BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF025E11

Length=783
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO98567.1|  unnamed protein product                                211   8e-62   Coffea canephora [robusta coffee]
ref|XP_011086955.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    207   2e-60   Sesamum indicum [beniseed]
ref|XP_011072066.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    206   3e-60   Sesamum indicum [beniseed]
gb|EYU22293.1|  hypothetical protein MIMGU_mgv1a006235mg                198   3e-56   Erythranthe guttata [common monkey flower]
ref|XP_009792116.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    195   7e-56   Nicotiana sylvestris
ref|XP_009630493.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    194   3e-55   Nicotiana tomentosiformis
ref|XP_006353939.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    193   4e-55   Solanum tuberosum [potatoes]
ref|XP_008803049.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    187   6e-53   Phoenix dactylifera
ref|XP_003634328.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       186   1e-52   Vitis vinifera
emb|CAN79596.1|  hypothetical protein VITISV_042386                     186   1e-52   Vitis vinifera
gb|EYU17802.1|  hypothetical protein MIMGU_mgv1a008418mg                186   2e-52   Erythranthe guttata [common monkey flower]
ref|XP_010935556.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    183   1e-51   Elaeis guineensis
ref|XP_010088395.1|  E3 ubiquitin-protein ligase RING1                  183   2e-51   Morus notabilis
ref|XP_010940373.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    180   2e-50   Elaeis guineensis
ref|XP_008811090.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    179   6e-50   Phoenix dactylifera
ref|XP_010246216.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    179   6e-50   Nelumbo nucifera [Indian lotus]
ref|XP_004235401.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    179   7e-50   Solanum lycopersicum
ref|XP_008467256.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    176   1e-48   Cucumis melo [Oriental melon]
ref|XP_004137524.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    176   1e-48   Cucumis sativus [cucumbers]
ref|XP_010249658.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    174   3e-48   Nelumbo nucifera [Indian lotus]
gb|ACT21194.1|  zinc finger protein                                     174   3e-48   Carica papaya [mamon]
ref|XP_009401096.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    172   2e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004299466.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    171   1e-46   Fragaria vesca subsp. vesca
ref|XP_006441411.1|  hypothetical protein CICLE_v10020902mg             169   2e-46   Citrus clementina [clementine]
ref|XP_008393509.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    170   2e-46   Malus domestica [apple tree]
ref|XP_006493415.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    169   3e-46   Citrus sinensis [apfelsine]
gb|KDO48740.1|  hypothetical protein CISIN_1g0186891mg                  169   3e-46   Citrus sinensis [apfelsine]
ref|XP_010069512.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    168   1e-45   Eucalyptus grandis [rose gum]
ref|XP_006374275.1|  hypothetical protein POPTR_0015s05600g             165   7e-45   Populus trichocarpa [western balsam poplar]
ref|XP_008240345.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    166   1e-44   Prunus mume [ume]
ref|NP_001064906.2|  Os10g0487400                                       162   3e-44   
gb|EAZ16486.1|  hypothetical protein OsJ_31957                          162   6e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010687250.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    163   8e-44   Beta vulgaris subsp. vulgaris [field beet]
gb|ACF84253.1|  unknown                                                 159   1e-43   Zea mays [maize]
ref|XP_011047757.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    162   1e-43   Populus euphratica
ref|XP_007152550.1|  hypothetical protein PHAVU_004G139600g             162   2e-43   Phaseolus vulgaris [French bean]
gb|AAL59019.1|AC087182_2  putative zinc finger protein                  161   4e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011003690.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    160   9e-43   Populus euphratica
gb|EAY78992.1|  hypothetical protein OsI_34100                          159   2e-42   Oryza sativa Indica Group [Indian rice]
ref|NP_001152117.1|  RHC1A                                              160   2e-42   Zea mays [maize]
ref|XP_002317728.2|  hypothetical protein POPTR_0012s03370g             156   3e-42   
ref|XP_009383684.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    158   4e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008346897.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    157   2e-41   Malus domestica [apple tree]
ref|XP_006655672.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    155   2e-41   
ref|XP_003534093.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    156   4e-41   Glycine max [soybeans]
ref|XP_009355932.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    156   4e-41   Pyrus x bretschneideri [bai li]
gb|ACG33105.1|  RHC1A                                                   155   6e-41   Zea mays [maize]
ref|XP_003549174.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    154   1e-40   Glycine max [soybeans]
ref|XP_004982780.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    155   1e-40   Setaria italica
gb|EYU35570.1|  hypothetical protein MIMGU_mgv1a013774mg                150   1e-40   Erythranthe guttata [common monkey flower]
gb|KDP37541.1|  hypothetical protein JCGZ_05980                         152   2e-40   Jatropha curcas
ref|NP_001130953.1|  uncharacterized LOC100192058                       154   2e-40   Zea mays [maize]
ref|XP_006661882.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    152   7e-40   Oryza brachyantha
ref|XP_002467049.1|  hypothetical protein SORBIDRAFT_01g018800          152   1e-39   Sorghum bicolor [broomcorn]
gb|KJB77384.1|  hypothetical protein B456_012G134900                    150   3e-39   Gossypium raimondii
ref|XP_003574092.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    149   8e-39   Brachypodium distachyon [annual false brome]
ref|XP_003620140.1|  RING finger protein                                146   1e-38   
gb|KHG22497.1|  E3 ubiquitin-protein ligase RING1                       149   1e-38   Gossypium arboreum [tree cotton]
sp|P0CH30.1|RING1_GOSHI  RecName: Full=E3 ubiquitin-protein ligas...    149   1e-38   Gossypium hirsutum [American cotton]
ref|XP_007043255.1|  RING/U-box superfamily protein, putative           149   1e-38   Theobroma cacao [chocolate]
gb|KJB49973.1|  hypothetical protein B456_008G147900                    148   2e-38   Gossypium raimondii
ref|XP_004515274.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    148   3e-38   Cicer arietinum [garbanzo]
ref|XP_011022020.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    145   5e-38   Populus euphratica
ref|XP_003620252.1|  RING finger protein                                147   6e-38   
gb|EMS63398.1|  E3 ubiquitin-protein ligase RING1                       144   8e-38   Triticum urartu
gb|KJB31865.1|  hypothetical protein B456_005G211800                    145   1e-37   Gossypium raimondii
gb|AES76470.2|  zinc finger, C3HC4 type (RING finger) protein           146   2e-37   Medicago truncatula
ref|XP_011070454.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       145   2e-37   Sesamum indicum [beniseed]
gb|EMT21882.1|  RING finger protein 126                                 145   2e-37   
gb|KJB79836.1|  hypothetical protein B456_013G068800                    144   7e-37   Gossypium raimondii
ref|XP_009357359.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       143   9e-37   Pyrus x bretschneideri [bai li]
gb|KHG01857.1|  E3 ubiquitin-protein ligase RING1                       143   1e-36   Gossypium arboreum [tree cotton]
gb|EPS73974.1|  hypothetical protein M569_00782                         142   1e-36   Genlisea aurea
ref|XP_010533212.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    142   2e-36   Tarenaya hassleriana [spider flower]
ref|XP_003557291.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    142   2e-36   Brachypodium distachyon [annual false brome]
emb|CDP18533.1|  unnamed protein product                                142   2e-36   Coffea canephora [robusta coffee]
ref|XP_009588217.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    141   4e-36   Nicotiana tomentosiformis
ref|XP_009401852.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    140   5e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008355430.1|  PREDICTED: uncharacterized protein LOC103419088    142   2e-35   
ref|XP_010508254.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    140   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010466163.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    140   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010487953.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    140   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_006306505.1|  hypothetical protein CARUB_v10012493mg             139   2e-35   Capsella rubella
ref|XP_009788594.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    139   2e-35   Nicotiana sylvestris
ref|XP_010557559.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    139   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_010541863.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    139   4e-35   Tarenaya hassleriana [spider flower]
ref|XP_009145710.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    139   4e-35   Brassica rapa
