BAN18500.1|  sucrose synthase                                       214   8e-67   Schiedea pentandra
gb|AFS17277.1|  sucrose synthase 1                                      231   1e-66   Amaranthus cruentus/Amaranthus hypocondriacus mixed library
dbj|BAN18504.1|  sucrose synthase                                       213   1e-66   Schiedea trinervis
gb|AGH29112.1|  sucrose synthase                                        231   2e-66   Jatropha curcas
ref|XP_004287669.1|  PREDICTED: sucrose synthase                        231   2e-66   Fragaria vesca subsp. vesca
gb|KDP33978.1|  hypothetical protein JCGZ_07549                         231   2e-66   Jatropha curcas
ref|XP_011010968.1|  PREDICTED: sucrose synthase-like isoform X1        230   2e-66   Populus euphratica
ref|XP_011010969.1|  PREDICTED: sucrose synthase-like isoform X2        230   2e-66   Populus euphratica
gb|ABD61653.1|  sucrose synthase                                        230   3e-66   Cichorium intybus [radicchio]
gb|ADW80556.1|  sucrose synthase 1                                      230   3e-66   Populus tomentosa [Chinese white poplar]
gb|ADW80565.1|  sucrose synthase 1                                      230   3e-66   Populus tomentosa [Chinese white poplar]
gb|ADW80571.1|  sucrose synthase 1                                      230   3e-66   Populus tomentosa [Chinese white poplar]
gb|ADW80558.1|  sucrose synthase 1                                      230   3e-66   Populus tomentosa [Chinese white poplar]
gb|ADW80549.1|  sucrose synthase 1                                      230   3e-66   Populus tomentosa [Chinese white poplar]
gb|ADW80546.1|  sucrose synthase 1                                      230   3e-66   Populus tomentosa [Chinese white poplar]
gb|ADW80563.1|  sucrose synthase 1                                      230   3e-66   Populus tomentosa [Chinese white poplar]
gb|ADW80543.1|  sucrose synthase 1                                      230   3e-66   Populus tomentosa [Chinese white poplar]
gb|ADW80534.1|  sucrose synthase 1                                      230   3e-66   Populus tomentosa [Chinese white poplar]
gb|ADW80555.1|  sucrose synthase 1                                      229   3e-66   Populus tomentosa [Chinese white poplar]
gb|ADW80552.1|  sucrose synthase 1                                      229   3e-66   Populus tomentosa [Chinese white poplar]
gb|ADW80551.1|  sucrose synthase 1                                      229   3e-66   Populus tomentosa [Chinese white poplar]
gb|ADW80536.1|  sucrose synthase 1                                      229   3e-66   Populus tomentosa [Chinese white poplar]
gb|ADW80559.1|  sucrose synthase 1                                      229   3e-66   Populus tomentosa [Chinese white poplar]
gb|ADW80548.1|  sucrose synthase 1                                      229   3e-66   Populus tomentosa [Chinese white poplar]
gb|ADW80550.1|  sucrose synthase 1                                      229   3e-66   Populus tomentosa [Chinese white poplar]
gb|ADW80566.1|  sucrose synthase 1                                      229   4e-66   Populus tomentosa [Chinese white poplar]
gb|ADW80541.1|  sucrose synthase 1                                      229   4e-66   Populus tomentosa [Chinese white poplar]
gb|ADW80535.1|  sucrose synthase 1                                      229   4e-66   Populus tomentosa [Chinese white poplar]
gb|ADW80560.1|  sucrose synthase 1                                      229   4e-66   Populus tomentosa [Chinese white poplar]
gb|ADV71181.1|  sucrose synthase 1                                      229   4e-66   Populus tomentosa [Chinese white poplar]
gb|ADW80562.1|  sucrose synthase 1                                      229   4e-66   Populus tomentosa [Chinese white poplar]
gb|KJB65372.1|  hypothetical protein B456_010G092300                    229   4e-66   Gossypium raimondii
gb|ADW80570.1|  sucrose synthase 1                                      229   4e-66   Populus tomentosa [Chinese white poplar]
gb|ADW80539.1|  sucrose synthase 1                                      229   4e-66   Populus tomentosa [Chinese white poplar]
gb|ADW80540.1|  sucrose synthase 1                                      229   4e-66   Populus tomentosa [Chinese white poplar]
emb|CAA67195.1|  sucrose synthase                                       213   6e-66   Pisum sativum [garden pea]
ref|XP_007012546.1|  Sucrose synthase 4 isoform 1                       229   7e-66   Theobroma cacao [chocolate]
ref|XP_007012547.1|  Sucrose synthase 4 isoform 2                       229   7e-66   
gb|ADA68252.1|  sucrose synthase                                        211   7e-66   Honckenya peploides
gb|AIJ28960.1|  sucrose synthase                                        229   8e-66   Manihot esculenta subsp. flabellifolia
ref|XP_004508035.1|  PREDICTED: sucrose synthase-like isoform X3        228   1e-65   Cicer arietinum [garbanzo]
gb|AFO84090.1|  sucrose synthase                                        228   1e-65   Actinidia chinensis
ref|XP_003551045.1|  PREDICTED: sucrose synthase-like isoform X1        228   1e-65   
gb|ADA68251.1|  sucrose synthase                                        211   1e-65   Schiedea membranacea
gb|AEE60913.1|  nodule-enhanced sucrose synthase                        228   1e-65   Cicer arietinum [garbanzo]
gb|KHN17754.1|  Sucrose synthase                                        228   1e-65   Glycine soja [wild soybean]
gb|KJB82966.1|  hypothetical protein B456_013G222400                    228   1e-65   Gossypium raimondii
gb|AEV40460.1|  sucrose synthase 1                                      228   1e-65   Gossypium arboreum [tree cotton]
gb|AHA41509.1|  sucrose synthase                                        228   2e-65   Populus deltoides
gb|KHG00606.1|  Sucrose synthase                                        228   2e-65   Gossypium arboreum [tree cotton]
dbj|BAM68521.1|  sucrose synthase                                       228   2e-65   Mangifera indica
dbj|BAM37539.1|  sucrose synthase                                       228   2e-65   Mangifera indica
ref|XP_007154543.1|  hypothetical protein PHAVU_003G127500g             228   2e-65   Phaseolus vulgaris [French bean]
gb|AAN76498.1|AF315375_1  sucrose synthase                              228   2e-65   Phaseolus vulgaris [French bean]
dbj|BAA88905.1|  sucrose synthase                                       228   2e-65   Citrus unshiu [satsuma mandarin]
ref|XP_006474580.1|  PREDICTED: sucrose synthase-like isoform X1        227   2e-65   Citrus sinensis [apfelsine]
gb|ADW80545.1|  sucrose synthase 1                                      227   2e-65   Populus tomentosa [Chinese white poplar]
dbj|BAA89049.1|  sucrose synthase                                       227   3e-65   Citrus unshiu [satsuma mandarin]
ref|XP_006452883.1|  hypothetical protein CICLE_v10007483mg             227   3e-65   Citrus clementina [clementine]
emb|CAB39757.2|  sucrose synthase                                       214   3e-65   Lotus japonicus
gb|KDO73788.1|  hypothetical protein CISIN_1g003661mg                   227   3e-65   Citrus sinensis [apfelsine]
gb|AEV40463.1|  sucrose synthase 4                                      227   3e-65   Gossypium arboreum [tree cotton]
gb|AEQ94149.1|  sucrose synthase1                                       213   4e-65   Elaeis guineensis
gb|AEV40464.1|  sucrose synthase 5                                      226   6e-65   Gossypium arboreum [tree cotton]
gb|AEF56625.1|  sucrose synthase                                        226   6e-65   Arachis hypogaea var. vulgaris [Spanish peanut]
gb|ADR81996.1|  sucrose synthase 1                                      226   1e-64   Populus trichocarpa [western balsam poplar]
ref|XP_002324136.2|  sucrose synthase family protein                    226   1e-64   
dbj|BAM68527.1|  sucrose synthase                                       225   1e-64   Mangifera indica
dbj|BAM68520.1|  sucrose synthase                                       225   1e-64   Mangifera indica
gb|AEN71067.1|  sucrose synthase Sus1                                   225   2e-64   Gossypium tomentosum
gb|ADY68848.1|  sucrose synthase                                        225   2e-64   Gossypium hirsutum [American cotton]
gb|AEN71079.1|  sucrose synthase Sus1                                   225   2e-64   Gossypium aridum
gb|AEN71075.1|  sucrose synthase Sus1                                   225   2e-64   Gossypium armourianum
dbj|BAM68526.1|  sucrose synthase                                       225   2e-64   Mangifera indica
gb|AEN71080.1|  sucrose synthase Sus1                                   225   2e-64   Gossypium gossypioides
gb|AEN71068.1|  sucrose synthase Sus1                                   225   2e-64   Gossypium tomentosum
gb|AEV40462.1|  sucrose synthase 3                                      225   2e-64   Gossypium arboreum [tree cotton]
gb|AGO61958.1|  sucrose synthase                                        218   2e-64   Prunus serrulata
gb|AEN71059.1|  sucrose synthase Sus1                                   225   2e-64   Gossypium thurberi
gb|AEN71063.1|  sucrose synthase Sus1                                   225   2e-64   Gossypium mustelinum
gb|ADY68845.1|  sucrose synthase                                        225   2e-64   Gossypium barbadense [Egyptian cotton]
gb|AEN71078.1|  sucrose synthase Sus1                                   225   2e-64   Gossypium klotzschianum
gb|AEN71066.1|  sucrose synthase Sus1                                   225   2e-64   Gossypium darwinii
gb|AEN71061.1|  sucrose synthase Sus1                                   225   2e-64   Gossypium schwendimanii
gb|AAK59464.1|  putative sucrose synthase                               220   2e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AAD28641.1|  sucrose synthase                                        225   2e-64   Gossypium hirsutum [American cotton]
gb|ACV72640.1|  sucrose synthase 1                                      225   2e-64   Gossypium hirsutum [American cotton]
gb|ADY68846.1|  sucrose synthase                                        225   2e-64   Gossypium herbaceum subsp. africanum
gb|AEK81520.1|  sucrose synthase isoform B                              225   2e-64   Gossypium hirsutum [American cotton]
gb|ADY68844.1|  sucrose synthase                                        224   2e-64   Gossypium barbadense [Egyptian cotton]
gb|AEK81522.1|  sucrose synthase isoform D                              224   2e-64   Gossypium hirsutum [American cotton]
ref|XP_010687574.1|  PREDICTED: sucrose synthase                        224   2e-64   
gb|AAR19769.1|  sucrose synthase                                        224   2e-64   Beta vulgaris [beet]
gb|AAR03498.1|  sucrose synthase                                        224   3e-64   Populus tremuloides
ref|XP_010047438.1|  PREDICTED: sucrose synthase                        224   3e-64   Eucalyptus grandis [rose gum]
gb|AIJ28962.1|  sucrose synthase                                        224   3e-64   Manihot esculenta [manioc]
ref|XP_010271909.1|  PREDICTED: sucrose synthase                        224   3e-64   Nelumbo nucifera [Indian lotus]
gb|AGM14949.1|  sucrose synthase 4                                      224   4e-64   Hevea brasiliensis [jebe]
gb|ADK98097.1|  sucrose synthase                                        207   4e-64   Schiedea globosa
ref|XP_002275155.1|  PREDICTED: sucrose synthase                        224   5e-64   Vitis vinifera
gb|ABD96570.1|  sucrose synthase                                        224   5e-64   Manihot esculenta [manioc]
emb|CAN82840.1|  hypothetical protein VITISV_024563                     224   5e-64   Vitis vinifera
gb|AIJ28961.1|  sucrose synthase                                        224   5e-64   Manihot esculenta [manioc]
ref|NP_001237525.1|  sucrose synthase                                   223   6e-64   Glycine max [soybeans]
ref|NP_001289655.1|  sucrose synthase                                   223   8e-64   Eucalyptus grandis [rose gum]
gb|AGM14948.1|  sucrose synthase 3                                      223   9e-64   Hevea brasiliensis [jebe]
gb|ADR81997.1|  sucrose synthase 2                                      223   9e-64   Populus trichocarpa [western balsam poplar]
ref|XP_006381564.1|  sucrose synthase family protein                    223   9e-64   Populus trichocarpa [western balsam poplar]
ref|XP_010247458.1|  PREDICTED: sucrose synthase                        223   9e-64   Nelumbo nucifera [Indian lotus]
gb|ADW09901.1|  putative sucrose synthase                               206   1e-63   Schiedea globosa
gb|ADK98109.1|  sucrose synthase                                        206   1e-63   Schiedea globosa
ref|XP_010535796.1|  PREDICTED: sucrose synthase 4                      223   1e-63   Tarenaya hassleriana [spider flower]
gb|EYU25805.1|  hypothetical protein MIMGU_mgv1a001207mg                223   1e-63   Erythranthe guttata [common monkey flower]
tpg|DAA45272.1|  TPA: putative sucrose synthase family protein          211   1e-63   
gb|ADW09936.1|  putative sucrose synthase                               205   1e-63   Schiedea globosa
ref|XP_007138617.1|  hypothetical protein PHAVU_009G223800g             223   1e-63   Phaseolus vulgaris [French bean]
gb|AEN71060.1|  sucrose synthase Sus1                                   222   1e-63   Gossypium laxum
ref|XP_006290612.1|  hypothetical protein CARUB_v10016702mg             222   2e-63   Capsella rubella
gb|ADW09933.1|  putative sucrose synthase                               205   2e-63   Schiedea globosa
gb|ADW80600.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80593.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80580.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ABW76422.1|  sucrose synthase                                        222   2e-63   Populus tremuloides
gb|ADW80585.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80609.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80575.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80606.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80586.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80598.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80611.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80587.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80610.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80595.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80591.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80578.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80608.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80592.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80582.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|AIJ28959.1|  sucrose synthase                                        222   2e-63   Manihot esculenta subsp. flabellifolia
gb|ADW80590.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80605.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80604.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80597.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80584.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADV71182.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80588.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80581.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80589.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80607.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80574.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80596.1|  sucrose synthase 2                                      222   3e-63   Populus tomentosa [Chinese white poplar]
ref|XP_003546526.1|  PREDICTED: sucrose synthase-like isoform X1        222   3e-63   
gb|ADW09904.1|  putative sucrose synthase                               204   3e-63   Schiedea globosa
gb|KHN49081.1|  Sucrose synthase                                        222   3e-63   Glycine soja [wild soybean]
gb|ADK98101.1|  sucrose synthase                                        204   3e-63   Schiedea globosa
ref|XP_008337809.1|  PREDICTED: sucrose synthase                        221   3e-63   Malus domestica [apple tree]
gb|ADW80602.1|  sucrose synthase 2                                      221   3e-63   Populus tomentosa [Chinese white poplar]
gb|ADK98116.1|  sucrose synthase                                        204   3e-63   Schiedea globosa
ref|XP_010493195.1|  PREDICTED: sucrose synthase 1                      221   4e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010420928.1|  PREDICTED: sucrose synthase 1-like                 221   4e-63   Camelina sativa [gold-of-pleasure]
ref|XP_011039917.1|  PREDICTED: sucrose synthase                        221   4e-63   Populus euphratica
ref|XP_010454391.1|  PREDICTED: sucrose synthase 1-like isoform X2      221   4e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010454392.1|  PREDICTED: sucrose synthase 1-like isoform X3      221   4e-63   Camelina sativa [gold-of-pleasure]
sp|Q01390.1|SUSY_VIGRR  RecName: Full=Sucrose synthase; AltName: ...    221   4e-63   Vigna radiata var. radiata [golden gram]
ref|XP_003533802.1|  PREDICTED: sucrose synthase-like isoform X1        221   4e-63   Glycine max [soybeans]
gb|KHN47619.1|  Sucrose synthase                                        221   5e-63   Glycine soja [wild soybean]
ref|XP_003609947.1|  Sucrose synthase                                   216   5e-63   
dbj|BAH56282.1|  sucrose synthase                                       221   5e-63   Vigna angularis [azuki bean]
gb|ADK98120.1|  sucrose synthase                                        204   5e-63   Schiedea adamantis
ref|XP_010520519.1|  PREDICTED: sucrose synthase 4-like                 221   5e-63   Tarenaya hassleriana [spider flower]
emb|CDX70945.1|  BnaC03g10290D                                          221   5e-63   
ref|XP_010454390.1|  PREDICTED: sucrose synthase 1-like isoform X1      221   5e-63   Camelina sativa [gold-of-pleasure]
gb|ADK98103.1|  sucrose synthase                                        204   5e-63   Schiedea globosa
ref|XP_009120766.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    221   5e-63   Brassica rapa
emb|CDX92432.1|  BnaA10g14710D                                          221   5e-63   
emb|CDY16569.1|  BnaC09g37040D                                          221   6e-63   Brassica napus [oilseed rape]
gb|ADW09903.1|  putative sucrose synthase                               204   6e-63   Schiedea globosa
ref|NP_566865.2|  sucrose synthase 4                                    221   6e-63   Arabidopsis thaliana [mouse-ear cress]
gb|ADW09926.1|  putative sucrose synthase                               204   7e-63   Schiedea globosa
gb|AGQ57012.1|  sucrose synthase 1                                      220   7e-63   Hevea brasiliensis [jebe]
ref|XP_002877269.1|  hypothetical protein ARALYDRAFT_484788             220   8e-63   
gb|ADW80603.1|  sucrose synthase 2                                      220   8e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80599.1|  sucrose synthase 2                                      220   9e-63   Populus tomentosa [Chinese white poplar]
gb|ADW80579.1|  sucrose synthase 2                                      220   9e-63   Populus tomentosa [Chinese white poplar]
emb|CAA09910.1|  sucrose synthase                                       220   1e-62   Pisum sativum [garden pea]
ref|NP_197583.1|  sucrose synthase 1                                    220   1e-62   Arabidopsis thaliana [mouse-ear cress]
gb|AFI57908.1|  sucrose synthase 1                                      220   1e-62   Prunus persica
ref|XP_008242292.1|  PREDICTED: sucrose synthase                        220   1e-62   Prunus mume [ume]
pdb|3S28|A  Chain A, The Crystal Structure Of Sucrose Synthase-1 ...    220   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007204649.1|  hypothetical protein PRUPE_ppa001535mg             220   1e-62   Prunus persica
gb|ADW80577.1|  sucrose synthase 2                                      220   1e-62   Populus tomentosa [Chinese white poplar]
gb|ACP17902.1|  sucrose synthase                                        220   1e-62   Phaseolus vulgaris [French bean]
gb|ADW80601.1|  sucrose synthase 2                                      220   1e-62   Populus tomentosa [Chinese white poplar]
gb|AAC28107.1|  nodule-enhanced sucrose synthase                        220   1e-62   Pisum sativum [garden pea]
sp|P31926.1|SUSY_VICFA  RecName: Full=Sucrose synthase; AltName: ...    220   1e-62   Vicia faba [broad bean]
emb|CDX88838.1|  BnaA03g08110D                                          219   1e-62   
ref|XP_009131818.1|  PREDICTED: sucrose synthase 1                      220   1e-62   Brassica rapa
ref|XP_008349074.1|  PREDICTED: sucrose synthase-like                   219   1e-62   
ref|XP_008382924.1|  PREDICTED: sucrose synthase-like                   219   1e-62   
sp|P49034.1|SUSY_ALNGL  RecName: Full=Sucrose synthase; AltName: ...    219   1e-62   Alnus glutinosa
tpg|DAA45273.1|  TPA: putative sucrose synthase family protein          211   1e-62   
ref|XP_009348897.1|  PREDICTED: sucrose synthase-like                   219   2e-62   Pyrus x bretschneideri [bai li]
gb|ADK98112.1|  sucrose synthase                                        202   2e-62   Schiedea globosa
ref|XP_008338289.1|  PREDICTED: sucrose synthase-like                   219   2e-62   
ref|XP_009348896.1|  PREDICTED: sucrose synthase-like                   219   2e-62   Pyrus x bretschneideri [bai li]
ref|XP_006287059.1|  hypothetical protein CARUB_v10000208mg             219   2e-62   
gb|ABP88869.1|  sucrose synthase                                        219   3e-62   Medicago falcata [sickle alfalfa]
gb|ADW09905.1|  putative sucrose synthase                               202   3e-62   Schiedea globosa
gb|AIL23782.1|  sucrose synthase                                        218   4e-62   Prunus serrulata
gb|ADW80583.1|  sucrose synthase 2                                      218   4e-62   Populus tomentosa [Chinese white poplar]
gb|KJB65376.1|  hypothetical protein B456_010G092300                    218   4e-62   Gossypium raimondii
ref|XP_008797380.1|  PREDICTED: sucrose synthase 1-like isoform X2      218   4e-62   Phoenix dactylifera
gb|AII19313.1|  sucrose synthase 1                                      218   4e-62   Ricinus communis
gb|KEH37657.1|  sucrose synthase                                        218   5e-62   Medicago truncatula
ref|XP_002516210.1|  sucrose synthase, putative                         218   5e-62   
emb|CDO97805.1|  unnamed protein product                                217   5e-62   Coffea canephora [robusta coffee]
ref|XP_009343356.1|  PREDICTED: sucrose synthase-like                   218   6e-62   Pyrus x bretschneideri [bai li]