ref|XP_010500595.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    138   7e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010461879.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    138   7e-35   Camelina sativa [gold-of-pleasure]
ref|XP_002883213.1|  zinc finger family protein                         138   9e-35   
emb|CDX82271.1|  BnaA03g35500D                                          135   9e-35   
emb|CDY24592.1|  BnaC05g32760D                                          138   9e-35   Brassica napus [oilseed rape]
gb|EEC79816.1|  hypothetical protein OsI_21260                          135   1e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_010322969.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    138   2e-34   Solanum lycopersicum
ref|XP_002437660.1|  hypothetical protein SORBIDRAFT_10g000250          137   2e-34   Sorghum bicolor [broomcorn]
ref|XP_002307159.2|  hypothetical protein POPTR_0005s09270g             136   2e-34   
ref|XP_006847820.1|  hypothetical protein AMTR_s00029p00043520          137   3e-34   
ref|XP_010034290.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       135   6e-34   Eucalyptus grandis [rose gum]
ref|XP_006359295.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    135   6e-34   Solanum tuberosum [potatoes]
emb|CDY25360.1|  BnaA05g19240D                                          135   7e-34   Brassica napus [oilseed rape]
emb|CDY36069.1|  BnaC03g41290D                                          133   7e-34   Brassica napus [oilseed rape]
ref|NP_001056529.1|  Os06g0101300                                       135   8e-34   
ref|XP_010479486.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    135   8e-34   Camelina sativa [gold-of-pleasure]
emb|CDY72364.1|  BnaAnng40830D                                          132   1e-33   Brassica napus [oilseed rape]
ref|XP_004964254.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    134   2e-33   Setaria italica
ref|XP_009135656.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    133   3e-33   Brassica rapa
ref|NP_188629.1|  E3 ubiquitin-protein ligase RING1-like protein        134   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004236843.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    133   3e-33   Solanum lycopersicum
dbj|BAB01310.1|  unnamed protein product                                134   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008659413.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    133   5e-33   Zea mays [maize]
ref|XP_006406436.1|  hypothetical protein EUTSA_v10021059mg             133   6e-33   Eutrema salsugineum [saltwater cress]
ref|XP_006297993.1|  hypothetical protein CARUB_v10014036mg             133   7e-33   
ref|XP_009111341.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    132   1e-32   Brassica rapa
gb|ABK96352.1|  unknown                                                 131   2e-32   Populus trichocarpa x Populus deltoides
ref|XP_002310643.2|  hypothetical protein POPTR_0007s07510g             131   2e-32   
ref|XP_002990229.1|  hypothetical protein SELMODRAFT_18755              125   2e-32   
ref|XP_002523963.1|  zinc finger protein, putative                      125   3e-32   
gb|EPS72590.1|  hypothetical protein M569_02175                         124   8e-32   Genlisea aurea
ref|XP_006393160.1|  hypothetical protein EUTSA_v10011690mg             129   1e-31   Eutrema salsugineum [saltwater cress]
ref|XP_003592721.1|  RING finger protein                                129   1e-31   Medicago truncatula
ref|XP_009382108.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    129   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY33437.1|  BnaC01g32880D                                          129   2e-31   Brassica napus [oilseed rape]
ref|XP_011002257.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    128   2e-31   Populus euphratica
ref|XP_004149872.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    128   3e-31   Cucumis sativus [cucumbers]
gb|AFG53307.1|  hypothetical protein 0_8445_01                          124   4e-31   Pinus taeda
gb|AFG53317.1|  hypothetical protein 0_8445_01                          124   4e-31   Pinus taeda
ref|XP_007142767.1|  hypothetical protein PHAVU_007G015200g             127   4e-31   Phaseolus vulgaris [French bean]
gb|ABR17677.1|  unknown                                                 129   5e-31   Picea sitchensis
ref|XP_001777565.1|  predicted protein                                  127   4e-30   
ref|XP_008659414.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    124   6e-30   
ref|XP_003555841.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    123   2e-29   Glycine max [soybeans]
ref|XP_003536735.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    122   3e-29   Glycine max [soybeans]
dbj|BAJ95268.1|  predicted protein                                      122   5e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY42507.1|  BnaC06g03510D                                          122   9e-29   Brassica napus [oilseed rape]
emb|CCA20603.1|  conserved hypothetical protein                         121   1e-28   Albugo laibachii Nc14
gb|ABK21010.1|  unknown                                                 119   5e-28   Picea sitchensis
emb|CCI42106.1|  unnamed protein product                                118   7e-28   Albugo candida
ref|XP_002514591.1|  zinc finger protein, putative                      120   1e-27   Ricinus communis
ref|XP_001773353.1|  predicted protein                                  112   1e-27   
ref|XP_010243363.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    118   3e-27   Nelumbo nucifera [Indian lotus]
gb|KDP31400.1|  hypothetical protein JCGZ_11776                         119   3e-27   Jatropha curcas
ref|XP_010453731.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    115   5e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010942240.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    117   9e-27   Elaeis guineensis
ref|XP_010261518.1|  PREDICTED: uncharacterized protein LOC104600329    117   1e-26   Nelumbo nucifera [Indian lotus]
ref|XP_002968394.1|  hypothetical protein SELMODRAFT_451322             119   1e-26   Selaginella moellendorffii
ref|XP_002988229.1|  hypothetical protein SELMODRAFT_451319             117   1e-26   Selaginella moellendorffii
ref|XP_008797578.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    117   1e-26   
ref|XP_010087330.1|  E3 ubiquitin-protein ligase RING1                  117   1e-26   Morus notabilis
gb|EYU44258.1|  hypothetical protein MIMGU_mgv1a026933mg                116   1e-26   Erythranthe guttata [common monkey flower]
ref|XP_002970557.1|  hypothetical protein SELMODRAFT_451325             118   1e-26   Selaginella moellendorffii
ref|XP_010678387.1|  PREDICTED: uncharacterized protein LOC104893943    117   1e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008797580.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    116   2e-26   
ref|XP_008797579.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    116   2e-26   
gb|ETO72364.1|  hypothetical protein F444_11492                         114   2e-26   Phytophthora parasitica P1976
ref|XP_008907457.1|  hypothetical protein PPTG_13494                    114   2e-26   Phytophthora parasitica INRA-310
ref|XP_010453730.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...    115   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_002273441.1|  PREDICTED: uncharacterized protein LOC100268065    116   2e-26   Vitis vinifera
ref|XP_004141480.1|  PREDICTED: uncharacterized protein LOC101208708    115   2e-26   
ref|XP_004156174.1|  PREDICTED: uncharacterized protein LOC101225971    115   2e-26   
dbj|BAC42901.1|  unknown protein                                        110   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KGN52539.1|  hypothetical protein Csa_5G642700                       116   2e-26   Cucumis sativus [cucumbers]
ref|XP_010257498.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    115   3e-26   Nelumbo nucifera [Indian lotus]
emb|CDO98521.1|  unnamed protein product                                115   3e-26   Coffea canephora [robusta coffee]
ref|XP_008797577.1|  PREDICTED: uncharacterized protein LOC103712...    116   3e-26   
gb|AFG68993.1|  hypothetical protein 0_10618_01                         110   3e-26   Pinus taeda
ref|XP_008459416.1|  PREDICTED: uncharacterized protein LOC103498560    115   4e-26   
gb|ADN34278.1|  zinc finger protein                                     115   4e-26   Cucumis melo subsp. melo
emb|CBI15364.3|  unnamed protein product                                118   5e-26   Vitis vinifera
gb|KJB19466.1|  hypothetical protein B456_003G104200                    115   6e-26   Gossypium raimondii
emb|CAN63309.1|  hypothetical protein VITISV_017174                     113   7e-26   Vitis vinifera
ref|XP_002991361.1|  hypothetical protein SELMODRAFT_429694             115   7e-26   Selaginella moellendorffii
emb|CDP02365.1|  unnamed protein product                                114   1e-25   Coffea canephora [robusta coffee]
ref|XP_007037687.1|  Zinc finger protein, putative isoform 2            114   1e-25   
ref|XP_009515775.1|  hypothetical protein PHYSODRAFT_294053             112   1e-25   Phytophthora sojae
ref|XP_008878243.1|  hypothetical protein H310_12817                    112   2e-25   Aphanomyces invadans
ref|XP_002906712.1|  conserved hypothetical protein                     112   2e-25   Phytophthora infestans T30-4
ref|XP_002317961.2|  hypothetical protein POPTR_0012s06680g             113   2e-25   
ref|XP_010660538.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    113   2e-25   Vitis vinifera
ref|XP_007037686.1|  Zinc finger protein, putative isoform 1            114   2e-25   
ref|XP_008803022.1|  PREDICTED: E3 ubiquitin-protein ligase Praja-2     114   3e-25   Phoenix dactylifera
ref|XP_009415542.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    112   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_197086.1|  RING/U-box domain-containing protein                  112   4e-25   Arabidopsis thaliana [mouse-ear cress]
gb|ABK25012.1|  unknown                                                 112   4e-25   Picea sitchensis
ref|XP_008384934.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    112   4e-25   
ref|XP_010654254.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    112   4e-25   
ref|XP_010420259.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    108   4e-25   Camelina sativa [gold-of-pleasure]
emb|CDX75998.1|  BnaA04g02620D                                          108   4e-25   
ref|XP_006345087.1|  PREDICTED: uncharacterized protein LOC102578405    112   5e-25   Solanum tuberosum [potatoes]
ref|XP_007151431.1|  hypothetical protein PHAVU_004G045600g             112   5e-25   Phaseolus vulgaris [French bean]
gb|AFG56549.1|  hypothetical protein 2_4925_01                          107   5e-25   Pinus taeda
ref|XP_009375922.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    111   5e-25   Pyrus x bretschneideri [bai li]
ref|XP_008356868.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    111   7e-25   Malus domestica [apple tree]
ref|XP_009346389.1|  PREDICTED: uncharacterized protein LOC103938109    112   7e-25   Pyrus x bretschneideri [bai li]
ref|XP_004307482.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    111   7e-25   Fragaria vesca subsp. vesca
ref|XP_009139092.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    109   8e-25   Brassica rapa
ref|XP_010463639.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    111   8e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010474409.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...    111   8e-25   Camelina sativa [gold-of-pleasure]
ref|XP_009364363.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    111   8e-25   Pyrus x bretschneideri [bai li]
gb|EEE62065.1|  hypothetical protein OsJ_16849                          109   8e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654903.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    109   9e-25   Oryza brachyantha
ref|XP_006288146.1|  hypothetical protein CARUB_v10001383mg             110   9e-25   Capsella rubella
emb|CDX94901.1|  BnaC05g07700D                                          110   9e-25   
ref|XP_002465271.1|  hypothetical protein SORBIDRAFT_01g035310          110   1e-24   Sorghum bicolor [broomcorn]
emb|CAN82964.1|  hypothetical protein VITISV_000345                     110   1e-24   Vitis vinifera
ref|XP_002322048.2|  hypothetical protein POPTR_0015s03560g             111   1e-24   
dbj|BAA77204.1|  ring finger protein                                    106   1e-24   Cicer arietinum [garbanzo]
ref|XP_011010366.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    110   1e-24   Populus euphratica
gb|AEW08272.1|  hypothetical protein 2_4925_01                          106   1e-24   Pinus radiata
ref|XP_011006162.1|  PREDICTED: uncharacterized protein LOC105112236    111   1e-24   Populus euphratica
ref|XP_004301091.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    111   1e-24   Fragaria vesca subsp. vesca
gb|EPS71485.1|  hypothetical protein M569_03274                         110   1e-24   Genlisea aurea
ref|XP_008461689.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    110   1e-24   Cucumis melo [Oriental melon]
emb|CDM85845.1|  unnamed protein product                                109   1e-24   Triticum aestivum [Canadian hard winter wheat]
emb|CDY22483.1|  BnaC03g22930D                                          109   1e-24   Brassica napus [oilseed rape]
ref|XP_007209983.1|  hypothetical protein PRUPE_ppa005133mg             111   1e-24   
gb|EMT01795.1|  RING finger protein 126                                 109   2e-24   
ref|XP_010540537.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    110   2e-24   Tarenaya hassleriana [spider flower]
gb|EYU19927.1|  hypothetical protein MIMGU_mgv1a007795mg                110   2e-24   Erythranthe guttata [common monkey flower]
ref|XP_011085033.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    110   2e-24   
ref|XP_008374682.1|  PREDICTED: uncharacterized protein LOC103437931    110   2e-24   Malus domestica [apple tree]
ref|XP_002531579.1|  zinc finger protein, putative                      109   2e-24   
ref|XP_010516266.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    109   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_009133459.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    109   2e-24   Brassica rapa
gb|KHN07574.1|  E3 ubiquitin-protein ligase RING1                       108   2e-24   Glycine soja [wild soybean]
ref|XP_010427489.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    109   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_009787392.1|  PREDICTED: uncharacterized protein LOC104235354    110   3e-24   Nicotiana sylvestris
ref|NP_001054437.2|  Os05g0110000                                       109   3e-24   
ref|XP_002283212.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       110   3e-24   Vitis vinifera
ref|XP_010504561.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    109   3e-24   
ref|NP_567039.1|  E3 ubiquitin ligase                                   109   3e-24   Arabidopsis thaliana [mouse-ear cress]
gb|ABD96901.1|  hypothetical protein                                    109   3e-24   Tarenaya spinosa
ref|XP_004240370.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       110   3e-24   Solanum lycopersicum
ref|XP_010558535.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    110   3e-24   Tarenaya hassleriana [spider flower]
ref|XP_004486987.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    109   3e-24   Cicer arietinum [garbanzo]
ref|XP_004161919.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    109   3e-24   
ref|XP_003547238.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    109   3e-24   Glycine max [soybeans]
ref|XP_008452807.1|  PREDICTED: E3 ubiquitin-protein ligase AIP2        109   3e-24   Cucumis melo [Oriental melon]
ref|XP_004147682.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    109   3e-24   Cucumis sativus [cucumbers]
ref|XP_010096594.1|  E3 ubiquitin-protein ligase RING1                  109   3e-24   Morus notabilis
ref|XP_010492431.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...    109   3e-24   Camelina sativa [gold-of-pleasure]
ref|NP_001050120.1|  Os03g0351800                                       108   3e-24   
ref|XP_004984362.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    108   3e-24   Setaria italica
gb|KDO29293.1|  hypothetical protein SPRG_05830                         108   3e-24   Saprolegnia parasitica CBS 223.65
dbj|BAJ87106.1|  predicted protein                                      105   3e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB36692.1|  hypothetical protein B456_006G171100                    109   4e-24   Gossypium raimondii
ref|XP_006402974.1|  hypothetical protein EUTSA_v10006102mg             108   4e-24   Eutrema salsugineum [saltwater cress]
ref|XP_010100889.1|  E3 ubiquitin-protein ligase RING1                  109   4e-24   Morus notabilis
ref|XP_011089490.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       109   4e-24   Sesamum indicum [beniseed]
ref|XP_011099174.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    109   4e-24   Sesamum indicum [beniseed]
emb|CDP00121.1|  unnamed protein product                                109   4e-24   Coffea canephora [robusta coffee]
ref|XP_006650082.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    108   4e-24   Oryza brachyantha
emb|CBI16098.3|  unnamed protein product                                110   4e-24   Vitis vinifera
ref|XP_002531557.1|  zinc finger protein, putative                      109   4e-24   Ricinus communis
emb|CDX72127.1|  BnaC08g27470D                                          108   4e-24   
ref|XP_010485476.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...    109   5e-24   Camelina sativa [gold-of-pleasure]
ref|XP_003557912.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    108   5e-24   Brachypodium distachyon [annual false brome]
ref|XP_004228482.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    108   5e-24   Solanum lycopersicum
ref|XP_006291489.1|  hypothetical protein CARUB_v10017638mg             108   5e-24   Capsella rubella
ref|XP_009794149.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    108   5e-24   Nicotiana sylvestris
ref|NP_565942.1|  RING-H2 finger C1A                                    108   5e-24   Arabidopsis thaliana [mouse-ear cress]
emb|CDM87068.1|  unnamed protein product                                107   5e-24   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004953777.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    108   5e-24   Setaria italica
ref|XP_010256860.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    108   6e-24   Nelumbo nucifera [Indian lotus]
emb|CBI24304.3|  unnamed protein product                                105   6e-24   Vitis vinifera
ref|XP_008230329.1|  PREDICTED: E3 ubiquitin-protein ligase Praja-1     108   6e-24   Prunus mume [ume]
ref|XP_009414329.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    108   6e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007215530.1|  hypothetical protein PRUPE_ppa007129mg             108   6e-24   Prunus persica
ref|XP_008240686.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    108   7e-24   Prunus mume [ume]
ref|XP_006297779.1|  hypothetical protein CARUB_v10013815mg             108   7e-24   Capsella rubella
ref|XP_009337814.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    109   7e-24   Pyrus x bretschneideri [bai li]
ref|XP_010262557.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    108   8e-24   Nelumbo nucifera [Indian lotus]
ref|XP_009593953.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    108   8e-24   Nicotiana tomentosiformis
gb|AAK73147.1|AC079022_20  putative RING-H2 finger protein              108   8e-24   Oryza sativa [red rice]