ref|XP_008391777.1|  PREDICTED: sucrose synthase-like isoform X1        218   6e-62   
ref|XP_008391788.1|  PREDICTED: sucrose synthase-like isoform X2        218   6e-62   
ref|XP_006400648.1|  hypothetical protein EUTSA_v10012719mg             218   6e-62   Eutrema salsugineum [saltwater cress]
gb|ADW09891.1|  putative sucrose synthase                               201   8e-62   Schiedea membranacea
sp|O65026.1|SUSY_MEDSA  RecName: Full=Sucrose synthase; AltName: ...    218   9e-62   Medicago sativa [alfalfa]
ref|XP_008797379.1|  PREDICTED: sucrose synthase 1-like isoform X1      218   9e-62   
ref|XP_010107074.1|  Sucrose synthase                                   217   1e-61   Morus notabilis
gb|AAM22755.1|  sucrose synthase                                        202   1e-61   Deschampsia antarctica
gb|ADW80576.1|  sucrose synthase 2                                      217   1e-61   Populus tomentosa [Chinese white poplar]
ref|XP_003609949.1|  Sucrose synthase                                   217   1e-61   Medicago truncatula
emb|CAB40795.1|  sucrose synthase                                       217   1e-61   Medicago truncatula
gb|ACF85812.1|  unknown                                                 201   1e-61   Zea mays [maize]
ref|XP_002874016.1|  hypothetical protein ARALYDRAFT_910122             217   1e-61   Arabidopsis lyrata subsp. lyrata
gb|ADW09914.1|  putative sucrose synthase                               200   1e-61   Schiedea globosa
gb|AGV22112.1|  sucrose synthase 2                                      217   1e-61   Betula luminifera [liang ye hua]
emb|CAA57881.1|  sucrose synthase                                       217   2e-61   Oxybasis rubra [pigweed]
gb|AFA36485.1|  putative sucrose synthase 2                             204   2e-61   Lolium perenne [perennial ryegrass]
gb|ACF80843.1|  unknown                                                 202   2e-61   Zea mays [maize]
gb|ADW09895.1|  putative sucrose synthase                               200   2e-61   Schiedea globosa
sp|Q41608.1|SUS1_TULGE  RecName: Full=Sucrose synthase 1; AltName...    216   2e-61   Tulipa gesneriana
ref|XP_009343357.1|  PREDICTED: sucrose synthase                        216   3e-61   Pyrus x bretschneideri [bai li]
ref|XP_003609946.1|  Sucrose synthase                                   216   3e-61   
ref|XP_008783129.1|  PREDICTED: sucrose synthase 1-like isoform X1      216   3e-61   Phoenix dactylifera
ref|XP_008783137.1|  PREDICTED: sucrose synthase 1-like isoform X2      216   4e-61   Phoenix dactylifera
ref|XP_010917399.1|  PREDICTED: sucrose synthase 1-like                 216   4e-61   Elaeis guineensis
gb|ABR25521.1|  sucrose synthase metabolism                             202   4e-61   Oryza sativa Indica Group [Indian rice]
dbj|BAM05649.1|  sucrose synthase 3                                     216   4e-61   Eucalyptus globulus subsp. globulus
gb|ACF78506.1|  unknown                                                 212   6e-61   Zea mays [maize]
gb|AAA34305.1|  sucrose synthase type 2                                 203   6e-61   Triticum aestivum [Canadian hard winter wheat]
gb|AEN83999.1|  sucrose synthase                                        215   6e-61   Cucumis sativus [cucumbers]
ref|XP_008450968.1|  PREDICTED: sucrose synthase                        215   7e-61   Cucumis melo [Oriental melon]
ref|XP_004488146.1|  PREDICTED: sucrose synthase-like isoform X6        215   7e-61   
ref|XP_004144053.1|  PREDICTED: sucrose synthase-like                   215   7e-61   Cucumis sativus [cucumbers]
gb|KGN66333.1|  hypothetical protein Csa_1G597800                       215   7e-61   
gb|ADM77474.1|  sucrose synthase-like protein                           200   7e-61   
gb|ADM77484.1|  sucrose synthase-like protein                           200   7e-61   
tpg|DAA45279.1|  TPA: putative sucrose synthase family protein          208   8e-61   
sp|Q41607.1|SUS2_TULGE  RecName: Full=Sucrose synthase 2; AltName...    215   9e-61   
pdb|3S27|A  Chain A, The Crystal Structure Of Sucrose Synthase-1 ...    214   9e-61   
emb|CAA09680.1|  sucrose synthase                                       207   1e-60   
dbj|BAA89232.1|  wsus                                                   214   1e-60   
ref|XP_009610442.1|  PREDICTED: sucrose synthase 4-like                 205   1e-60   
gb|AFM52233.1|  putative sucrose synthase 2                             214   1e-60   
gb|KJB82967.1|  hypothetical protein B456_013G222400                    214   1e-60   
ref|XP_004508033.1|  PREDICTED: sucrose synthase-like isoform X1        214   1e-60   
ref|XP_010932355.1|  PREDICTED: sucrose synthase 2-like isoform X2      214   2e-60   
ref|XP_008795811.1|  PREDICTED: sucrose synthase 4-like                 202   2e-60   
ref|XP_010937277.1|  PREDICTED: sucrose synthase 2-like                 214   2e-60   
ref|XP_010932353.1|  PREDICTED: sucrose synthase 1-like isoform X1      214   2e-60   
gb|AGM14947.1|  sucrose synthase 2                                      213   3e-60   
gb|ADW09921.1|  putative sucrose synthase                               197   3e-60   
gb|KJB54539.1|  hypothetical protein B456_009G038000                    213   3e-60   
gb|ABK23178.1|  unknown                                                 197   3e-60   
emb|CAC32462.1|  sucrose synthase isoform 3                             213   3e-60   
gb|KJB54541.1|  hypothetical protein B456_009G038000                    213   4e-60   
ref|XP_010049327.1|  PREDICTED: sucrose synthase-like                   213   5e-60   
ref|XP_009410254.1|  PREDICTED: sucrose synthase 1-like                 213   5e-60   
ref|NP_001289661.1|  sucrose synthase-like                              213   5e-60   
emb|CAA50317.1|  sucrose synthase                                       213   5e-60   
gb|AGQ57013.1|  sucrose synthase 2                                      213   6e-60   
gb|ADW09887.1|  putative sucrose synthase                               196   7e-60   
gb|AFW88069.1|  sucrose synthase1                                       204   8e-60   
ref|XP_006838088.1|  hypothetical protein AMTR_s00106p00019920          212   8e-60   
gb|ABE73120.1|  SUS1                                                    207   8e-60   
gb|ADE77562.1|  unknown                                                 200   9e-60   
gb|ADW09917.1|  putative sucrose synthase                               196   9e-60   
ref|NP_001268888.1|  sucrose synthase 2-like                            212   1e-59   
ref|XP_008655408.1|  PREDICTED: sucrose synthase 4-like                 212   1e-59   
ref|XP_009352312.1|  PREDICTED: sucrose synthase 2-like                 211   1e-59   
gb|KGN52828.1|  hypothetical protein Csa_4G001950                       211   1e-59   
gb|ADW09918.1|  putative sucrose synthase                               195   2e-59   
ref|XP_008783098.1|  PREDICTED: sucrose synthase 1                      211   2e-59   
ref|NP_001105194.1|  sucrose synthase2                                  211   2e-59   
ref|XP_009404100.1|  PREDICTED: sucrose synthase 2                      211   2e-59   
ref|XP_008223239.1|  PREDICTED: sucrose synthase 2                      199   2e-59   
gb|ADY02961.1|  sucrose synthase                                        211   2e-59   
gb|ADW09907.1|  putative sucrose synthase                               195   2e-59   
sp|O24301.1|SUS2_PEA  RecName: Full=Sucrose synthase 2; AltName: ...    211   2e-59   
ref|XP_002465303.1|  hypothetical protein SORBIDRAFT_01g035890          211   2e-59   
dbj|BAM75184.1|  sucrose synthase                                       202   2e-59   
ref|XP_008454320.1|  PREDICTED: sucrose synthase 2                      210   3e-59   
ref|XP_006474683.1|  PREDICTED: sucrose synthase-like                   210   3e-59   
dbj|BAE06059.1|  sucrose synthase                                       210   4e-59   
gb|KDP28192.1|  hypothetical protein JCGZ_13963                         210   4e-59   
gb|KJB07349.1|  hypothetical protein B456_001G017700                    210   4e-59   
gb|KDO87158.1|  hypothetical protein CISIN_1g003492mg                   208   5e-59   
ref|XP_006444401.1|  hypothetical protein CICLE_v10018889mg             208   5e-59   
dbj|BAM05651.1|  sucrose synthase 3                                     209   5e-59   
gb|AAL27096.1|  sucrose synthase                                        209   5e-59   
gb|ABY82048.1|  sucrose synthase                                        202   5e-59   
dbj|BAM05650.1|  sucrose synthase 3                                     209   5e-59   
gb|AAM95944.1|  sucrose synthase                                        210   5e-59   
gb|KDO87153.1|  hypothetical protein CISIN_1g003492mg                   209   6e-59   
gb|AEV40461.1|  sucrose synthase 2                                      209   7e-59   
gb|KDO71750.1|  hypothetical protein CISIN_1g003726mg                   209   7e-59   
gb|ABR15470.1|  sucrose synthase                                        209   7e-59   
ref|XP_002516963.1|  sucrose synthase, putative                         209   8e-59   
ref|XP_006489034.1|  PREDICTED: sucrose synthase 2-like isoform X2      209   8e-59   
ref|XP_006419508.1|  hypothetical protein CICLE_v10004341mg             209   8e-59   
ref|XP_009380139.1|  PREDICTED: sucrose synthase 2-like                 209   9e-59   
ref|XP_008800466.1|  PREDICTED: sucrose synthase 2                      209   1e-58   
dbj|BAA88904.1|  sucrose synthase                                       209   1e-58   
ref|XP_006480003.1|  PREDICTED: sucrose synthase 3-like                 209   1e-58   
gb|KDO87151.1|  hypothetical protein CISIN_1g003492mg                   209   1e-58   
gb|AGM14950.1|  sucrose synthase 5                                      209   1e-58   
ref|XP_006444402.1|  hypothetical protein CICLE_v10018889mg             209   1e-58   
gb|EMT20174.1|  Sucrose synthase 2                                      207   1e-58   
ref|XP_010939862.1|  PREDICTED: sucrose synthase 1                      209   1e-58   
gb|ACN36258.1|  unknown                                                 204   1e-58   
ref|XP_010051346.1|  PREDICTED: sucrose synthase-like                   208   1e-58   
gb|AGW23638.1|  sucrose synthase                                        208   2e-58   
ref|XP_009359754.1|  PREDICTED: sucrose synthase                        208   2e-58   
tpg|DAA45281.1|  TPA: putative sucrose synthase family protein          208   2e-58   
gb|KDO73800.1|  hypothetical protein CISIN_1g003947mg                   207   3e-58   
gb|AHM02468.1|  sucrose synthase                                        207   3e-58   
ref|XP_007163138.1|  hypothetical protein PHAVU_001G209600g             207   3e-58   
dbj|BAJ10424.1|  sucrose synthase                                       207   3e-58   
gb|ABF95854.1|  Sucrose synthase 2, putative, expressed                 206   4e-58   
ref|XP_006452875.1|  hypothetical protein CICLE_v10010343mg             207   4e-58   
gb|AJA37527.1|  sucrose synthase                                        207   5e-58   
gb|EMS65561.1|  Sucrose synthase 2                                      207   5e-58   
gb|AEZ00745.1|  SusA1                                                   207   5e-58   
gb|AEN71101.1|  sucrose synthase SusA1                                  207   5e-58   
gb|AFY03626.1|  sucrose synthase                                        207   6e-58   
gb|AEN71091.1|  sucrose synthase SusA1                                  207   6e-58   
ref|XP_006651359.1|  PREDICTED: sucrose synthase 4-like                 207   6e-58   
ref|XP_008246168.1|  PREDICTED: sucrose synthase 2-like                 196   6e-58   
gb|AEN71099.1|  sucrose synthase SusA1                                  207   6e-58   
gb|AFK45264.1|  unknown                                                 193   6e-58   
gb|AEN71086.1|  sucrose synthase SusA1                                  207   6e-58   
ref|XP_010482198.1|  PREDICTED: sucrose synthase 2-like                 191   6e-58   
gb|AEN71094.1|  sucrose synthase SusA1                                  207   6e-58   
gb|AEN71090.1|  sucrose synthase SusA1                                  207   6e-58   
gb|AEN71096.1|  sucrose synthase SusA1                                  207   6e-58   
gb|AEN71106.1|  sucrose synthase SusA1                                  207   6e-58   
gb|AEN71104.1|  sucrose synthase SusA1                                  207   6e-58   
gb|AEZ00746.1|  SusA1                                                   207   6e-58   
gb|AEN71105.1|  sucrose synthase SusA1                                  207   6e-58   
gb|AEN71085.1|  sucrose synthase SusA1                                  207   6e-58   
gb|AEV40896.1|  sucrose synthase                                        207   6e-58   
gb|AEN71103.1|  sucrose synthase SusA1                                  206   6e-58   
gb|AEN71093.1|  sucrose synthase SusA1                                  206   7e-58   
gb|AEN71089.1|  sucrose synthase SusA1                                  206   7e-58   
gb|AEN71084.1|  sucrose synthase SusA1                                  206   7e-58   
gb|AEN71083.1|  sucrose synthase SusA1                                  206   7e-58   
gb|AEN71092.1|  sucrose synthase SusA1                                  206   7e-58   
ref|XP_010092252.1|  Sucrose synthase 2                                 206   7e-58   
gb|AEV40894.1|  sucrose synthase                                        206   7e-58   
gb|AEN71088.1|  sucrose synthase SusA1                                  206   7e-58   
gb|AEV40893.1|  sucrose synthase                                        206   7e-58   
gb|AEO09338.2|  sucrose synthase                                        206   7e-58   
ref|XP_007200961.1|  hypothetical protein PRUPE_ppa002723mg             205   8e-58   
ref|XP_010556726.1|  PREDICTED: sucrose synthase 3                      206   8e-58   
emb|CAL25362.2|  sucrose synthase                                       206   1e-57   
gb|ADW09927.1|  putative sucrose synthase                               190   1e-57   
dbj|BAA88981.1|  sucrose synthase                                       206   1e-57   
gb|AFM52237.1|  putative sucrose synthase 6                             206   1e-57   
ref|NP_001050064.1|  Os03g0340500                                       206   1e-57   
ref|XP_009390318.1|  PREDICTED: sucrose synthase 2-like                 206   1e-57   
gb|AIL88516.1|  sucrose synthase type 2-1                               206   1e-57   
gb|EPS58089.1|  sucrose synthase                                        201   1e-57   
gb|AIL88517.1|  sucrose synthase type 2-2                               206   1e-57   
gb|ADW09923.1|  putative sucrose synthase                               190   1e-57   
ref|XP_008386674.1|  PREDICTED: sucrose synthase 3                      206   2e-57   
ref|NP_001280838.1|  sucrose synthase 3                                 206   2e-57   
ref|XP_004495938.1|  PREDICTED: sucrose synthase 2-like                 205   2e-57   
ref|XP_003562658.1|  PREDICTED: sucrose synthase 2                      205   2e-57   
ref|XP_008235123.1|  PREDICTED: sucrose synthase 3                      205   2e-57   
gb|KJB24380.1|  hypothetical protein B456_004G142700                    203   2e-57   
ref|XP_006287087.1|  hypothetical protein CARUB_v10000249mg             205   2e-57   
gb|AEN71087.1|  sucrose synthase SusA1                                  205   2e-57   
gb|AAA34304.1|  sucrose synthase type 1                                 192   4e-57   
ref|XP_007050984.1|  Sucrose synthase 3 isoform 1                       204   4e-57   
ref|XP_008659017.1|  PREDICTED: sucrose synthase 2 isoform X1           204   4e-57   
gb|AAL50570.1|AF412037_1  sucrose synthase                              204   4e-57   
ref|XP_010921619.1|  PREDICTED: sucrose synthase 4                      204   4e-57   
ref|XP_010088307.1|  Sucrose synthase 2                                 204   5e-57   
gb|AIS75087.1|  sus1                                                    204   5e-57   
ref|XP_006378062.1|  hypothetical protein POPTR_0010s01360g             197   5e-57   
dbj|BAB20799.1|  sucrose synthase 1                                     204   5e-57   
ref|XP_004984086.1|  PREDICTED: sucrose synthase 2-like                 204   5e-57   
ref|XP_002465161.1|  hypothetical protein SORBIDRAFT_01g033060          204   5e-57   
ref|XP_011462741.1|  PREDICTED: sucrose synthase 2                      204   6e-57   
ref|XP_010456053.1|  PREDICTED: sucrose synthase 3-like                 204   6e-57   
gb|AGI56230.1|  sucrose synthase 1                                      204   6e-57   
gb|KJB24379.1|  hypothetical protein B456_004G142700                    204   6e-57   
gb|EAZ04713.1|  hypothetical protein OsI_26874                          204   6e-57   
gb|AEV40895.1|  sucrose synthase                                        204   6e-57   
gb|AFR41908.1|  sucrose synthase                                        189   7e-57   
ref|XP_010429475.1|  PREDICTED: sucrose synthase 3                      204   7e-57   
ref|XP_003557752.1|  PREDICTED: sucrose synthase 1                      204   7e-57   
gb|KEH24408.1|  sucrose synthase                                        204   7e-57   
ref|NP_001060278.1|  Os07g0616800                                       204   8e-57   
ref|XP_006657957.1|  PREDICTED: sucrose synthase 3-like                 204   8e-57   
gb|AAC41682.1|  sucrose synthase 3                                      204   8e-57   
gb|AGV22111.1|  sucrose synthase 1                                      203   9e-57   
ref|XP_003521575.1|  PREDICTED: sucrose synthase 2-like                 203   1e-56   
ref|XP_002302727.1|  sucrose synthase family protein                    203   1e-56   
dbj|BAE06058.1|  sucrose synthase                                       203   1e-56   
ref|XP_004287544.1|  PREDICTED: sucrose synthase-like                   203   1e-56   
ref|XP_004494391.1|  PREDICTED: sucrose synthase 2-like isoform X2      203   1e-56   
gb|AFR41929.1|  sucrose synthase                                        188   1e-56   
gb|AAM95943.1|  sucrose synthase                                        202   2e-56   
ref|XP_002271896.1|  PREDICTED: sucrose synthase 2                      202   2e-56   
emb|CAA03935.1|  sucrose synthase type 2                                202   2e-56   
gb|AEA76429.1|  sucrose synthase 1                                      202   2e-56   
ref|XP_003564156.1|  PREDICTED: sucrose synthase 1                      202   2e-56   
gb|EAY90371.1|  hypothetical protein OsI_11950                          202   2e-56   
emb|CDX86250.1|  BnaA06g29670D                                          202   2e-56   
gb|KDO87150.1|  hypothetical protein CISIN_1g003492mg                   202   2e-56   
ref|NP_001105323.1|  sucrose synthase 2                                 202   2e-56   
ref|NP_001050319.1|  Os03g0401300                                       202   2e-56   
ref|XP_009390882.1|  PREDICTED: sucrose synthase 2-like                 202   2e-56   
ref|XP_003557951.1|  PREDICTED: sucrose synthase 4                      202   2e-56   
ref|XP_004488141.1|  PREDICTED: sucrose synthase-like isoform X1        202   2e-56   
ref|XP_010269598.1|  PREDICTED: sucrose synthase 2-like                 202   2e-56   
ref|XP_009151715.1|  PREDICTED: sucrose synthase 2                      202   3e-56   
gb|KHN43494.1|  Sucrose synthase 2                                      202   3e-56   
gb|KCW81848.1|  hypothetical protein EUGRSUZ_C03199                     202   3e-56   
ref|XP_004290813.1|  PREDICTED: sucrose synthase 2                      202   3e-56   
gb|AIL88515.1|  sucrose synthase type 3                                 202   3e-56   
ref|XP_002523115.1|  sucrose synthase, putative                         201   4e-56   
gb|AFR41915.1|  sucrose synthase                                        187   4e-56   
gb|KCW58409.1|  hypothetical protein EUGRSUZ_H01094                     200   4e-56   
gb|AFY03625.1|  sucrose synthase                                        198   4e-56   
ref|XP_003554531.1|  PREDICTED: sucrose synthase 2-like                 201   4e-56   
gb|AFR41912.1|  sucrose synthase                                        187   4e-56   
ref|XP_009800149.1|  PREDICTED: sucrose synthase 2-like                 201   4e-56   
gb|EMS66266.1|  Sucrose synthase 1                                      201   4e-56   
ref|XP_010422613.1|  PREDICTED: sucrose synthase 3-like                 201   4e-56   
gb|AAA68209.1|  sus1                                                    201   5e-56   
gb|AFR41917.1|  sucrose synthase                                        186   5e-56   
dbj|BAM05645.1|  sucrose synthase 1                                     201   5e-56   
gb|KFK30802.1|  hypothetical protein AALP_AA6G027800                    201   5e-56   
gb|KCW67227.1|  hypothetical protein EUGRSUZ_F01010                     198   5e-56   
gb|AFR41916.1|  sucrose synthase                                        186   5e-56   
dbj|BAK02964.1|  predicted protein                                      201   6e-56   
gb|AAL50572.2|AF412039_1  sucrose synthase                              201   6e-56   
gb|EMT06653.1|  Sucrose synthase 1                                      201   6e-56   
ref|XP_007225257.1|  hypothetical protein PRUPE_ppa001573mg             201   6e-56   
dbj|BAM05652.1|  sucrose synthase 3                                     201   6e-56   
gb|AFR41922.1|  sucrose synthase                                        186   6e-56   
ref|XP_006650177.1|  PREDICTED: sucrose synthase 1-like isoform X2      201   6e-56   
ref|XP_010069893.1|  PREDICTED: sucrose synthase 2                      201   7e-56   
ref|XP_004984440.1|  PREDICTED: sucrose synthase 4-like                 201   7e-56   
ref|XP_010938368.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    201   7e-56   
gb|EMT33394.1|  Sucrose synthase 1                                      201   7e-56   
gb|AIO11846.1|  sucrose synthase                                        201   7e-56   
gb|AAL50571.1|AF412038_1  sucrose synthase                              201   8e-56   
ref|XP_002271530.1|  PREDICTED: sucrose synthase 2                      201   8e-56   
ref|XP_010259474.1|  PREDICTED: sucrose synthase 4-like                 201   8e-56   
ref|XP_010685729.1|  PREDICTED: sucrose synthase-like                   200   9e-56   
sp|P31923.1|SUS2_HORVU  RecName: Full=Sucrose synthase 2; AltName...    201   1e-55   
ref|XP_006396436.1|  hypothetical protein EUTSA_v10028435mg             200   1e-55   