ref|XP_009116354.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    107   8e-24   
ref|XP_010922286.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    108   9e-24   
ref|XP_008233646.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    107   9e-24   Prunus mume [ume]
ref|XP_010538978.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    108   1e-23   Tarenaya hassleriana [spider flower]
ref|XP_007205441.1|  hypothetical protein PRUPE_ppa007829mg             108   1e-23   Prunus persica
emb|CDY23878.1|  BnaC04g01590D                                          107   1e-23   Brassica napus [oilseed rape]
ref|XP_008614288.1|  hypothetical protein SDRG_10094                    107   1e-23   
ref|XP_009766707.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    108   1e-23   
gb|KFK36864.1|  hypothetical protein AALP_AA4G181500                    108   1e-23   
ref|XP_010538977.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    107   1e-23   
ref|XP_009338606.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    107   1e-23   
ref|XP_010549960.1|  PREDICTED: E3 ubiquitin-protein ligase Praja-1     108   1e-23   
ref|XP_008379474.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...    108   1e-23   
ref|XP_010939389.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    107   1e-23   
ref|XP_009387750.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    107   1e-23   
ref|XP_009378303.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...    107   1e-23   
ref|XP_002879893.1|  ring-H2 finger C1A                                 107   1e-23   
dbj|BAJ87816.1|  predicted protein                                      107   1e-23   
ref|XP_002452884.1|  hypothetical protein SORBIDRAFT_04g034270          107   1e-23   
gb|KJB76747.1|  hypothetical protein B456_012G105100                    107   1e-23   
ref|XP_009126069.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...    107   1e-23   
ref|XP_009384344.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...    108   1e-23   
ref|XP_010508797.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    107   1e-23   
ref|XP_008807019.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    106   2e-23   
ref|XP_010517526.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    107   2e-23   
ref|XP_010505840.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    107   2e-23   
ref|XP_006294585.1|  hypothetical protein CARUB_v10023620mg             107   2e-23   
ref|XP_006400108.1|  hypothetical protein EUTSA_v10013685mg             107   2e-23   
ref|XP_007146184.1|  hypothetical protein PHAVU_006G019600g             107   2e-23   
ref|XP_010690953.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    108   2e-23   
ref|XP_010653661.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    107   2e-23   
ref|XP_009384343.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...    108   2e-23   
ref|XP_008785560.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    107   2e-23   
gb|KJB76748.1|  hypothetical protein B456_012G105100                    107   2e-23   
ref|XP_006411351.1|  hypothetical protein EUTSA_v10016932mg             107   2e-23   
ref|XP_009409508.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    107   2e-23   
ref|XP_010922808.1|  PREDICTED: E3 ubiquitin-protein ligase Praja-1     108   2e-23   
gb|KDP42227.1|  hypothetical protein JCGZ_02957                         107   2e-23   
gb|KHN30758.1|  E3 ubiquitin-protein ligase RING1-like                  107   2e-23   
gb|KJB20021.1|  hypothetical protein B456_003G129300                    107   2e-23   
gb|KHN02654.1|  E3 ubiquitin-protein ligase RING1-like                  107   2e-23   
ref|XP_008777326.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    107   2e-23   
ref|XP_008369925.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    107   2e-23   
ref|XP_002520538.1|  zinc finger protein, putative                      106   2e-23   
ref|XP_009609325.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    106   2e-23   
ref|XP_007028207.1|  RING-H2 finger C1A, putative                       106   2e-23   
ref|XP_011346103.1|  PREDICTED: E3 ubiquitin-protein ligase RNF181      103   2e-23   
ref|XP_007016358.1|  Zinc finger family protein, putative               107   3e-23   
emb|CAN72193.1|  hypothetical protein VITISV_022309                     110   3e-23   
ref|XP_006435652.1|  hypothetical protein CICLE_v10031679mg             107   3e-23   
ref|XP_010906598.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    107   3e-23   
ref|XP_006346709.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    107   3e-23   
ref|XP_008222223.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    107   3e-23   
ref|XP_004236734.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    107   3e-23   
ref|XP_011167764.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    103   3e-23   
gb|AFG56541.1|  hypothetical protein 2_4925_01                          102   3e-23   
ref|XP_010106526.1|  E3 ubiquitin-protein ligase RING1                  107   3e-23   
dbj|BAD16922.1|  zinc finger -like                                      106   3e-23   
ref|XP_004507269.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    106   3e-23   
ref|XP_006481992.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    106   3e-23   
ref|XP_008341822.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    106   3e-23   
ref|XP_009384341.1|  PREDICTED: uncharacterized protein LOC103971...    108   3e-23   
ref|XP_006435651.1|  hypothetical protein CICLE_v10031679mg             107   3e-23   
ref|XP_003543521.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    106   3e-23   
gb|KDP44929.1|  hypothetical protein JCGZ_01429                         106   3e-23   
ref|NP_001045539.1|  Os01g0972000                                       106   3e-23   
emb|CDY27204.1|  BnaA09g35980D                                          106   3e-23   
ref|XP_008803097.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    106   3e-23   
ref|XP_011260425.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    102   3e-23   
ref|XP_002871686.1|  hypothetical protein ARALYDRAFT_909558             106   3e-23   
gb|EAZ24742.1|  hypothetical protein OsJ_08513                          106   3e-23   
emb|CAN73309.1|  hypothetical protein VITISV_018157                     104   3e-23   
emb|CDX85531.1|  BnaA02g02820D                                          106   4e-23   
ref|XP_008353550.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    106   4e-23   
ref|XP_004304177.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       103   4e-23   
ref|XP_002298344.2|  hypothetical protein POPTR_0001s25010g             106   4e-23   
ref|XP_008342060.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    106   4e-23   
emb|CDP09090.1|  unnamed protein product                                106   4e-23   
ref|XP_006430455.1|  hypothetical protein CICLE_v10012279mg             105   4e-23   
gb|KDO57382.1|  hypothetical protein CISIN_1g021656mg                   105   4e-23   
ref|XP_009604770.1|  PREDICTED: uncharacterized protein LOC104099468    106   4e-23   
ref|XP_011002644.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    106   5e-23   
ref|XP_009143292.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    105   5e-23   
ref|XP_006362735.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    105   5e-23   
ref|XP_006358699.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    106   5e-23   
gb|ACN40798.1|  unknown                                                 105   5e-23   
ref|XP_009394851.1|  PREDICTED: uncharacterized protein LOC103980247    106   5e-23   
ref|XP_008393264.1|  PREDICTED: uncharacterized protein LOC103455455    107   5e-23   
gb|KEH32065.1|  zinc finger, C3HC4 type (RING finger) protein           106   5e-23   
ref|XP_008464108.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       106   5e-23   
ref|XP_004137779.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    105   6e-23   
ref|XP_008442524.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    105   6e-23   
ref|XP_010544579.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    105   6e-23   
emb|CDX74839.1|  BnaA05g05850D                                          105   6e-23   
emb|CDX90972.1|  BnaC02g06250D                                          105   6e-23   
ref|XP_009831419.1|  hypothetical protein, variant                      105   6e-23   
ref|XP_004302753.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    105   6e-23   
ref|XP_011035277.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    105   6e-23   
ref|XP_011066304.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    102   7e-23   
gb|EAY77404.1|  hypothetical protein OsI_05393                          105   7e-23   
ref|XP_010544562.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    105   7e-23   
ref|XP_009831418.1|  hypothetical protein H257_07553                    105   7e-23   
ref|XP_009421331.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    105   7e-23   
ref|XP_003597390.1|  RING finger protein                                105   7e-23   
gb|KDO69133.1|  hypothetical protein CISIN_1g039088mg                   105   7e-23   
ref|XP_010937587.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    105   7e-23   
ref|XP_003569102.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    105   7e-23   
ref|XP_010251900.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       105   7e-23   
ref|XP_004294651.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       105   8e-23   
ref|XP_010544570.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    105   8e-23   
ref|XP_002266870.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    105   9e-23   
gb|ACU19744.1|  unknown                                                 103   9e-23   
ref|XP_010927985.1|  PREDICTED: uncharacterized protein LOC105049900    105   9e-23   
ref|XP_004508643.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    105   9e-23   
ref|XP_010931555.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    105   9e-23   
ref|XP_003569088.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    105   9e-23   
ref|XP_010318890.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    105   9e-23   
ref|XP_007145499.1|  hypothetical protein PHAVU_007G243900g             104   9e-23   
ref|XP_007148495.1|  hypothetical protein PHAVU_006G213500g             105   9e-23   
ref|XP_007218078.1|  hypothetical protein PRUPE_ppa006881mg             105   9e-23   
ref|XP_010036030.1|  PREDICTED: uncharacterized protein LOC104425...    107   1e-22   
ref|XP_007148496.1|  hypothetical protein PHAVU_006G213500g             105   1e-22   
ref|XP_009419929.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    105   1e-22   
gb|KDP22949.1|  hypothetical protein JCGZ_01757                         104   1e-22   
ref|XP_007150348.1|  hypothetical protein PHAVU_005G146100g             104   1e-22   
emb|CDY20473.1|  BnaC04g05710D                                          104   1e-22   
ref|XP_010036029.1|  PREDICTED: uncharacterized protein LOC104425...    107   1e-22   
ref|XP_004142724.1|  PREDICTED: uncharacterized protein LOC101204782    106   1e-22   
gb|AFG67327.1|  hypothetical protein 2_7298_01                          100   1e-22   
ref|XP_004161717.1|  PREDICTED: uncharacterized protein LOC101223715    107   1e-22   
gb|KHN33467.1|  E3 ubiquitin-protein ligase RING1                       104   1e-22   
ref|XP_003547055.2|  PREDICTED: E3 ubiquitin-protein ligase RING1...    104   1e-22   
ref|XP_009387697.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       104   2e-22   
ref|XP_007026969.1|  Zinc finger family protein, putative               104   2e-22   
ref|NP_001149786.1|  LOC100283413                                       103   2e-22   
ref|XP_006485723.1|  PREDICTED: uncharacterized protein LOC102607084    105   2e-22   
ref|XP_002323210.1|  zinc finger family protein                         103   2e-22   
ref|XP_008788971.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    105   2e-22   
ref|XP_009387343.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    104   2e-22   
ref|XP_008370522.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    104   2e-22   
ref|XP_010278933.1|  PREDICTED: uncharacterized protein LOC104612961    106   2e-22   
gb|KDO65626.1|  hypothetical protein CISIN_1g036764mg                   105   2e-22   
ref|XP_007163425.1|  hypothetical protein PHAVU_001G233700g             104   2e-22   
ref|XP_004143127.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    104   2e-22   
ref|XP_002315214.2|  hypothetical protein POPTR_0010s20890g             105   2e-22   
ref|XP_003543320.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    103   2e-22   
gb|AFG67337.1|  hypothetical protein 2_7298_01                          100   2e-22   
gb|AEW08366.1|  hypothetical protein 2_7298_01                          100   2e-22   
gb|ACE97593.1|  thioredoxin-related protein                             102   2e-22   
gb|KHN30808.1|  E3 ubiquitin-protein ligase RING1                       103   2e-22   
gb|ACE97620.1|  thioredoxin-related protein                             102   3e-22   
ref|XP_009380632.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       103   3e-22   
gb|ACE97613.1|  thioredoxin-related protein                             102   3e-22   
emb|CDX79968.1|  BnaA05g01880D                                          103   3e-22   
gb|KGN47134.1|  hypothetical protein Csa_6G190250                       104   3e-22   
gb|ACE97591.1|  thioredoxin-related protein                             102   3e-22   
ref|XP_006348226.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    103   3e-22   
gb|KHN35429.1|  E3 ubiquitin-protein ligase RING1-like                  103   3e-22   
emb|CDY34722.1|  BnaA01g33030D                                          103   3e-22   
ref|XP_008801592.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    103   3e-22   
gb|ACE97628.1|  thioredoxin-related protein                             102   3e-22   
ref|XP_004141356.1|  PREDICTED: E3 ubiquitin-protein ligase AIP2-...    103   3e-22   
ref|XP_004141355.1|  PREDICTED: E3 ubiquitin-protein ligase AIP2-...    103   3e-22   
ref|XP_002454349.1|  hypothetical protein SORBIDRAFT_04g029220          103   4e-22   
ref|XP_010554737.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    103   4e-22   
ref|XP_009142711.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    103   4e-22   
ref|XP_009133377.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    103   4e-22   
ref|XP_002309072.1|  hypothetical protein POPTR_0006s08810g             103   4e-22   
ref|XP_009775595.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    103   4e-22   
ref|XP_003545449.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    103   4e-22   
gb|ACE97608.1|  thioredoxin-related protein                             102   4e-22   
ref|XP_010943356.1|  PREDICTED: uncharacterized protein LOC105061096    104   4e-22   
ref|XP_010938677.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       102   4e-22   
ref|XP_008797320.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    103   4e-22   
ref|XP_004954037.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    103   4e-22   
ref|XP_006380961.1|  hypothetical protein POPTR_0006s03070g             102   4e-22   
ref|XP_002308856.2|  zinc finger family protein                         102   4e-22   
ref|XP_002439130.1|  hypothetical protein SORBIDRAFT_09g001100          103   4e-22   
ref|XP_006348225.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    103   4e-22   
gb|ABK95425.1|  unknown                                                 102   4e-22   
ref|XP_006440833.1|  hypothetical protein CICLE_v10018495mg             107   4e-22   
ref|XP_011019833.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    102   4e-22   
ref|XP_006846282.1|  hypothetical protein AMTR_s00012p00250160          103   4e-22   
ref|XP_011032138.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    103   4e-22   
ref|XP_002531415.1|  zinc finger protein, putative                      103   5e-22   
ref|XP_011090210.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...    102   5e-22   
ref|XP_006853112.1|  hypothetical protein AMTR_s00038p00135070          100   5e-22   
gb|ACE97595.1|  thioredoxin-related protein                             102   5e-22   
gb|KFK36186.1|  hypothetical protein AALP_AA4G089500                    103   5e-22   
ref|XP_004507169.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    103   5e-22   
ref|XP_009399864.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    103   5e-22   
ref|XP_008786879.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    102   5e-22   
gb|AFK44009.1|  unknown                                                 102   5e-22   
ref|XP_003537982.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    103   5e-22   
gb|KHN15189.1|  E3 ubiquitin-protein ligase RING1-like                99.8    5e-22   
ref|XP_009775540.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    103   5e-22   
ref|XP_004503159.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    103   6e-22   
ref|XP_009596918.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    103   6e-22   
ref|XP_010111250.1|  E3 ubiquitin-protein ligase RING1                  102   6e-22   
gb|KJB08900.1|  hypothetical protein B456_001G111900                    102   6e-22   
ref|XP_011041353.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    102   6e-22   
ref|XP_006480869.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    102   6e-22   
gb|KDO52347.1|  hypothetical protein CISIN_1g017269mg                   102   7e-22   
ref|XP_002312107.2|  zinc finger family protein                         103   7e-22   
gb|KHN17914.1|  E3 ubiquitin-protein ligase RING1                       101   7e-22   
ref|XP_010554613.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    102   7e-22   
ref|XP_009343691.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    102   7e-22   
ref|XP_006348224.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    102   8e-22   
ref|XP_010922248.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    102   8e-22   
ref|NP_186883.1|  RING/U-box domain-containing protein                  102   8e-22   
ref|XP_010029440.1|  PREDICTED: E3 ubiquitin-protein ligase Praja-1     102   8e-22   
ref|XP_006411202.1|  hypothetical protein EUTSA_v10016765mg             102   8e-22   
ref|XP_009759330.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       102   8e-22   
ref|XP_008463301.1|  PREDICTED: uncharacterized protein LOC103501491    104   9e-22   
gb|KJB35824.1|  hypothetical protein B456_006G129700                    102   9e-22   
ref|XP_003617179.1|  Thioredoxin-related protein                        101   9e-22   
ref|XP_006429129.1|  hypothetical protein CICLE_v10012000mg             102   9e-22   
emb|CDY07641.1|  BnaA03g18700D                                          102   9e-22   
gb|KCW56354.1|  hypothetical protein EUGRSUZ_I02088                     102   9e-22   
ref|XP_006429131.1|  hypothetical protein CICLE_v10012000mg             102   9e-22   
ref|XP_002881672.1|  hypothetical protein ARALYDRAFT_903223             102   9e-22   
ref|XP_007205383.1|  hypothetical protein PRUPE_ppa007335mg             102   1e-21   
ref|XP_008220737.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...    102   1e-21   
ref|XP_010920534.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    102   1e-21   
ref|XP_003616442.1|  RING finger protein                                102   1e-21   
ref|XP_005704537.1|  zinc finger (C3HC4-type RING finger) family ...  99.0    1e-21   
ref|XP_010543132.1|  PREDICTED: uncharacterized protein LOC104816149    103   1e-21   