>ref|XP_009625446.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
Length=805

 Score =   254 bits (648),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/125 (94%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELL DFFE+CKK+PSHWE IS
Sbjct  681  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLADFFERCKKEPSHWEAIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE V
Sbjct  741  EGGLKRIQEKYTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEAV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>ref|XP_009792656.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
Length=805

 Score =   253 bits (647),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/125 (94%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHG+QAAELL DFFEKCKK+PSHWE IS
Sbjct  681  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGDQAAELLADFFEKCKKEPSHWEAIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE V
Sbjct  741  EGGLKRIQEKYTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEAV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>ref|NP_001275286.1| sucrose synthase [Solanum tuberosum]
 emb|CAD61188.1| sucrose synthase 4 [Solanum tuberosum]
Length=805

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKK+PSHWETIS
Sbjct  681  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKEPSHWETIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE V
Sbjct  741  TGGLKRIQEKYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAAE  805



>ref|XP_006345244.1| PREDICTED: uncharacterized LOC102577594 [Solanum tuberosum]
Length=805

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKKDPSHWETIS
Sbjct  681  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKDPSHWETIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE V
Sbjct  741  MGGLKRIEEKYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAAE  805



>emb|CAA09681.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKK+PSHWETIS
Sbjct  681  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKEPSHWETIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE V
Sbjct  741  TGGLKRIQEKYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAAE  805



>ref|NP_001234655.1| sucrose synthase [Solanum lycopersicum]
 sp|P49037.1|SUSY_SOLLC RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Solanum lycopersicum]
 gb|AAA34196.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKK+PSHWETIS
Sbjct  681  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKEPSHWETIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE V
Sbjct  741  TGGLKRIQEKYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAAE  805