>emb|CDO98567.1| unnamed protein product [Coffea canephora]
Length=391

 Score =   211 bits (536),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 119/153 (78%), Gaps = 14/153 (9%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAVEGLP + +T+E+LA+DSSQCAVCKDSF LDEEAKQMPCKHIYH DCI+PWLEL
Sbjct  200  PASKSAVEGLPTVKMTEELLATDSSQCAVCKDSFLLDEEAKQMPCKHIYHSDCILPWLEL  259

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQP--------------TRnnnnsfglgigglgggg  462
            HNSCPVCRYELPTDDPDYE+RRN QQ                R ++N      G  GG  
Sbjct  260  HNSCPVCRYELPTDDPDYESRRNGQQGGNNSTSNVRSFGINIRTDDNLGTGSGGLSGGAV  319

Query  461  NQENPQAPRTVERRFRVSLPWLFGGFGSPAETS  363
            NQENPQ PRTVERRFR+SLPWLF GFGSPAETS
Sbjct  320  NQENPQTPRTVERRFRISLPWLFRGFGSPAETS  352



>ref|XP_011086955.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
 ref|XP_011086956.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
 ref|XP_011086957.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
Length=382

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 114/145 (79%), Gaps = 6/145 (4%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAVEGLP+I IT+EML SDSSQCAVCKDSFEL+EEAKQMPCKHIYHKDCI+PWLEL
Sbjct  197  PASKSAVEGLPNIKITEEMLPSDSSQCAVCKDSFELNEEAKQMPCKHIYHKDCILPWLEL  256

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQE------NPQAP  438
            HNSCPVCRYELPTDDPDYENRR  Q    +N  S    IG     G+QE      N   P
Sbjct  257  HNSCPVCRYELPTDDPDYENRRTGQMNDNSNRTSNISNIGLGVAAGSQENRDDNNNSTTP  316

Query  437  RTVERRFRVSLPWLFGGFGSPAETS  363
            R VERRFR+SLPWLF G GSPAETS
Sbjct  317  RMVERRFRISLPWLFRGLGSPAETS  341



>ref|XP_011072066.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
Length=380

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 117/145 (81%), Gaps = 6/145 (4%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAVEGLPDI IT+EMLASDSSQCAVCKDSFEL+EEAKQMPCKHIYHKDCI+PWLEL
Sbjct  195  PASKSAVEGLPDIKITEEMLASDSSQCAVCKDSFELNEEAKQMPCKHIYHKDCILPWLEL  254

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQ------AP  438
            HNSCPVCRYELPTDDPDYENRR  Q    ++ NS    +G   GGG Q++         P
Sbjct  255  HNSCPVCRYELPTDDPDYENRRTGQTNDNSSRNSGNTSLGFGAGGGYQDSGDNNNSSLTP  314

Query  437  RTVERRFRVSLPWLFGGFGSPAETS  363
            RT+ERRFR+S+PWL  G GSPAETS
Sbjct  315  RTMERRFRISVPWLLRGLGSPAETS  339



>gb|EYU22293.1| hypothetical protein MIMGU_mgv1a006235mg [Erythranthe guttata]
Length=451

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 112/139 (81%), Gaps = 5/139 (4%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KS VEGLPDI IT EMLASDSSQCAVCKDSFEL+EEAKQ+PCKHIYHKDCI+PWLEL
Sbjct  272  PASKSVVEGLPDIKITAEMLASDSSQCAVCKDSFELNEEAKQIPCKHIYHKDCILPWLEL  331

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCRYELPTDD DYENRR     T  NNN+ G    G     N  NPQ PR +ER 
Sbjct  332  HNSCPVCRYELPTDDADYENRR-----TGQNNNNSGGNQDGRNNNINNSNPQTPRAMERM  386

Query  419  FRVSLPWLFGGFGSPAETS  363
            FR+SLP +FGGFGSPAETS
Sbjct  387  FRISLPSIFGGFGSPAETS  405



>ref|XP_009792116.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
sylvestris]
 ref|XP_009792117.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
sylvestris]
Length=398

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 114/152 (75%), Gaps = 13/152 (9%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKSAV GLPDI IT E+L SDSSQCAVCKD+FEL E+AKQMPCKHIYHKDCI+PWLEL
Sbjct  204  PAAKSAVAGLPDIKITVELLDSDSSQCAVCKDTFELGEDAKQMPCKHIYHKDCILPWLEL  263

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglg-------------igglggggN  459
            HNSCPVCRYELPTDDPDYENRR SQQ   N+N +                  G  GGGGN
Sbjct  264  HNSCPVCRYELPTDDPDYENRRTSQQQNANSNANNSNNNNTNNNNNTGWIFGGSEGGGGN  323

Query  458  QENPQAPRTVERRFRVSLPWLFGGFGSPAETS  363
            QEN Q PRTVE R R+ L WLF G GSPAETS
Sbjct  324  QENSQTPRTVEGRLRIPLQWLFRGLGSPAETS  355



>ref|XP_009630493.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
tomentosiformis]
Length=399

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 112/152 (74%), Gaps = 13/152 (9%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKSAV GLPDI IT E+L SDSSQCAVCKD+FEL EEAKQ+PCKHIYHKDCI+PWLEL
Sbjct  205  PAAKSAVAGLPDIKITVELLDSDSSQCAVCKDTFELGEEAKQIPCKHIYHKDCILPWLEL  264