>gb|AAA97571.1| sucrose synthase [Solanum tuberosum]
Length=805

 Score =   248 bits (634),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCK++PSHWETIS
Sbjct  681  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKREPSHWETIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE V
Sbjct  741  TGGLKRIQEKYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAAE  805



>sp|P10691.1|SUS1_SOLTU RecName: Full=Sucrose synthase; AltName: Full=SS16; AltName: 
Full=Sucrose-UDP glucosyltransferase [Solanum tuberosum]
 gb|AAA33841.1| sucrase synthase (EC 2.4.1.13) [Solanum tuberosum]
Length=805

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKKDPSHWETIS
Sbjct  681  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKDPSHWETIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTWQIYS+ LLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE V
Sbjct  741  MGGLKRIEEKYTWQIYSESLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAAE  805



>gb|ABV02029.1| sucrose sythase [Nicotiana langsdorffii x Nicotiana sanderae]
Length=805

 Score =   246 bits (627),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFATNHGGPAEIIV+GKSGFHIDPYHGEQAA+LL DFFEKCK +PSHWETIS
Sbjct  681  EAMTCGLPTFATNHGGPAEIIVNGKSGFHIDPYHGEQAADLLADFFEKCKTEPSHWETIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE V
Sbjct  741  TGGLKRIQEKYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAAE  805



>ref|XP_011093886.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093887.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093888.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093889.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093890.1| PREDICTED: sucrose synthase [Sesamum indicum]
Length=805

 Score =   245 bits (626),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT HGGPAEIIVHGKSGFHIDPY+GEQ AE+LVDFFEKCK DPSHWETIS
Sbjct  681  EAMTCGLPTFATLHGGPAEIIVHGKSGFHIDPYNGEQVAEVLVDFFEKCKHDPSHWETIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
            AGGLKRIQEKYTWQIYSDRLLTLA VYGFWK+VSKLDR EIRRYLEMFYALKFRKLAE V
Sbjct  741  AGGLKRIQEKYTWQIYSDRLLTLAGVYGFWKYVSKLDRREIRRYLEMFYALKFRKLAEAV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>ref|XP_009589756.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
 ref|XP_009589757.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
Length=805

 Score =   244 bits (624),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFATNHGGPAEIIV+GKSGFHIDPYHGEQAA+LL DFFEKCK  PSHWETIS
Sbjct  681  EAMTCGLPTFATNHGGPAEIIVNGKSGFHIDPYHGEQAADLLADFFEKCKTQPSHWETIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE V
Sbjct  741  TGGLKRIQEKYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAAE  805



>gb|AHL84158.1| sucrose synthase [Nicotiana tabacum]
Length=805

 Score =   244 bits (624),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFATNHGGPAEIIV+GKSGFHIDPYHGEQAA+LL DFFEKCK +PSHWETIS
Sbjct  681  EAMTCGLPTFATNHGGPAEIIVNGKSGFHIDPYHGEQAADLLADFFEKCKTEPSHWETIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYL+MFYALK+RK+AE V
Sbjct  741  TGGLKRIQEKYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLDMFYALKYRKMAEAV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAAE  805



>ref|XP_006353766.1| PREDICTED: sucrose synthase 2 isoform X2 [Solanum tuberosum]
Length=805

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAM+CGLPTFATN GGPAEIIVHGKSGF IDPYHGEQAA+LL DFFEKCK DPSHWE IS
Sbjct  681  EAMSCGLPTFATNQGGPAEIIVHGKSGFQIDPYHGEQAADLLADFFEKCKVDPSHWEAIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLA+ V
Sbjct  741  EGGLKRIQEKYTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAQLV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>ref|NP_001274911.1| sucrose synthase 2 [Solanum tuberosum]
 gb|AAO34668.1| sucrose synthase 2 [Solanum tuberosum]
Length=805

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAM+CGLPTFATN GGPAEIIVHGKSGF IDPYHGEQAA+LL DFFEKCK DPSHWE IS
Sbjct  681  EAMSCGLPTFATNQGGPAEIIVHGKSGFQIDPYHGEQAADLLADFFEKCKVDPSHWEAIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLA+ V
Sbjct  741  EGGLKRIQEKYTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAQLV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>sp|P49039.1|SUS2_SOLTU RecName: Full=Sucrose synthase; AltName: Full=SS65; AltName: 
Full=Sucrose-UDP glucosyltransferase [Solanum tuberosum]
 gb|AAA97572.1| sucrose synthase [Solanum tuberosum]
Length=805

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAM+CGLPTFATN GGPAEIIVHGKSGF IDPYHGEQAA+LL DFFEKCK DPSHWE IS
Sbjct  681  EAMSCGLPTFATNQGGPAEIIVHGKSGFQIDPYHGEQAADLLADFFEKCKVDPSHWEAIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLA+ V
Sbjct  741  EGGLKRIQEKYTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAQLV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>ref|XP_010323602.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323603.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323604.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323605.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 gb|ADM47608.1| sucrose synthase isoform 3 [Solanum lycopersicum]
Length=805

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAM+CGLPTFATN GGPAEIIVHGKSGF IDPYHGEQAA+LL +FFEKCK DPSHWE IS
Sbjct  681  EAMSCGLPTFATNQGGPAEIIVHGKSGFQIDPYHGEQAADLLAEFFEKCKVDPSHWEAIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE V
Sbjct  741  KGGLKRIQEKYTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAELV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>ref|NP_001234804.1| sucrose synthase [Solanum lycopersicum]
 emb|CAA09593.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   243 bits (621),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAM+CGLPTFATN GGPAEIIVHGKSGF IDPYHGEQAA+LL +FFEKCK DPSHWE IS
Sbjct  681  EAMSCGLPTFATNQGGPAEIIVHGKSGFQIDPYHGEQAADLLAEFFEKCKVDPSHWEAIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE V
Sbjct  741  KGGLKRIQEKYTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAELV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>ref|XP_009760458.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
 ref|XP_009760459.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
Length=805

 Score =   243 bits (620),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFATNHGGPAEIIV+GKSGFHIDPYHGEQAA+LL DFFEKCK +P HWETIS
Sbjct  681  EAMTCGLPTFATNHGGPAEIIVNGKSGFHIDPYHGEQAADLLADFFEKCKTEPYHWETIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE V
Sbjct  741  TGGLKRIQEKYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAAE  805



>ref|XP_011078145.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078146.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078147.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078148.1| PREDICTED: sucrose synthase [Sesamum indicum]
Length=805

 Score =   243 bits (619),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT HGGPAEIIVHGKSGFHIDPY+GEQ AE LV+FFEKCKKDPSHWETIS
Sbjct  681  EAMTCGLPTFATVHGGPAEIIVHGKSGFHIDPYNGEQVAETLVNFFEKCKKDPSHWETIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
            AGGLKRI EKYTWQIYSDRLLTLA VYGFWK+VSKLDRLEIRRYLEMFYALK+RKLAE V
Sbjct  741  AGGLKRIMEKYTWQIYSDRLLTLAGVYGFWKYVSKLDRLEIRRYLEMFYALKYRKLAEAV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAAE  805



>sp|P49035.1|SUS1_DAUCA RecName: Full=Sucrose synthase isoform 1; AltName: Full=Sucrose 
synthase isoform I; AltName: Full=Sucrose-UDP glucosyltransferase 
1; AltName: Full=Susy*Dc1 [Daucus carota]
 emb|CAA53081.1| sucrose synthase [Daucus carota]
 emb|CAA76056.1| sucrose synthase isoform I [Daucus carota]
Length=808

 Score =   241 bits (614),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT HGGPAEIIVHGKSGFHIDPYHGEQ AELLV+FFEKCK DPS W+ IS
Sbjct  683  EAMTCGLPTFATLHGGPAEIIVHGKSGFHIDPYHGEQVAELLVNFFEKCKTDPSQWDAIS  742

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
            AGGLKRIQEKYTWQIYS+RLLTLA VYGFWKHVSKLDRLEIRRYLEMFYALK+RKLAE V
Sbjct  743  AGGLKRIQEKYTWQIYSERLLTLAGVYGFWKHVSKLDRLEIRRYLEMFYALKYRKLAESV  802

Query  349  PLA  341
            PLA
Sbjct  803  PLA  805



>emb|CAI56307.1| sucrose synthase [Coffea canephora]
 emb|CDP03035.1| unnamed protein product [Coffea canephora]
Length=806

 Score =   239 bits (610),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFATNHGGPAEII+HGKSGFHIDPYHGEQ +ELL +FFE+CKK+PS+W+TIS
Sbjct  681  EAMTCGLPTFATNHGGPAEIIIHGKSGFHIDPYHGEQVSELLANFFERCKKEPSYWDTIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
            AGGLKRIQEKYTWQIYSDRLLTLA VYGFWK VSKLDR EIRRYLEMFYALK+RKLAE V
Sbjct  741  AGGLKRIQEKYTWQIYSDRLLTLAGVYGFWKCVSKLDRQEIRRYLEMFYALKYRKLAEAV  800

Query  349  PLAIE  335
            PLA++
Sbjct  801  PLAVD  805



>emb|CAJ32596.1| sucrose synthase [Coffea arabica]
Length=806

 Score =   239 bits (610),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFATNHGGPAEII+HGKSGFHIDPYHGEQ +ELL +FFE+CKK+PS+W+TIS
Sbjct  681  EAMTCGLPTFATNHGGPAEIIIHGKSGFHIDPYHGEQVSELLANFFERCKKEPSYWDTIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
            AGGLKRIQEKYTWQIYSDRLLTLA VYGFWK VSKLDR EIRRYLEMFYALK+RKLAE V
Sbjct  741  AGGLKRIQEKYTWQIYSDRLLTLAGVYGFWKCVSKLDRQEIRRYLEMFYALKYRKLAEAV  800

Query  349  PLAIE  335
            PLA++
Sbjct  801  PLAVD  805



>gb|ABI17891.1| sucrose synthase [Coffea canephora]
Length=806

 Score =   237 bits (605),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFATNHGGPAEII+HGKSGFHIDPYHGEQ +ELL +FFE+CKK+PS+W+TI 
Sbjct  681  EAMTCGLPTFATNHGGPAEIIIHGKSGFHIDPYHGEQVSELLANFFERCKKEPSYWDTIP  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
            AGGLKRIQEKYTWQIYSDRLLTLA VYGFWK VSKLDR EIRRYLEMFYALK+RKLAE V
Sbjct  741  AGGLKRIQEKYTWQIYSDRLLTLAGVYGFWKCVSKLDRQEIRRYLEMFYALKYRKLAEAV  800

Query  349  PLAIE  335
            PLA++
Sbjct  801  PLAVD  805



>sp|O49845.1|SUS2_DAUCA RecName: Full=Sucrose synthase isoform 2; AltName: Full=Sucrose 
synthase isoform II; AltName: Full=Sucrose-UDP glucosyltransferase 
2; AltName: Full=Susy*Dc2 [Daucus carota]
 emb|CAA76057.1| sucrose synthase isoform II [Daucus carota]
Length=801

 Score =   235 bits (600),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT HGGPAEIIVHG SGFHIDPYHGE+AAEL+V+FFE+CK +PSHWETIS
Sbjct  677  EAMTCGLPTFATIHGGPAEIIVHGTSGFHIDPYHGEKAAELIVNFFERCKTEPSHWETIS  736

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
            AGGLKRIQEKYTWQIYS+RLLTL  VYGFWKHVSKLDR+EIRRYLEMF ALK+R LAE V
Sbjct  737  AGGLKRIQEKYTWQIYSERLLTLGGVYGFWKHVSKLDRIEIRRYLEMFCALKYRNLAESV  796

Query  349  PLAIE  335
            PLA++
Sbjct  797  PLAVD  801



>gb|AHL29281.1| sucrose synthase 1 [Camellia sinensis]
Length=805

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT++GGPAEII+HGKSGFHIDPYHG+Q AELLV+F+E+C KDPSHW+ IS
Sbjct  681  EAMTCGLPTFATSYGGPAEIIIHGKSGFHIDPYHGDQVAELLVNFYERCSKDPSHWDEIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
            AGGL+RI EKYTWQIYS+RL+TLA VYGFWK+VSKLDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  AGGLQRIMEKYTWQIYSERLMTLAGVYGFWKYVSKLDRLETRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLAIE
Sbjct  801  PLAIE  805



>gb|AEN79500.1| sucrose synthase 1 [Orobanche ramosa]
Length=805

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMT GLPTFAT HGGPAEIIV GKSGFHIDPY+GEQ AE LV FFEKC KDPSHWE IS
Sbjct  681  EAMTRGLPTFATLHGGPAEIIVDGKSGFHIDPYNGEQVAETLVSFFEKCNKDPSHWEAIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYSDRLLTLA VYGFWK+VSKLDRLEIRRYLEMFYALK+RKLAE V
Sbjct  741  TGGLKRIQEKYTWQIYSDRLLTLAGVYGFWKYVSKLDRLEIRRYLEMFYALKYRKLAEAV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>gb|ADA68250.1| sucrose synthase, partial [Schiedea globosa]
 dbj|BAN18490.1| sucrose synthase, partial [Schiedea spergulina]
 dbj|BAN18491.1| sucrose synthase, partial [Schiedea kealiae]
 dbj|BAN18492.1| sucrose synthase, partial [Schiedea mannii]
 dbj|BAN18493.1| sucrose synthase, partial [Schiedea menziesii]
 dbj|BAN18494.1| sucrose synthase, partial [Schiedea hookeri]
 dbj|BAN18495.1| sucrose synthase, partial [Schiedea sarmentosa]
 dbj|BAN18496.1| sucrose synthase, partial [Schiedea lydgatei]
 dbj|BAN18497.1| sucrose synthase, partial [Schiedea haleakalensis]
 dbj|BAN18498.1| sucrose synthase, partial [Schiedea salicaria]
 dbj|BAN18499.1| sucrose synthase, partial [Schiedea globosa]
Length=118

 Score =   214 bits (545),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  685  TFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQ  506
            TFAT HGGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+
Sbjct  1    TFATCHGGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIE  60

Query  505  EKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            EKYTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  61   EKYTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  117



>gb|ADR00484.1| sucrose synthase [Arachis hypogaea var. vulgaris]
Length=490

 Score =   226 bits (576),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFF+KCK DP+HW+ IS
Sbjct  365  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFDKCKVDPTHWDNIS  424

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE V
Sbjct  425  QGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESV  484

Query  349  PLAIE  335
            PLA+E
Sbjct  485  PLAVE  489



>dbj|BAD94975.1| sucrose-UDP glucosyltransferase [Arabidopsis thaliana]
Length=279

 Score =   219 bits (559),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS
Sbjct  154  EAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEIS  213

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ V
Sbjct  214  KGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAV  273

Query  349  PLA  341
            PLA
Sbjct  274  PLA  276



>dbj|BAN18500.1| sucrose synthase, partial [Schiedea pentandra]
 dbj|BAN18501.1| sucrose synthase, partial [Schiedea kauaiensis]
 dbj|BAN18502.1| sucrose synthase, partial [Schiedea perlmanii]
 dbj|BAN18509.1| sucrose synthase, partial [Schiedea stellarioides]
Length=118

 Score =   214 bits (544),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  685  TFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQ  506
            TFAT HGGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE +S GGLKRI+
Sbjct  1    TFATCHGGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAVSLGGLKRIE  60

Query  505  EKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            EKYTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  61   EKYTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  117