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglg-------------igglggggN  459
            HNSCPVCRYELPTDDPDYENRR SQQ   N+N +                  G  GGG N
Sbjct  265  HNSCPVCRYELPTDDPDYENRRTSQQQNANSNANNSSNNNTNNNNNTGWVFGGSEGGGEN  324

Query  458  QENPQAPRTVERRFRVSLPWLFGGFGSPAETS  363
            QEN   PRTVE R R+ L WLF G GSPAETS
Sbjct  325  QENSHTPRTVEGRLRIPLQWLFRGLGSPAETS  356



>ref|XP_006353939.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum tuberosum]
Length=387

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 117/152 (77%), Gaps = 13/152 (9%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKSAV GLPDI IT+E+L SDSSQCAVCKD+FEL  EAKQ+PCKHIYHKDCIMPWLEL
Sbjct  196  PAAKSAVAGLPDIKITEELLDSDSSQCAVCKDTFELGMEAKQIPCKHIYHKDCIMPWLEL  255

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnn-------------nsfglgigglggggN  459
            HNSCPVCRYELPTDDPDYENR+ SQQ T N +             N+ G+  GGL GGG+
Sbjct  256  HNSCPVCRYELPTDDPDYENRKTSQQQTANTSNTHANTSNNNTNNNNTGVMFGGLEGGGD  315

Query  458  QENPQAPRTVERRFRVSLPWLFGGFGSPAETS  363
            Q+N Q P T ERR R+ L WLF G GSPAETS
Sbjct  316  QDNSQTPSTGERRLRIPLQWLFRGLGSPAETS  347



>ref|XP_008803049.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
Length=364

 Score =   187 bits (474),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 104/140 (74%), Gaps = 2/140 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKSAV  LPDI IT+E+LA+D +QCAVCKD+FE+ EEAKQMPCKHIYHKDCI+PWLEL
Sbjct  189  PAAKSAVGSLPDIKITEELLATDEAQCAVCKDTFEIGEEAKQMPCKHIYHKDCILPWLEL  248

Query  599  HNSCPVCRYELPTDDPDYENRRN--SQQPTRnnnnsfglgigglggggNQENPQAPRTVE  426
            HNSCPVCRYELPTDDPDYENRR    Q          G   G   G     N Q+PRTVE
Sbjct  249  HNSCPVCRYELPTDDPDYENRRGPAVQGAHPVGTEDPGGAGGLAAGASGDGNTQSPRTVE  308

Query  425  RRFRVSLPWLFGGFGSPAET  366
            RRFR+SLPW   GFGS AE 
Sbjct  309  RRFRISLPWPLRGFGSQAEA  328



>ref|XP_003634328.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Vitis vinifera]
 ref|XP_010663919.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Vitis vinifera]
Length=369

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 105/151 (70%), Gaps = 12/151 (8%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA+EGLP I IT E+L +DSSQCAVCKDSFELDEEAKQMPCKHIYH DCI+PWLEL
Sbjct  191  PASKSAIEGLPTIRITVELLGTDSSQCAVCKDSFELDEEAKQMPCKHIYHNDCILPWLEL  250

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQE-----------  453
            HNSCPVCRYELPTDDPDYE+R    Q  +   N+  +   G                   
Sbjct  251  HNSCPVCRYELPTDDPDYEHRTRGGQVNQTGGNAAAVAAAGAASNSASGAAGGAAVSGEN  310

Query  452  -NPQAPRTVERRFRVSLPWLFGGFGSPAETS  363
             NPQ PRT +R FR+S PW F  FGSPAETS
Sbjct  311  PNPQTPRTADRMFRISFPWPFRTFGSPAETS  341



>emb|CAN79596.1| hypothetical protein VITISV_042386 [Vitis vinifera]
Length=371

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 105/151 (70%), Gaps = 12/151 (8%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA+EGLP I IT E+L +DSSQCAVCKDSFELDEEAKQMPCKHIYH DCI+PWLEL
Sbjct  193  PASKSAIEGLPTIRITVELLGTDSSQCAVCKDSFELDEEAKQMPCKHIYHNDCILPWLEL  252

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQE-----------  453
            HNSCPVCRYELPTDDPDYE+R    Q  +   N+  +   G                   
Sbjct  253  HNSCPVCRYELPTDDPDYEHRTRGGQVNQTGGNAAAVAAAGAASNSASGAAGGAAVSGEN  312

Query  452  -NPQAPRTVERRFRVSLPWLFGGFGSPAETS  363
             NPQ PRT +R FR+S PW F  FGSPAETS
Sbjct  313  PNPQTPRTADRMFRISFPWPFRTFGSPAETS  343



>gb|EYU17802.1| hypothetical protein MIMGU_mgv1a008418mg [Erythranthe guttata]
Length=374

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 107/142 (75%), Gaps = 3/142 (2%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KS VEGLPDITITQEML SDSSQCAVCKDSFEL+E AKQ+PCKH+YHKDCI+PWLEL
Sbjct  202  PASKSVVEGLPDITITQEMLTSDSSQCAVCKDSFELNEAAKQIPCKHLYHKDCIVPWLEL  261

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQEN--PQAPR-TV  429
            HNSCPVCRYELPTDDP+YENRR  +    + +++          G N  N   Q P    
Sbjct  262  HNSCPVCRYELPTDDPEYENRRTRENENSSQSSNISNSSLEALDGDNSSNNGEQTPMAAA  321

Query  428  ERRFRVSLPWLFGGFGSPAETS  363
            ERRFR+SLPW F GFGS AE S
Sbjct  322  ERRFRISLPWPFRGFGSTAEAS  343



>ref|XP_010935556.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
Length=358

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 104/141 (74%), Gaps = 2/141 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAV  L DI IT E+LASD +QCAVCKD+FE+ EEAKQMPCKHIYHKDCI+PWLEL
Sbjct  183  PASKSAVASLSDIKITVELLASDEAQCAVCKDTFEIGEEAKQMPCKHIYHKDCILPWLEL  242

Query  599  HNSCPVCRYELPTDDPDYENRRNS--QQPTRnnnnsfglgigglggggNQENPQAPRTVE  426
            HNSCPVCRYELPTDDPDYENRR +  Q       +  G   G         + Q+PRTVE
Sbjct  243  HNSCPVCRYELPTDDPDYENRRGAPVQGGLPVGADDPGGAGGSAARASGDGSTQSPRTVE  302

Query  425  RRFRVSLPWLFGGFGSPAETS  363
            RRFR+SLPW   GFGS AE S
Sbjct  303  RRFRISLPWPLRGFGSQAEAS  323



>ref|XP_010088395.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis]
 gb|EXC35976.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis]
Length=378

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 108/150 (72%), Gaps = 13/150 (9%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA+EGLP + IT+E+LASDSSQCAVCKD+FEL EEAKQMPCKHIYH +CI+PWLEL
Sbjct  193  PASKSAMEGLPSVKITEELLASDSSQCAVCKDTFELGEEAKQMPCKHIYHSECILPWLEL  252

Query  599  HNSCPVCRYELPTDDPDYENR-RNSQQPTRnnnnsf------------glgigglggggN  459
            HNSCPVCRYELPTDDPDYE R R +  P   +  +              +G G   G  +
Sbjct  253  HNSCPVCRYELPTDDPDYEQRNRGTSTPANQSQAAGGFNISVGGGSINAVGDGSGSGATS  312

Query  458  QENPQAPRTVERRFRVSLPWLFGGFGSPAE  369
             ENPQ PR VERRF +SLP LF  FGS AE
Sbjct  313  GENPQTPRMVERRFTISLPQLFRVFGSTAE  342



>ref|XP_010940373.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
 ref|XP_010940374.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
 ref|XP_010940375.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
 ref|XP_010940376.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
Length=363

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 105/140 (75%), Gaps = 2/140 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKSA+  LPDI I +E+LASD +QCAVCKD+FE+  EAKQMPCKHIYHKDCI+PWLEL
Sbjct  187  PAAKSAITSLPDIKINEELLASDEAQCAVCKDTFEIGVEAKQMPCKHIYHKDCILPWLEL  246