>gb|AFS17277.1| sucrose synthase 1 [Amaranthus cruentus/Amaranthus hypocondriacus 
mixed library]
Length=803

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            E+MTCGLPTFAT HGGPAEIIVHGKSGFHIDPYHG++AAELLVDFF+K K DP+HWETIS
Sbjct  678  ESMTCGLPTFATCHGGPAEIIVHGKSGFHIDPYHGDKAAELLVDFFKKSKADPTHWETIS  737

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTWQIYSDRLLTLA VYGFWK+VS LDR E RRYLEMFYALK++KLAE V
Sbjct  738  KGGLKRIEEKYTWQIYSDRLLTLAGVYGFWKYVSNLDRREARRYLEMFYALKYKKLAESV  797

Query  349  PLAIE  335
            PLAIE
Sbjct  798  PLAIE  802



>dbj|BAN18504.1| sucrose synthase, partial [Schiedea trinervis]
 dbj|BAN18505.1| sucrose synthase, partial [Schiedea obovata]
 dbj|BAN18506.1| sucrose synthase, partial [Schiedea viscosa]
 dbj|BAN18507.1| sucrose synthase, partial [Schiedea verticillata]
Length=118

 Score =   213 bits (542),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  685  TFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQ  506
            TFAT HGGPAEIIV+G+SGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+
Sbjct  1    TFATCHGGPAEIIVNGQSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIE  60

Query  505  EKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            EKYTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  61   EKYTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  117



>gb|AGH29112.1| sucrose synthase [Jatropha curcas]
Length=805

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHGEQAA+LLVDFFEKCK DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGEQAAQLLVDFFEKCKVDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL +E
Sbjct  801  PLTVE  805



>ref|XP_004287669.1| PREDICTED: sucrose synthase [Fragaria vesca subsp. vesca]
 ref|XP_011461050.1| PREDICTED: sucrose synthase [Fragaria vesca subsp. vesca]
Length=806

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSG+HIDPYHGEQAAE+LVDFFEKCKKDPSHW+ IS
Sbjct  682  EAMTCGLPTFATCKGGPAEIIVHGKSGYHIDPYHGEQAAEILVDFFEKCKKDPSHWDKIS  741

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTWQIYS+RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK++KLA+ V
Sbjct  742  QGGLKRIEEKYTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYKKLADSV  801

Query  349  PLAIE  335
            PLA E
Sbjct  802  PLAEE  806



>gb|KDP33978.1| hypothetical protein JCGZ_07549 [Jatropha curcas]
Length=805

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHGEQAA+LLVDFFEKCK DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGEQAAQLLVDFFEKCKVDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL +E
Sbjct  801  PLTVE  805



>ref|XP_011010968.1| PREDICTED: sucrose synthase-like isoform X1 [Populus euphratica]
Length=812

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFF+KCK DP+HWE IS
Sbjct  688  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFDKCKVDPAHWEKIS  747

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  748  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  807

Query  349  PLAIE  335
            PL  E
Sbjct  808  PLTKE  812



>ref|XP_011010969.1| PREDICTED: sucrose synthase-like isoform X2 [Populus euphratica]
Length=805

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFF+KCK DP+HWE IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFDKCKVDPAHWEKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ABD61653.1| sucrose synthase [Cichorium intybus]
Length=806

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT HGGPAEIIVHGKSGFHIDPYHG+Q  +LLV FFEK K DPSHWE IS
Sbjct  681  EAMTCGLPTFATLHGGPAEIIVHGKSGFHIDPYHGDQVTDLLVKFFEKTKVDPSHWEAIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             G  +RIQEKYTWQIYSDRLLTLA VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE V
Sbjct  741  KGAEQRIQEKYTWQIYSDRLLTLAGVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAESV  800

Query  349  PLAIE  335
            PLA++
Sbjct  801  PLAVD  805



>gb|ADW80556.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADW80565.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADW80571.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADW80558.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADW80549.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADW80546.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADW80563.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADW80543.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADW80534.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADW80555.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADW80552.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADW80551.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADW80536.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80544.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80561.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80567.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80568.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADW80559.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADW80548.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADW80550.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADW80566.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADW80541.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80542.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80547.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80553.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80554.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80564.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADW80535.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80537.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADW80560.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADV71181.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80538.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80557.1| sucrose synthase 1 [Populus tomentosa]
 gb|AFZ78658.1| sucrose synthase [Populus tomentosa]
Length=805

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADW80562.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|KJB65372.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
 gb|KJB65373.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
 gb|KJB65374.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=806

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFF+KCKKDPSHW  IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFDKCKKDPSHWNDIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE V
Sbjct  741  EGGLKRIQEKYTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>gb|ADW80570.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADW80539.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80569.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|ADW80540.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>emb|CAA67195.1| sucrose synthase [Pisum sativum]
Length=164

 Score =   213 bits (542),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 110/126 (87%), Gaps = 1/126 (1%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAM  GLPTFAT +GGPAEIIVHGKSGFHIDPYHGE AA+LLV+FFEK K DPSHW+ IS
Sbjct  38   EAMATGLPTFATLNGGPAEIIVHGKSGFHIDPYHGEGAADLLVEFFEKVKSDPSHWDKIS  97

Query  529  -AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  353
              GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RK AE 
Sbjct  98   LKGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKSAES  157

Query  352  VPLAIE  335
            VPLA+E
Sbjct  158  VPLAVE  163



>ref|XP_007012546.1| Sucrose synthase 4 isoform 1 [Theobroma cacao]
 gb|EOY30165.1| Sucrose synthase 4 isoform 1 [Theobroma cacao]
Length=852

 Score =   229 bits (584),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS
Sbjct  727  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKADPSYWNKIS  786

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE V
Sbjct  787  EGGLKRIQEKYTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESV  846

Query  349  PLAIE  335
            PLA+E
Sbjct  847  PLAVE  851



>ref|XP_007012547.1| Sucrose synthase 4 isoform 2 [Theobroma cacao]
 gb|EOY30166.1| Sucrose synthase 4 isoform 2 [Theobroma cacao]
Length=806

 Score =   229 bits (583),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKADPSYWNKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE V
Sbjct  741  EGGLKRIQEKYTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>gb|ADA68252.1| sucrose synthase, partial [Honckenya peploides]
Length=118

 Score =   211 bits (538),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -1

Query  685  TFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQ  506
            TFAT HGGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+
Sbjct  1    TFATCHGGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIK  60

Query  505  EKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            EKYTWQIYSDRLLTLA VYGFWK+VS LD LE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  61   EKYTWQIYSDRLLTLAGVYGFWKYVSNLDHLEARRYLEMFYALKYRKLAESVPLAIE  117



>gb|AIJ28960.1| sucrose synthase [Manihot esculenta subsp. flabellifolia]
Length=806

 Score =   229 bits (583),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLV+FFEKCK DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVEFFEKCKADPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             G ++RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  QGAMQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRLESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL +E
Sbjct  801  PLTVE  805



>ref|XP_004508035.1| PREDICTED: sucrose synthase-like isoform X3 [Cicer arietinum]
Length=806

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAM CGLPTFAT +GGPAEIIVHGKSGFHIDPYHGE+AA+LLV+FFEKCK DPSHW+ IS
Sbjct  681  EAMGCGLPTFATLNGGPAEIIVHGKSGFHIDPYHGERAADLLVEFFEKCKVDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>gb|AFO84090.1| sucrose synthase [Actinidia chinensis]
Length=806

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT HGGPAEII+HGKSGFHIDPYHG+Q AELLV+F+EKCK DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCHGGPAEIIIHGKSGFHIDPYHGDQVAELLVNFYEKCKVDPSHWDAIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI EKYTWQIYS+RL+TLA VYGFWK+VSKLDR E RRYLEMFYALK+RKLAE V
Sbjct  741  EGGLKRILEKYTWQIYSERLMTLAGVYGFWKYVSKLDRRETRRYLEMFYALKYRKLAEAV  800

Query  349  PLAIE  335
            PLA++
Sbjct  801  PLAVD  805



>ref|XP_003551045.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006600427.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=805

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEKCK DP+HWETIS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFEKCKLDPTHWETIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
              GL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE V
Sbjct  741  KAGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>gb|ADA68251.1| sucrose synthase, partial [Schiedea membranacea]
 dbj|BAN18503.1| sucrose synthase, partial [Schiedea helleri]
 dbj|BAN18508.1| sucrose synthase, partial [Schiedea membranacea]
Length=118

 Score =   211 bits (537),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -1

Query  685  TFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQ  506
            TFAT HGGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK D SHWE IS GGLKRI+
Sbjct  1    TFATCHGGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDLSHWEAISLGGLKRIE  60

Query  505  EKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            EKYTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  61   EKYTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  117



>gb|AEE60913.1| nodule-enhanced sucrose synthase [Cicer arietinum]
Length=806

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAM CGLPTFAT +GGPAEIIVHGKSGFHIDPYHGE+AA+LLV+FFEKCK DPSHW+ IS
Sbjct  681  EAMGCGLPTFATLNGGPAEIIVHGKSGFHIDPYHGERAADLLVEFFEKCKVDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>gb|KHN17754.1| Sucrose synthase [Glycine soja]
Length=805

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEKCK DP+HWETIS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFEKCKLDPTHWETIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
              GL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE V
Sbjct  741  KAGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>gb|KJB82966.1| hypothetical protein B456_013G222400 [Gossypium raimondii]
Length=806

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKTDPSYWTKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  EGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>gb|AEV40460.1| sucrose synthase 1 [Gossypium arboreum]
 gb|AFM52232.1| putative sucrose synthase 1 [Gossypium arboreum]
Length=806

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKTDPSYWTKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  EGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>gb|AHA41509.1| sucrose synthase [Populus deltoides]
Length=805

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIV+GKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVNGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>gb|KHG00606.1| Sucrose synthase [Gossypium arboreum]
Length=814

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS
Sbjct  689  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKTDPSYWTKIS  748

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  749  EGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  808

Query  349  PLAIE  335
            PLA+E
Sbjct  809  PLAVE  813



>dbj|BAM68521.1| sucrose synthase [Mangifera indica]
 dbj|BAM68528.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPSHW+ IS
Sbjct  676  EAMTCGLPTFATCNGGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKADPSHWDKIS  735

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  736  QGGLKRIEEKYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESV  795

Query  349  PLAIE  335
            PLA+E
Sbjct  796  PLAVE  800



>dbj|BAM37539.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPSHW+ IS
Sbjct  676  EAMTCGLPTFATCNGGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKADPSHWDKIS  735

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  736  QGGLKRIEEKYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESV  795

Query  349  PLAIE  335
            PLA+E
Sbjct  796  PLAVE  800



>ref|XP_007154543.1| hypothetical protein PHAVU_003G127500g [Phaseolus vulgaris]
 gb|ESW26537.1| hypothetical protein PHAVU_003G127500g [Phaseolus vulgaris]
Length=805

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEKCK +PSHW+TIS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKCKVEPSHWDTIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
              GL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  QAGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>gb|AAN76498.1|AF315375_1 sucrose synthase [Phaseolus vulgaris]
Length=805

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEKCK +PSHW+TIS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKCKVEPSHWDTIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
              GL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  QAGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>dbj|BAA88905.1| sucrose synthase [Citrus unshiu]
Length=805

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS
Sbjct  681  EAMTCGLPTFATCKGGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  LGGLKRIEEKYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>ref|XP_006474580.1| PREDICTED: sucrose synthase-like isoform X1 [Citrus sinensis]
 ref|XP_006474581.1| PREDICTED: sucrose synthase-like isoform X2 [Citrus sinensis]
 ref|XP_006474582.1| PREDICTED: sucrose synthase-like isoform X3 [Citrus sinensis]
 ref|XP_006474583.1| PREDICTED: sucrose synthase-like isoform X4 [Citrus sinensis]
 ref|XP_006474584.1| PREDICTED: sucrose synthase-like isoform X5 [Citrus sinensis]
 ref|XP_006474585.1| PREDICTED: sucrose synthase-like isoform X6 [Citrus sinensis]
 ref|XP_006474586.1| PREDICTED: sucrose synthase-like isoform X7 [Citrus sinensis]
 ref|XP_006474587.1| PREDICTED: sucrose synthase-like isoform X8 [Citrus sinensis]
 gb|KDO73779.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73780.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73781.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73782.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73783.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73784.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73785.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|AIN45138.1| sucrose synthase [Citrus suavissima]
Length=805

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS
Sbjct  681  EAMTCGLPTFATCKGGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  LGGLKRIEEKYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>gb|ADW80545.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIHEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>dbj|BAA89049.1| sucrose synthase [Citrus unshiu]
Length=805

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS
Sbjct  681  EAMTCGLPTFATCKGGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  LGGLKRIEEKYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>ref|XP_006452883.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452884.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452885.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452886.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452887.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452888.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452889.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452890.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452891.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66123.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66124.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66125.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66126.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66127.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66128.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66129.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66130.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66131.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
Length=806

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS
Sbjct  681  EAMTCGLPTFATCKGGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  LGGLKRIEEKYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>emb|CAB39757.2| sucrose synthase [Lotus japonicus]
Length=233

 Score =   214 bits (544),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSG+HIDPYHG++AAE LV+FFEK K DPS+W+ IS
Sbjct  108  EAMTCGLPTFATCNGGPAEIIVHGKSGYHIDPYHGDRAAETLVEFFEKSKADPSYWDKIS  167

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI EKYTW+IYSDRLLTL  VYGFWKHV+ LDR E +RYLEMFYALK+ KLAE V
Sbjct  168  QGGLQRIHEKYTWKIYSDRLLTLTGVYGFWKHVTNLDRRENKRYLEMFYALKYSKLAESV  227

Query  349  PLAIE  335
            PLA+E
Sbjct  228  PLAVE  232



>gb|KDO73788.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
Length=783

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS
Sbjct  659  EAMTCGLPTFATCKGGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKIS  718

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  719  LGGLKRIEEKYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  778

Query  349  PLAIE  335
            PLA+E
Sbjct  779  PLAVE  783



>gb|AEV40463.1| sucrose synthase 4 [Gossypium arboreum]
 gb|AFM52235.1| putative sucrose synthase 4 [Gossypium arboreum]
 gb|KHG06249.1| Sucrose synthase [Gossypium arboreum]
Length=806

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFF+KCKK+PSHW  IS
Sbjct  681  EAMTCGLPTFATCKGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFDKCKKEPSHWNDIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE V
Sbjct  741  EGGLKRIQEKYTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>gb|AEQ94149.1| sucrose synthase1 [Elaeis guineensis]
Length=235

 Score =   213 bits (543),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            E+MTCGLPTFAT HGGPAEIIVHG SGFHIDPY G++AAELLVDFFEKCK+DPSHW  IS
Sbjct  102  ESMTCGLPTFATCHGGPAEIIVHGVSGFHIDPYQGDKAAELLVDFFEKCKEDPSHWAKIS  161

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTW++YS+RL+TL+ VYGFWK+VS LDR E RRYLEMFYALK+R LA+ V
Sbjct  162  QGGLQRIEEKYTWKLYSERLMTLSGVYGFWKYVSNLDRRETRRYLEMFYALKYRNLAKSV  221

Query  349  PL  344
            PL
Sbjct  222  PL  223



>gb|AEV40464.1| sucrose synthase 5 [Gossypium arboreum]
Length=833

 Score =   226 bits (577),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFF+KCKK+PSHW  IS
Sbjct  708  EAMTCGLPTFATCKGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFDKCKKEPSHWNDIS  767

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE V
Sbjct  768  EGGLKRIQEKYTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESV  827

Query  349  PLAIE  335
            PLA E
Sbjct  828  PLAEE  832



>gb|AEF56625.1| sucrose synthase [Arachis hypogaea var. vulgaris]
Length=806

 Score =   226 bits (576),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFF+KCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFDKCKVDPTHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>gb|ADR81996.1| sucrose synthase 1 [Populus trichocarpa]
 gb|ADV71183.1| sucrose synthase 1 [Populus trichocarpa]
Length=805

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIV+GKSGFHIDPYHGE+AAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVNGKSGFHIDPYHGEKAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>ref|XP_002324136.2| sucrose synthase family protein [Populus trichocarpa]
 gb|EEF02701.2| sucrose synthase family protein [Populus trichocarpa]
Length=805

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIV+GKSGFHIDPYHGE+AAELLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVNGKSGFHIDPYHGEKAAELLVDFFEKCKVDPAHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  HGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>dbj|BAM68527.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPS+W+ IS
Sbjct  676  EAMTCGLPTFATCNGGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKADPSYWDKIS  735

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  736  QGGLKRIEEKYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESV  795

Query  349  PLAIE  335
            PLA+E
Sbjct  796  PLAVE  800



>dbj|BAM68520.1| sucrose synthase [Mangifera indica]
 dbj|BAM68522.1| sucrose synthase [Mangifera indica]
 dbj|BAM68523.1| sucrose synthase [Mangifera indica]
 dbj|BAM68524.1| sucrose synthase [Mangifera indica]
 dbj|BAM68525.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPS+W+ IS
Sbjct  676  EAMTCGLPTFATCNGGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKADPSYWDKIS  735

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  736  QGGLKRIEEKYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESV  795

Query  349  PLAIE  335
            PLA+E
Sbjct  796  PLAVE  800



>gb|AEN71067.1| sucrose synthase Sus1 [Gossypium tomentosum]
Length=805

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>gb|ADY68848.1| sucrose synthase [Gossypium hirsutum]
Length=805

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>gb|AEN71079.1| sucrose synthase Sus1 [Gossypium aridum]
Length=805

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>gb|AEN71075.1| sucrose synthase Sus1 [Gossypium armourianum]
 gb|AEN71076.1| sucrose synthase Sus1 [Gossypium harknessii]
Length=805

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>dbj|BAM68526.1| sucrose synthase [Mangifera indica]
 dbj|BAM68529.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPS+W+ IS
Sbjct  676  EAMTCGLPTFATCNGGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKVDPSYWDKIS  735

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  736  QGGLKRIEEKYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESV  795

Query  349  PLAIE  335
            PLA+E
Sbjct  796  PLAVE  800



>gb|AEN71080.1| sucrose synthase Sus1 [Gossypium gossypioides]
Length=805

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>gb|AEN71068.1| sucrose synthase Sus1 [Gossypium tomentosum]
Length=805

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>gb|AEV40462.1| sucrose synthase 3 [Gossypium arboreum]
 gb|AFM52234.1| putative sucrose synthase 3 [Gossypium arboreum]
 gb|KHG30366.1| Sucrose synthase [Gossypium arboreum]
Length=805

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>gb|AGO61958.1| sucrose synthase, partial [Prunus serrulata]
Length=437

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSG+HIDPYHG+QAAE+LVDFFEK + DPSHW+ IS
Sbjct  312  EAMTCGLPTFATCKGGPAEIIVHGKSGYHIDPYHGDQAAEILVDFFEKSRADPSHWDKIS  371

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI EKYT QIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  372  QGGLQRIFEKYTRQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  431

Query  349  PLAIE  335
            PLA E
Sbjct  432  PLAEE  436



>gb|AEN71059.1| sucrose synthase Sus1 [Gossypium thurberi]
 gb|AEN71082.1| sucrose synthase Sus1 [Gossypium trilobum]
Length=805

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>gb|AEN71063.1| sucrose synthase Sus1 [Gossypium mustelinum]
 gb|AEN71065.1| sucrose synthase Sus1 [Gossypium darwinii]
 gb|AEN71069.1| sucrose synthase Sus1 [Gossypium barbadense var. brasiliense]
 gb|AEN71071.1| sucrose synthase Sus1 [Gossypium barbadense var. peruvianum]
 gb|AEN71073.1| sucrose synthase Sus1 [Gossypium hirsutum subsp. latifolium]
Length=805

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>gb|ADY68845.1| sucrose synthase [Gossypium barbadense]
 gb|ADY68847.1| sucrose synthase [Gossypium raimondii]
 gb|AEN71062.1| sucrose synthase Sus1 [Gossypium turneri]
 gb|AEN71064.1| sucrose synthase Sus1 [Gossypium mustelinum]
 gb|AEN71070.1| sucrose synthase Sus1 [Gossypium barbadense var. brasiliense]
 gb|AEN71072.1| sucrose synthase Sus1 [Gossypium barbadense var. peruvianum]
 gb|AEN71077.1| sucrose synthase Sus1 [Gossypium davidsonii]
 gb|KJB54536.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
 gb|KJB54537.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
 gb|KJB54538.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=805

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>gb|AEN71078.1| sucrose synthase Sus1 [Gossypium klotzschianum]
Length=805

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>gb|AEN71066.1| sucrose synthase Sus1 [Gossypium darwinii]
Length=805

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>gb|AEN71061.1| sucrose synthase Sus1 [Gossypium schwendimanii]
Length=805

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>gb|AAK59464.1| putative sucrose synthase [Arabidopsis thaliana]
Length=532

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AAE L DFF KCK DPSHW+ IS
Sbjct  407  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDKAAESLADFFTKCKHDPSHWDQIS  466

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ V
Sbjct  467  LGGLERIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAV  526

Query  349  PLAIE  335
            PLA E
Sbjct  527  PLAHE  531



>gb|AAD28641.1| sucrose synthase [Gossypium hirsutum]
Length=806

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS
Sbjct  682  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKIS  741

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE V
Sbjct  742  QGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESV  801

Query  349  PLAIE  335
            PLA E
Sbjct  802  PLAEE  806



>gb|ACV72640.1| sucrose synthase 1 [Gossypium hirsutum]
 gb|ADY68849.1| sucrose synthase [Gossypium hirsutum]
 gb|AEN71074.1| sucrose synthase Sus1 [Gossypium hirsutum subsp. latifolium]
Length=805

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>gb|ADY68846.1| sucrose synthase [Gossypium herbaceum subsp. africanum]
Length=805

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>gb|AEK81520.1| sucrose synthase isoform B [Gossypium hirsutum]
Length=805

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+L DFF+KCKKDPSHW  IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILADFFDKCKKDPSHWNDIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+ KLAE V
Sbjct  741  EGGLKRIQEKYTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYPKLAESV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>gb|ADY68844.1| sucrose synthase [Gossypium barbadense]
Length=805

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>gb|AEK81522.1| sucrose synthase isoform D [Gossypium hirsutum]
Length=806

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK D S+W  IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKTDSSYWTKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  EGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>ref|XP_010687574.1| PREDICTED: sucrose synthase [Beta vulgaris subsp. vulgaris]
Length=805

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT HGGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEK   DPS+WE IS
Sbjct  678  EAMTCGLPTFATCHGGPAEIIVHGKSGFHIDPYHGDKAADLLVDFFEKSTADPSYWENIS  737

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTW+IYSDRLLTLA VYGFWK+VS LDR E RRYLEMFYALK++KLAE V
Sbjct  738  KGGLQRIEEKYTWKIYSDRLLTLAGVYGFWKYVSNLDRREARRYLEMFYALKYKKLAESV  797

Query  349  PLAIE  335
            PLAIE
Sbjct  798  PLAIE  802



>gb|AAR19769.1| sucrose synthase [Beta vulgaris]
Length=805

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT HGGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEK   DPS+WE IS
Sbjct  678  EAMTCGLPTFATCHGGPAEIIVHGKSGFHIDPYHGDKAADLLVDFFEKSTADPSYWENIS  737

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTW+IYSDRLLTLA VYGFWK+VS LDR E RRYLEMFYALK++KLAE V
Sbjct  738  KGGLQRIEEKYTWKIYSDRLLTLAGVYGFWKYVSNLDRREARRYLEMFYALKYKKLAESV  797

Query  349  PLAIE  335
            PLAIE
Sbjct  798  PLAIE  802



>gb|AAR03498.1| sucrose synthase [Populus tremuloides]
Length=805

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  741  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL  E
Sbjct  801  PLTKE  805



>ref|XP_010047438.1| PREDICTED: sucrose synthase [Eucalyptus grandis]
 gb|KCW79350.1| hypothetical protein EUGRSUZ_C00769 [Eucalyptus grandis]
Length=805

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAAE L +FFEKCK DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAAETLANFFEKCKVDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             G ++RI+EKYTWQIYS+RLL L +VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  QGAMQRIKEKYTWQIYSERLLNLTAVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>gb|AIJ28962.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLV+FFEKCK DP HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVEFFEKCKADPPHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             G ++RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE V
Sbjct  741  QGAMQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL +E
Sbjct  801  PLTVE  805



>ref|XP_010271909.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
Length=806

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT HGGPAEIIVHGKSGFHIDPY G++AAELLV FFEKCK+DPSHWE IS
Sbjct  681  EAMTCGLPTFATCHGGPAEIIVHGKSGFHIDPYQGDRAAELLVHFFEKCKEDPSHWEKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI EKYTWQIYS+RL+TL+ VYGFWK+VSKL+R E RRYLEMFYALK+RKLA+ V
Sbjct  741  QGGLKRIHEKYTWQIYSERLMTLSGVYGFWKYVSKLERRETRRYLEMFYALKYRKLAQMV  800

Query  349  PLAIE  335
            PLA++
Sbjct  801  PLAVD  805



>gb|AGM14949.1| sucrose synthase 4 [Hevea brasiliensis]
Length=806

 Score =   224 bits (571),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLVDFFEK K DPSHW  IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVDFFEKSKADPSHWNNIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             G ++RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE V
Sbjct  741  QGAMQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL +E
Sbjct  801  PLTVE  805



>gb|ADK98097.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98098.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98099.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98100.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98104.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98105.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98106.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98107.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98108.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98110.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98111.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98114.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98115.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98117.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98119.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADW09893.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09894.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09899.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09900.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09902.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09909.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09910.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09919.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09920.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09931.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09932.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09935.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09937.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09938.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   207 bits (526),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -1

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_002275155.1| PREDICTED: sucrose synthase [Vitis vinifera]
 ref|XP_010656083.1| PREDICTED: sucrose synthase [Vitis vinifera]
 ref|XP_010656084.1| PREDICTED: sucrose synthase [Vitis vinifera]
 emb|CBI27755.3| unnamed protein product [Vitis vinifera]
Length=806

 Score =   224 bits (570),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AAELL +FFEKCK DP+HWE IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDKAAELLANFFEKCKADPTHWEKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
              GLKRI+EKYTW+IYS+RLLTLA VYGFWK+VS LDR E RRYLEMFYALK+RKLA+ V
Sbjct  741  KAGLKRIEEKYTWKIYSERLLTLAGVYGFWKYVSNLDRRETRRYLEMFYALKYRKLAQSV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>gb|ABD96570.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   224 bits (570),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLV FFEKCK DPSHW  IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVQFFEKCKADPSHWIKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             G ++RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE V
Sbjct  741  EGAMQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL +E
Sbjct  801  PLTVE  805



>emb|CAN82840.1| hypothetical protein VITISV_024563 [Vitis vinifera]
Length=806

 Score =   224 bits (570),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AAELL +FFEKCK DP+HWE IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDKAAELLANFFEKCKADPTHWEKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
              GLKRI+EKYTW+IYS+RLLTLA VYGFWK+VS LDR E RRYLEMFYALK+RKLA+ V
Sbjct  741  KAGLKRIEEKYTWKIYSERLLTLAGVYGFWKYVSNLDRRETRRYLEMFYALKYRKLAQSV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>gb|AIJ28961.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   224 bits (570),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLV FFEKCK DPSHW  IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVQFFEKCKADPSHWIKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             G ++RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE V
Sbjct  741  EGAMQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL +E
Sbjct  801  PLTVE  805



>ref|NP_001237525.1| sucrose synthase [Glycine max]
 sp|P13708.2|SUSY_SOYBN RecName: Full=Sucrose synthase; AltName: Full=Nodulin-100; Short=N-100; 
AltName: Full=Sucrose-UDP glucosyltransferase [Glycine 
max]
 gb|AAC39323.1| sucrose synthase [Glycine max]
 gb|KHN45052.1| Sucrose synthase [Glycine soja]
Length=805

 Score =   223 bits (569),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEKCK DP+HW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFEKCKLDPTHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
              GL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE V
Sbjct  741  KAGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAAE  805



>ref|NP_001289655.1| sucrose synthase [Eucalyptus grandis]
 gb|ABB53602.1| sucrose synthase [Eucalyptus grandis]
Length=805

 Score =   223 bits (568),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAAE L +FFEKCK DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAAETLANFFEKCKVDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             G ++RI++KYTWQIYS+RLL L +VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  QGAMQRIKDKYTWQIYSERLLNLTAVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>gb|AGM14948.1| sucrose synthase 3 [Hevea brasiliensis]
Length=810

 Score =   223 bits (568),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLVDFFEKCK DPS+W  IS
Sbjct  685  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVDFFEKCKVDPSYWNNIS  744

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             G ++RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDRLE +RYLEMFYALK+ KLAE V
Sbjct  745  HGAMQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRLESKRYLEMFYALKYHKLAESV  804

Query  349  PLAIE  335
            PL +E
Sbjct  805  PLTVE  809



>gb|ADR81997.1| sucrose synthase 2 [Populus trichocarpa]
 gb|ADV71184.1| sucrose synthase 2 [Populus trichocarpa]
Length=803

 Score =   223 bits (568),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DPS+W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPSYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>ref|XP_006381564.1| sucrose synthase family protein [Populus trichocarpa]
 gb|ERP59361.1| sucrose synthase family protein [Populus trichocarpa]
Length=803

 Score =   223 bits (568),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DPS+W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPSYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>ref|XP_010247458.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
 ref|XP_010247459.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
 ref|XP_010247460.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
Length=806

 Score =   223 bits (568),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            E+MTCGLPTFAT HGGPAEIIVHGKSGFHIDPYHG++AAELLV+FFEK K+DP++WE IS
Sbjct  681  ESMTCGLPTFATCHGGPAEIIVHGKSGFHIDPYHGDRAAELLVNFFEKSKEDPTYWEKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI EKYTWQIYS RL+TLA VYGFWK+VSKLDR E RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLQRIHEKYTWQIYSGRLMTLAGVYGFWKYVSKLDRRETRRYLEMFYALKYRKLAEMV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>gb|ADW09901.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   206 bits (523),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -1

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGPAEIIV+G+SGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGRSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADK98109.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98118.1| sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   206 bits (523),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -1

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGPAEIIV+GKSGFHIDPYHG++AA LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGKSGFHIDPYHGDKAAXLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_010535796.1| PREDICTED: sucrose synthase 4 [Tarenaya hassleriana]
Length=806

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG+QAAE+L DFF KCK+DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDQAAEILADFFAKCKEDPSHWDEIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ V
Sbjct  741  HGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKAV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAQE  805



>gb|EYU25805.1| hypothetical protein MIMGU_mgv1a001207mg [Erythranthe guttata]
Length=866

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT HGGPAEIIV G SGFHIDPY+GE  AE+L+ FFEKC KDPSHWE IS
Sbjct  742  EAMTCGLPTFATLHGGPAEIIVDGISGFHIDPYNGESVAEILIGFFEKCTKDPSHWEAIS  801

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTWQIYS+RLL LA VYGFWK+VSKLDRLEI+RYLEM YALK RKLAE V
Sbjct  802  TGGLKRIREKYTWQIYSERLLNLAGVYGFWKYVSKLDRLEIKRYLEMLYALKLRKLAEAV  861

Query  349  PLAIE  335
            PLA+E
Sbjct  862  PLAVE  866



>tpg|DAA45272.1| TPA: putative sucrose synthase family protein [Zea mays]
Length=282

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT HGGPAEII HG SGFHIDPYH EQAA L+ DFFE+CK+DP HW  IS
Sbjct  155  EAMTCGLPTFATLHGGPAEIIEHGVSGFHIDPYHPEQAANLMADFFERCKQDPDHWVKIS  214

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
              GL+RI EKYTW+IYS+RL+TLA VYGFWK+VSKL+RLE RRYLEMFY LKFR+LA+ V
Sbjct  215  GAGLQRIYEKYTWKIYSERLMTLAGVYGFWKYVSKLERLETRRYLEMFYILKFRELAKTV  274

Query  349  PLAIE  335
            PLAI+
Sbjct  275  PLAID  279



>gb|ADW09936.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -1

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGPAEIIV+GKSGFHIDPYHG++AA LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGKSGFHIDPYHGDKAAHLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_007138617.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 ref|XP_007138618.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 gb|ESW10611.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 gb|ESW10612.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
Length=806

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIV GKSG+HIDPYHG++AAE+LVDFFEK K DPSHW+ IS
Sbjct  681  EAMTCGLPTFATFNGGPAEIIVDGKSGYHIDPYHGDRAAEILVDFFEKSKADPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQIYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIQEKYTWQIYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLAIE
Sbjct  801  PLAIE  805



>gb|AEN71060.1| sucrose synthase Sus1 [Gossypium laxum]
 gb|AEN71081.1| sucrose synthase Sus1 [Gossypium lobatum]
Length=805

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFE CKKDPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEVCKKDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>ref|XP_006290612.1| hypothetical protein CARUB_v10016702mg [Capsella rubella]
 gb|EOA23510.1| hypothetical protein CARUB_v10016702mg [Capsella rubella]
Length=807

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEII HGKSGFHIDPYHG+QAAE L DFF KCK+DPSHW+ IS
Sbjct  683  EAMTCGLPTFATCNGGPAEIIEHGKSGFHIDPYHGDQAAETLADFFTKCKQDPSHWDQIS  742

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ V
Sbjct  743  LGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAV  802

Query  349  PLAIE  335
            PLA E
Sbjct  803  PLAQE  807



>gb|ADW09933.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09934.1| putative sucrose synthase, partial [Schiedea globosa]
Length=113

 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -1

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGP EIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  1    HGGPXEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  60

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  61   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  112



>gb|ADW80600.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80593.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80580.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ABW76422.1| sucrose synthase [Populus tremuloides]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80585.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80609.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80575.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80606.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80586.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80598.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80611.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80587.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80610.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80595.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80591.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80578.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80608.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80592.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80582.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|AIJ28959.1| sucrose synthase [Manihot esculenta subsp. flabellifolia]
Length=806

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLV FF KCK DPSHW  IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVQFFVKCKADPSHWTKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             G ++RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE V
Sbjct  741  EGAMQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL +E
Sbjct  801  PLTVE  805



>gb|ADW80590.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80605.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80604.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80597.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80584.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADV71182.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80572.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80573.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80594.1| sucrose synthase 2 [Populus tomentosa]
 gb|AFZ78659.1| sucrose synthase [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80588.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80581.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80589.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80607.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80574.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80596.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>ref|XP_003546526.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006597891.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=806

 Score =   222 bits (565),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSG+HIDPYHG++AAE+LV+FFEK K DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGYHIDPYHGDRAAEILVEFFEKSKADPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI EKYTWQIYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIHEKYTWQIYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLAIE
Sbjct  801  PLAIE  805



>gb|ADW09904.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09911.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09912.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09913.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09925.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09929.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09930.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   204 bits (520),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -1

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGP EIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPXEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|KHN49081.1| Sucrose synthase [Glycine soja]
Length=806

 Score =   222 bits (565),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSG+HIDPYHG++AAE+LV+FFEK K DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGYHIDPYHGDRAAEILVEFFEKSKADPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI EKYTWQIYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIHEKYTWQIYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLAIE
Sbjct  801  PLAIE  805



>gb|ADK98101.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98102.1| sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   204 bits (520),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -1

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGPAEIIV+G SGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGXSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_008337809.1| PREDICTED: sucrose synthase [Malus domestica]
 ref|XP_008337810.1| PREDICTED: sucrose synthase [Malus domestica]
 ref|XP_008337811.1| PREDICTED: sucrose synthase [Malus domestica]
Length=807

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSG+HIDPYHG+QAAE+LVDFFEK K DPSHW+ IS
Sbjct  682  EAMTCGLPTFATCKGGPAEIIVHGKSGYHIDPYHGDQAAEILVDFFEKSKADPSHWDKIS  741

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+ KLA  V
Sbjct  742  QGGLQRIYEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYSKLAASV  801

Query  349  PLAIE  335
            PLA+E
Sbjct  802  PLAVE  806



>gb|ADW80602.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFH+DPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHVDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADK98116.1| sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   204 bits (520),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -1

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGPAEIIV+GKSGFHIDPYHG++AA+LL DFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGKSGFHIDPYHGDKAADLLXDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_010493195.1| PREDICTED: sucrose synthase 1 [Camelina sativa]
Length=808

 Score =   221 bits (564),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS
Sbjct  683  EAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEIS  742

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ V
Sbjct  743  QGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAV  802

Query  349  PLAIE  335
            PLA E
Sbjct  803  PLAQE  807



>ref|XP_010420928.1| PREDICTED: sucrose synthase 1-like [Camelina sativa]
Length=808

 Score =   221 bits (564),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS
Sbjct  683  EAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEIS  742

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ V
Sbjct  743  QGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAV  802

Query  349  PLAIE  335
            PLA E
Sbjct  803  PLAQE  807



>ref|XP_011039917.1| PREDICTED: sucrose synthase [Populus euphratica]
Length=803

 Score =   221 bits (563),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEK+TW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLAE V
Sbjct  739  QGGLQRIQEKHTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLAESV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>ref|XP_010454391.1| PREDICTED: sucrose synthase 1-like isoform X2 [Camelina sativa]
Length=808

 Score =   221 bits (563),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS
Sbjct  683  EAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEIS  742

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ V
Sbjct  743  QGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAV  802

Query  349  PLAIE  335
            PLA E
Sbjct  803  PLAQE  807



>ref|XP_010454392.1| PREDICTED: sucrose synthase 1-like isoform X3 [Camelina sativa]
Length=838

 Score =   221 bits (564),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS
Sbjct  713  EAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEIS  772

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ V
Sbjct  773  QGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAV  832

Query  349  PLAIE  335
            PLA E
Sbjct  833  PLAQE  837



>sp|Q01390.1|SUSY_VIGRR RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Vigna radiata var. radiata]
 dbj|BAA01108.1| sucrose synthase [Vigna radiata var. radiata]
Length=805

 Score =   221 bits (563),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
              GL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE V
Sbjct  741  QAGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>ref|XP_003533802.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006587064.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=806

 Score =   221 bits (563),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSG+HIDPYHG+ AAE+LV+FFEK K DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGYHIDPYHGDHAAEILVEFFEKSKADPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI EKYTWQIYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIHEKYTWQIYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLAIE
Sbjct  801  PLAIE  805



>gb|KHN47619.1| Sucrose synthase [Glycine soja]
Length=806

 Score =   221 bits (563),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSG+HIDPYHG+ AAE+LV+FFEK K DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGYHIDPYHGDHAAEILVEFFEKSKADPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI EKYTWQIYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE V
Sbjct  741  QGGLKRIHEKYTWQIYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLAIE
Sbjct  801  PLAIE  805



>ref|XP_003609947.1| Sucrose synthase [Medicago truncatula]
Length=531

 Score =   216 bits (551),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAM  GLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS
Sbjct  407  EAMATGLPTFATLNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKIS  466

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTW IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  467  QGGLQRIEEKYTWTIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  526

Query  349  PLAIE  335
            PLA+E
Sbjct  527  PLAVE  531



>dbj|BAH56282.1| sucrose synthase [Vigna angularis]
Length=805

 Score =   221 bits (563),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
              GL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE V
Sbjct  741  EAGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>gb|ADK98120.1| sucrose synthase, partial [Schiedea adamantis]
 gb|ADW09897.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09898.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   204 bits (519),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -1

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGPAEIIV+GKSG HIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGKSGXHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_010520519.1| PREDICTED: sucrose synthase 4-like [Tarenaya hassleriana]
Length=807

 Score =   221 bits (563),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIV+GKSGFHIDPYHG+QAAE+L DFF KCK+DPSHW+ IS
Sbjct  682  EAMTCGLPTFATCNGGPAEIIVNGKSGFHIDPYHGDQAAEILADFFAKCKEDPSHWDEIS  741

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ V
Sbjct  742  HGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAV  801

Query  349  PLAIE  335
            PLA E
Sbjct  802  PLAQE  806



>emb|CDX70945.1| BnaC03g10290D [Brassica napus]
Length=806

 Score =   221 bits (563),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHGEQAA+ L DFF KCK+DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGEQAADTLADFFTKCKEDPSHWDEIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ V
Sbjct  741  KGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKAV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>ref|XP_010454390.1| PREDICTED: sucrose synthase 1-like isoform X1 [Camelina sativa]
Length=862

 Score =   221 bits (564),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS
Sbjct  737  EAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEIS  796

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ V
Sbjct  797  QGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAV  856

Query  349  PLAIE  335
            PLA E
Sbjct  857  PLAQE  861



>gb|ADK98103.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98113.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADW09889.1| putative sucrose synthase, partial [Schiedea adamantis]
 gb|ADW09890.1| putative sucrose synthase, partial [Schiedea adamantis]
 gb|ADW09915.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09916.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   204 bits (518),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -1

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGPAEIIV+GKSG HIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGKSGSHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_009120766.1| PREDICTED: LOW QUALITY PROTEIN: sucrose synthase 1 [Brassica 
rapa]
Length=805

 Score =   221 bits (562),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDQIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ V
Sbjct  741  KGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAQE  805



>emb|CDX92432.1| BnaA10g14710D [Brassica napus]
Length=805

 Score =   221 bits (562),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDQIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ V
Sbjct  741  KGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAQE  805



>emb|CDY16569.1| BnaC09g37040D [Brassica napus]
Length=805

 Score =   221 bits (562),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFAKCKEDPSHWDQIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ V
Sbjct  741  KGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAQE  805



>gb|ADW09903.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   204 bits (518),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -1

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGP EIIV+G+SGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPXEIIVNGRSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|NP_566865.2| sucrose synthase 4 [Arabidopsis thaliana]
 sp|Q9LXL5.1|SUS4_ARATH RecName: Full=Sucrose synthase 4; Short=AtSUS4; AltName: Full=Sucrose-UDP 
glucosyltransferase 4 [Arabidopsis thaliana]
 emb|CAB89040.1| sucrose synthase-like protein [Arabidopsis thaliana]
 gb|AEE77773.1| sucrose synthase 4 [Arabidopsis thaliana]
Length=808

 Score =   221 bits (562),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AAE L DFF KCK DPSHW+ IS
Sbjct  683  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDKAAESLADFFTKCKHDPSHWDQIS  742

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ V
Sbjct  743  LGGLERIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAV  802

Query  349  PLAIE  335
            PLA E
Sbjct  803  PLAHE  807



>gb|ADW09926.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   204 bits (518),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -1

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGP EIIV+GKSGFHIDPYHG++AA LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPXEIIVNGKSGFHIDPYHGDKAAHLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|AGQ57012.1| sucrose synthase 1 [Hevea brasiliensis]
Length=806

 Score =   220 bits (561),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGK GF+IDPYHG QAAELLVDFFEK K DPSHW  IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKPGFNIDPYHGGQAAELLVDFFEKSKADPSHWNNIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             G ++RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE V
Sbjct  741  RGAMQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PL +E
Sbjct  801  PLTVE  805



>ref|XP_002877269.1| hypothetical protein ARALYDRAFT_484788 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53528.1| hypothetical protein ARALYDRAFT_484788 [Arabidopsis lyrata subsp. 
lyrata]
Length=808

 Score =   220 bits (561),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMT GLPTFAT +GGPAEIIVHGKSGFHIDPYHG+QAAE L DFF KCK DPSHW+ IS
Sbjct  683  EAMTSGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDQAAETLADFFTKCKHDPSHWDQIS  742

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ V
Sbjct  743  LGGLERIQEKYTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAV  802

Query  349  PLAIE  335
            PLA E
Sbjct  803  PLAQE  807



>gb|ADW80603.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   220 bits (561),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFW+HVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWEHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80599.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   220 bits (561),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+  
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSA  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ADW80579.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   220 bits (561),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKH S LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWRIYSQRLLTLTGVYGFWKHASNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>emb|CAA09910.1| sucrose synthase [Pisum sativum]
Length=806

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAM  GLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS
Sbjct  681  EAMATGLPTFATLNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKTDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>ref|NP_197583.1| sucrose synthase 1 [Arabidopsis thaliana]
 ref|NP_001031915.1| sucrose synthase 1 [Arabidopsis thaliana]
 sp|P49040.3|SUSY1_ARATH RecName: Full=Sucrose synthase 1; Short=AtSUS1; AltName: Full=Sucrose-UDP 
glucosyltransferase 1 [Arabidopsis thaliana]
 dbj|BAH19538.1| AT5G20830 [Arabidopsis thaliana]
 gb|AED92894.1| sucrose synthase 1 [Arabidopsis thaliana]
 gb|AED92895.1| sucrose synthase 1 [Arabidopsis thaliana]
Length=808

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS
Sbjct  683  EAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEIS  742

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ V
Sbjct  743  KGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAV  802

Query  349  PLA  341
            PLA
Sbjct  803  PLA  805



>gb|AFI57908.1| sucrose synthase 1 [Prunus persica]
Length=806

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSG+HIDPYHG+QAA++LVDFFEK + DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCKGGPAEIIVHGKSGYHIDPYHGDQAADILVDFFEKSRADPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI EKYTWQIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLQRIYEKYTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            P A E
Sbjct  801  PRAEE  805



>ref|XP_008242292.1| PREDICTED: sucrose synthase [Prunus mume]
 ref|XP_008242293.1| PREDICTED: sucrose synthase [Prunus mume]
Length=806

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSG+HIDPYHG+QAA++LVDFFEK + DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCKGGPAEIIVHGKSGYHIDPYHGDQAADILVDFFEKSRADPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI EKYTWQIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLQRIYEKYTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            P A E
Sbjct  801  PRAEE  805



>pdb|3S28|A Chain A, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|B Chain B, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|C Chain C, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|D Chain D, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|E Chain E, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|F Chain F, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|G Chain G, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|H Chain H, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S29|A Chain A, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|B Chain B, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|C Chain C, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|D Chain D, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|E Chain E, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|F Chain F, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|G Chain G, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|H Chain H, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
Length=816

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS
Sbjct  683  EAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEIS  742

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ V
Sbjct  743  KGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAV  802

Query  349  PLA  341
            PLA
Sbjct  803  PLA  805



>ref|XP_007204649.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 ref|XP_007204650.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 gb|EMJ05848.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 gb|EMJ05849.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
Length=806

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSG+HIDPYHG+QAA++LVDFFEK + DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCKGGPAEIIVHGKSGYHIDPYHGDQAADILVDFFEKSRADPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI EKYTWQIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLQRIYEKYTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            P A E
Sbjct  801  PRAEE  805



>gb|ADW80577.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLE+FYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEVFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|ACP17902.1| sucrose synthase [Phaseolus vulgaris]
Length=806

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIV GKSG+HIDPYHG++AAE+LVDFFEK K DPSHWE IS
Sbjct  681  EAMTCGLPTFATFNGGPAEIIVDGKSGYHIDPYHGDRAAEILVDFFEKSKADPSHWEKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRIQEKYTWQ+YSDRLLTL  VYGFWKHV+ L+R E +R LEMFYALK+RKLAE V
Sbjct  741  QGGLKRIQEKYTWQVYSDRLLTLTGVYGFWKHVTNLERRESKRSLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLAIE
Sbjct  801  PLAIE  805



>gb|ADW80601.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKY W+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYAWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|AAC28107.1| nodule-enhanced sucrose synthase [Pisum sativum]
Length=806

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAM  GLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS
Sbjct  681  EAMATGLPTFATLNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKTDPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>sp|P31926.1|SUSY_VICFA RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Vicia faba]
 emb|CAA49428.1| sucrose synthase [Vicia faba]
 gb|AAC37346.1| UDP-glucose:D-fructose-2-glucosyltransferase [Vicia faba]
Length=806

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAM  GLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS
Sbjct  681  EAMATGLPTFATLNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKADPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  LGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA+E
Sbjct  801  PLAVE  805



>emb|CDX88838.1| BnaA03g08110D [Brassica napus]
Length=743

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS
Sbjct  618  EAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEIS  677

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ V
Sbjct  678  KGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKAV  737

Query  349  PLAIE  335
            PLA E
Sbjct  738  PLAEE  742



>ref|XP_009131818.1| PREDICTED: sucrose synthase 1 [Brassica rapa]
Length=806

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ V
Sbjct  741  KGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKAV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>ref|XP_008349074.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIV+GKSG+HIDPYHG+QAAE+ VDFFEK K DPSHW+ IS
Sbjct  682  EAMTCGLPTFATCKGGPAEIIVNGKSGYHIDPYHGDQAAEIJVDFFEKNKADPSHWDKIS  741

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI EKYTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  V
Sbjct  742  QGGLQRIYEKYTWQIYSERLLTLTGVYGFWKDVSNLDRLESRRYLEMFYALKFRKLAASV  801

Query  349  PLAIE  335
            PLA+E
Sbjct  802  PLAVE  806



>ref|XP_008382924.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIV+GKSG+HIDPYHG+QAAE+ VDFFEK K DPSHW+ IS
Sbjct  682  EAMTCGLPTFATCKGGPAEIIVNGKSGYHIDPYHGDQAAEIJVDFFEKNKADPSHWDKIS  741

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI EKYTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  V
Sbjct  742  QGGLQRIYEKYTWQIYSERLLTLTGVYGFWKDVSNLDRLESRRYLEMFYALKFRKLAASV  801

Query  349  PLAIE  335
            PLA+E
Sbjct  802  PLAVE  806



>sp|P49034.1|SUSY_ALNGL RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Alnus glutinosa]
 emb|CAA63122.1| sucrose synthase [Alnus glutinosa]
Length=803

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            E+MTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHGEQAA+LLVDFFEK K DPSHW  IS
Sbjct  679  ESMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGEQAAQLLVDFFEKTKADPSHWAKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI EKYTW+IYS+RLLTL  V  FWKHVS LDRLE RRY+EMFYALK+RKLAE V
Sbjct  739  LGGLQRIHEKYTWKIYSERLLTLTGVTAFWKHVSNLDRLESRRYIEMFYALKYRKLAESV  798

Query  349  PLAIE  335
            PLA+E
Sbjct  799  PLAVE  803



>tpg|DAA45273.1| TPA: putative sucrose synthase family protein [Zea mays]
Length=383

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT HGGPAEII HG SGFHIDPYH EQAA L+ DFFE+CK+DP HW  IS
Sbjct  256  EAMTCGLPTFATLHGGPAEIIEHGVSGFHIDPYHPEQAANLMADFFERCKQDPDHWVKIS  315

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
              GL+RI EKYTW+IYS+RL+TLA VYGFWK+VSKL+RLE RRYLEMFY LKFR+LA+ V
Sbjct  316  GAGLQRIYEKYTWKIYSERLMTLAGVYGFWKYVSKLERLETRRYLEMFYILKFRELAKTV  375

Query  349  PLAIE  335
            PLAI+
Sbjct  376  PLAID  380



>ref|XP_009348897.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIV+GKSG+HIDPY G+QAAE+LVDFFEK K DPSHWE IS
Sbjct  682  EAMTCGLPTFATCKGGPAEIIVNGKSGYHIDPYQGDQAAEILVDFFEKSKADPSHWEKIS  741

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI EKYTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  V
Sbjct  742  QGGLQRIYEKYTWQIYSERLLTLTGVYGFWKDVSNLDRLENRRYLEMFYALKFRKLAASV  801

Query  349  PLAIE  335
            PLA+E
Sbjct  802  PLAVE  806



>gb|ADK98112.1| sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   202 bits (515),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -1

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYT 
Sbjct  2    HGGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTX  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_008338289.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIV+GKSG+HIDPYHG+QAAE+ VDFFEK K DPSHW+ IS
Sbjct  682  EAMTCGLPTFATCKGGPAEIIVNGKSGYHIDPYHGDQAAEIJVDFFEKNKADPSHWDKIS  741

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI EKYTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  V
Sbjct  742  QGGLQRIYEKYTWQIYSERLLTLTGVYGFWKDVSNLDRLESRRYLEMFYALKFRKLAASV  801

Query  349  PLAIE  335
            PLA+E
Sbjct  802  PLAVE  806



>ref|XP_009348896.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIV+GKSG+HIDPYHG+QAAE+LVDFFEK K DPSHW+ IS
Sbjct  682  EAMTCGLPTFATCMGGPAEIIVNGKSGYHIDPYHGDQAAEILVDFFEKSKADPSHWDKIS  741

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI EKYTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALK+RKLA  V
Sbjct  742  QGGLQRIYEKYTWQIYSERLLTLTGVYGFWKDVSNLDRLESRRYLEMFYALKYRKLAASV  801

Query  349  PLAIE  335
            PLA+E
Sbjct  802  PLAVE  806



>ref|XP_006287059.1| hypothetical protein CARUB_v10000208mg, partial [Capsella rubella]
 gb|EOA19957.1| hypothetical protein CARUB_v10000208mg, partial [Capsella rubella]
Length=850

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS
Sbjct  725  EAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEIS  784

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ V
Sbjct  785  LGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAV  844

Query  349  PLA  341
            PLA
Sbjct  845  PLA  847



>gb|ABP88869.1| sucrose synthase [Medicago falcata]
Length=804

 Score =   219 bits (557),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAM  GLPTFAT +GGPAEIIVHGKSGFHIDPYHGE+AA+LLV+FFEK K DPSHW+ IS
Sbjct  680  EAMATGLPTFATLNGGPAEIIVHGKSGFHIDPYHGERAADLLVEFFEKVKADPSHWDKIS  739

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTW IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  740  QGGLQRIEEKYTWTIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  799

Query  349  PLAIE  335
            PLA+E
Sbjct  800  PLAVE  804



>gb|ADW09905.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09906.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   202 bits (513),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -1

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGP EIIV+GKSG HIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPXEIIVNGKSGSHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|AIL23782.1| sucrose synthase [Prunus serrulata]
Length=806

 Score =   218 bits (556),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSG+HIDPYHG+QAAE+LVDFFEK + DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCKGGPAEIIVHGKSGYHIDPYHGDQAAEILVDFFEKSRADPSHWDKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI EKYT QIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE V
Sbjct  741  QGGLQRIFEKYTRQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAEE  805



>gb|ADW80583.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   218 bits (556),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGFHI PYHG QAAELLVDFFEKCK DP++W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGFHIVPYHGVQAAELLVDFFEKCKADPTYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ V
Sbjct  739  QGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSV  798

Query  349  PLAIE  335
            PL IE
Sbjct  799  PLTIE  803



>gb|KJB65376.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=818

 Score =   218 bits (556),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFF+KCKKDPSHW  IS
Sbjct  681  EAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFDKCKKDPSHWNDIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE  356
             GGLKRIQEKYTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKL +
Sbjct  741  EGGLKRIQEKYTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLVD  798



>ref|XP_008797380.1| PREDICTED: sucrose synthase 1-like isoform X2 [Phoenix dactylifera]
Length=814

 Score =   218 bits (556),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT++GGPAEIIVHG SGFHIDPY G++AAELLV FFEKC++DP+HW  IS
Sbjct  681  EAMTCGLPTFATSNGGPAEIIVHGVSGFHIDPYQGDKAAELLVSFFEKCREDPNHWNKIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI+EKYTW++YS+RL+TLA VYGFWK+VSKLDR E RRYLEMFYALK+R LA  V
Sbjct  741  QGGLKRIEEKYTWKLYSERLMTLAGVYGFWKYVSKLDRRETRRYLEMFYALKYRNLATSV  800

Query  349  PLAIE  335
            PLA++
Sbjct  801  PLAVD  805



>gb|AII19313.1| sucrose synthase 1, partial [Ricinus communis]
Length=805

 Score =   218 bits (556),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            E+M+CGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLV+FFEKCK DP  W+ IS
Sbjct  681  ESMSCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVEFFEKCKADPCVWDEIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK++KLA+ V
Sbjct  741  KGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYKKLADSV  800

Query  349  PLAIE  335
            PL +E
Sbjct  801  PLTVE  805



>gb|KEH37657.1| sucrose synthase [Medicago truncatula]
Length=804

 Score =   218 bits (556),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIVHGKSG+HIDPYHG+QAAE LV+FFEK K DPS+W+ IS
Sbjct  679  EAMTCGLPTFATCNGGPAEIIVHGKSGYHIDPYHGDQAAETLVEFFEKSKADPSYWDKIS  738

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGLKRI EKYTWQIYSDRLLTL  VYGFWKHV+ LDR E +RYLEMFYALK+ KLAE V
Sbjct  739  HGGLKRIHEKYTWQIYSDRLLTLTGVYGFWKHVTNLDRRESKRYLEMFYALKYSKLAESV  798

Query  349  PLAIE  335
            PLA+E
Sbjct  799  PLAVE  803



>ref|XP_002516210.1| sucrose synthase, putative [Ricinus communis]
 gb|EEF46212.1| sucrose synthase, putative [Ricinus communis]
Length=773

 Score =   218 bits (555),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            E+M+CGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLV+FFEKCK DP  W+ IS
Sbjct  649  ESMSCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVEFFEKCKADPCVWDEIS  708

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK++KLA+ V
Sbjct  709  KGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYKKLADSV  768

Query  349  PLAIE  335
            PL +E
Sbjct  769  PLTVE  773



>emb|CDO97805.1| unnamed protein product [Coffea canephora]
Length=731

 Score =   217 bits (553),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT +GGPAEIIV+GKSGFHIDPY GEQ AE+LVDFFE+CK+D S+WETIS
Sbjct  608  EAMTCGLPTFATINGGPAEIIVNGKSGFHIDPYKGEQVAEVLVDFFERCKEDASYWETIS  667

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
            +GGLKRIQEKYTWQIYSDR+LTLA VYGFWK VS+ DRL+++RYLEMFY L +RKLAE V
Sbjct  668  SGGLKRIQEKYTWQIYSDRILTLAGVYGFWKEVSRPDRLKMQRYLEMFYLLNYRKLAESV  727

Query  349  PLA  341
            P+A
Sbjct  728  PVA  730



>ref|XP_009343356.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   218 bits (555),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIV+GKSG+HIDPY G+QAAE+LVDFFEK K DPSHW+ IS
Sbjct  682  EAMTCGLPTFATCKGGPAEIIVNGKSGYHIDPYQGDQAAEILVDFFEKSKADPSHWDKIS  741

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI EKYTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  V
Sbjct  742  QGGLQRIYEKYTWQIYSERLLTLTGVYGFWKDVSNLDRLENRRYLEMFYALKFRKLAASV  801

Query  349  PLAIE  335
            PLA+E
Sbjct  802  PLAVE  806



>ref|XP_008391777.1| PREDICTED: sucrose synthase-like isoform X1 [Malus domestica]
 ref|XP_008391781.1| PREDICTED: sucrose synthase-like isoform X1 [Malus domestica]
Length=806

 Score =   218 bits (555),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIV+G SG+HIDPYHG+QAAE+LVDFFEK K DPSHW+ IS
Sbjct  682  EAMTCGLPTFATCKGGPAEIIVNGISGYHIDPYHGDQAAEILVDFFEKSKADPSHWDKIS  741

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI EKYTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  V
Sbjct  742  QGGLQRIYEKYTWQIYSERLLTLTGVYGFWKDVSNLDRLECRRYLEMFYALKFRKLAASV  801

Query  349  PLAIE  335
            PLA+E
Sbjct  802  PLAVE  806



>ref|XP_008391788.1| PREDICTED: sucrose synthase-like isoform X2 [Malus domestica]
Length=806

 Score =   218 bits (555),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIV+G SG+HIDPYHG+QAAE+LVDFFEK K DPSHW+ IS
Sbjct  682  EAMTCGLPTFATCKGGPAEIIVNGISGYHIDPYHGDQAAEILVDFFEKSKADPSHWDKIS  741

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI EKYTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  V
Sbjct  742  QGGLQRIYEKYTWQIYSERLLTLTGVYGFWKDVSNLDRLECRRYLEMFYALKFRKLAASV  801

Query  349  PLAIE  335
            PLA+E
Sbjct  802  PLAVE  806



>ref|XP_006400648.1| hypothetical protein EUTSA_v10012719mg [Eutrema salsugineum]
 gb|ESQ42101.1| hypothetical protein EUTSA_v10012719mg [Eutrema salsugineum]
Length=806

 Score =   218 bits (555),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -1

Query  709  EAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS  530
            EAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS
Sbjct  681  EAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFAKCKEDPSHWDEIS  740

Query  529  AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDV  350
             GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LD LE RRYLEMFYALK+R LA+ V
Sbjct  741  KGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDHLESRRYLEMFYALKYRPLAQAV  800

Query  349  PLAIE  335
            PLA E
Sbjct  801  PLAQE  805



>gb|ADW09891.1| putative sucrose synthase, partial [Schiedea membranacea]
 gb|ADW09892.1| putative sucrose synthase, partial [Schiedea membranacea]
Length=114

 Score =   201 bits (510),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -1

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK D S WE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDLSRWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1219970116365