Query  599  HNSCPVCRYELPTDDPDYENRRN-SQQPTRnnnnsfglgigglggggNQE-NPQAPRTVE  426
            HNSCPVCRYELPTDDPDYENR+  + + TR        G GG       + N  +PRTVE
Sbjct  247  HNSCPVCRYELPTDDPDYENRKGPAAEGTRPAGAGDPGGAGGSAAEALGDGNTLSPRTVE  306

Query  425  RRFRVSLPWLFGGFGSPAET  366
            RRFR+SLPW   GFGS AE 
Sbjct  307  RRFRISLPWPLRGFGSQAEA  326



>ref|XP_008811090.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
 ref|XP_008811098.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
 ref|XP_008811103.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
 ref|XP_008811112.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
 ref|XP_008811119.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
Length=362

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 102/140 (73%), Gaps = 2/140 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKSA+  LPDI IT+E+LASD +QCAVCKD+FE+  EAKQMPCKHIYHKDCI+PWLEL
Sbjct  186  PAAKSAISSLPDIKITEELLASDEAQCAVCKDTFEIGVEAKQMPCKHIYHKDCILPWLEL  245

Query  599  HNSCPVCRYELPTDDPDYENRRN--SQQPTRnnnnsfglgigglggggNQENPQAPRTVE  426
            HNSCPVCRYEL TDDPDYEN+R   ++          G   G   G     N  +PRTVE
Sbjct  246  HNSCPVCRYELLTDDPDYENKRGAAAEGARPAGAGDPGGAGGSAAGASGDGNTLSPRTVE  305

Query  425  RRFRVSLPWLFGGFGSPAET  366
            RRFR+SLPW   GFGS AE 
Sbjct  306  RRFRISLPWPLRGFGSQAEA  325



>ref|XP_010246216.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
Length=361

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 100/138 (72%), Gaps = 2/138 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+ SAVE LP+I IT E+LASD++QCAVCKD+FEL  EAKQMPCKHIYH DCI+PWLEL
Sbjct  190  PASNSAVEALPNIIITDELLASDTAQCAVCKDTFELGSEAKQMPCKHIYHSDCILPWLEL  249

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCRYELPTDDPDYE RR +Q    +         G    G      Q  RTVERR
Sbjct  250  HNSCPVCRYELPTDDPDYEQRRGNQGTANSARAGGSADSGSGRAGQVHAPMQ--RTVERR  307

Query  419  FRVSLPWLFGGFGSPAET  366
            FR+SLP +F G  SPAET
Sbjct  308  FRISLPSIFRGLISPAET  325



>ref|XP_004235401.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
 ref|XP_004235402.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
 ref|XP_010318345.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
 ref|XP_010318346.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
Length=383

 Score =   179 bits (455),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 116/152 (76%), Gaps = 13/152 (9%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKSAV GLPDI IT+E+L SDSSQCAVCKD+FEL  EAKQ+PCKHIYHKDCIMPWLEL
Sbjct  196  PAAKSAVAGLPDIKITEELLDSDSSQCAVCKDTFELGMEAKQIPCKHIYHKDCIMPWLEL  255

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPT-------------RnnnnsfglgigglggggN  459
            HNSCPVCRYELPTDDPDYENR+ SQQ T               NNN+ G+  GGL GGG+
Sbjct  256  HNSCPVCRYELPTDDPDYENRKTSQQQTANTSNTNTNTSNNNTNNNNTGVMFGGLEGGGD  315

Query  458  QENPQAPRTVERRFRVSLPWLFGGFGSPAETS  363
            Q++ Q   + ERR R+ L WLF G GSPAETS
Sbjct  316  QDSSQTSSSGERRLRIPLQWLFRGLGSPAETS  347



>ref|XP_008467256.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis melo]
 ref|XP_008467264.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis melo]
Length=377

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 106/147 (72%), Gaps = 9/147 (6%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA+EGLPDI IT+E+LA+DSSQCAVCKD+FELDE AK MPCKHIYH DCI+PWLEL
Sbjct  197  PASKSAIEGLPDIKITEELLATDSSQCAVCKDTFELDEVAKLMPCKHIYHADCIIPWLEL  256

Query  599  HNSCPVCRYELPTDDPDYENR-RNSQQPTRnnn-------nsfglgigglggggNQENPQ  444
            HNSCPVCRYELPTDDPDYE R R S  P R+ +       +S G          + EN Q
Sbjct  257  HNSCPVCRYELPTDDPDYEQRTRASSAPNRSQSESQPFGDSSTGGENVVGSDPNSDENSQ  316

Query  443  APRTVERRF-RVSLPWLFGGFGSPAET  366
              +  ERR  R++ PW F GFGS AET
Sbjct  317  TQQMGERRVRRIAFPWPFRGFGSAAET  343



>ref|XP_004137524.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004137525.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004137526.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 3 [Cucumis 
sativus]
 ref|XP_004161827.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004161828.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004161829.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 3 [Cucumis 
sativus]
 gb|KGN64207.1| hypothetical protein Csa_1G043100 [Cucumis sativus]
Length=378

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 106/147 (72%), Gaps = 9/147 (6%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA+EGLPDI IT+E+LA+DSSQCAVCKD+FELDE AK MPCKHIYH DCI+PWLEL
Sbjct  198  PASKSAIEGLPDIKITEELLATDSSQCAVCKDTFELDEVAKLMPCKHIYHADCIIPWLEL  257

Query  599  HNSCPVCRYELPTDDPDYENR-RNSQQPTRnnn-------nsfglgigglggggNQENPQ  444
            HNSCPVCRYELPTDDPDYE R R S  P R+ +       +S G          + EN Q
Sbjct  258  HNSCPVCRYELPTDDPDYEQRTRGSSAPNRSQSESQPFGDSSTGGENVVGSDPNSDENSQ  317

Query  443  APRTVERRF-RVSLPWLFGGFGSPAET  366
              +  ERR  R++ PW F GFGS AET
Sbjct  318  TQQMGERRVRRIAFPWPFRGFGSAAET  344



>ref|XP_010249658.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
Length=363

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 104/139 (75%), Gaps = 4/139 (3%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++GLPD+ I++E+LASD +QCAVCKD+FEL  EAKQMPCKHIYH DCI+PWL+L
Sbjct  194  PASKSAIDGLPDVKISEELLASDLAQCAVCKDTFELGSEAKQMPCKHIYHSDCILPWLKL  253

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCRYELPTDDPDYE RR        ++   G  +   GG   QEN Q   T ER 
Sbjct  254  HNSCPVCRYELPTDDPDYEQRRGGL--GTGSSIGDGGPVDSGGGRAGQENNQP--TTERS  309

Query  419  FRVSLPWLFGGFGSPAETS  363
            FR++LP +F  F SPAETS
Sbjct  310  FRITLPSIFRAFASPAETS  328



>gb|ACT21194.1| zinc finger protein [Carica papaya]
Length=340

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 108/142 (76%), Gaps = 3/142 (2%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA+E LP I I QEM  SDSSQCAVCKDSF L EEAKQMPCKHIYH  CI+PWLEL
Sbjct  173  PASKSAIEALPTIKIFQEMPDSDSSQCAVCKDSFALAEEAKQMPCKHIYHSQCILPWLEL  232

Query  599  HNSCPVCRYELPTDDPDYENR-RNSQQPTRnnnnsf-glgigglggggNQENPQAPRTVE  426
            HNSCPVCRYELPTDD DYE+R R ++ P +N + S   +     G  GN++NP+ PR+VE
Sbjct  233  HNSCPVCRYELPTDDADYEHRTRANRTPAQNVSGSTDAVNAVADGNAGNRDNPETPRSVE  292

Query  425  RRFRVSLPWLF-GGFGSPAETS  363
            RRFR+ LPW F   FGS AETS
Sbjct  293  RRFRIFLPWPFRSSFGSGAETS  314



>ref|XP_009401096.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Musa acuminata 
subsp. malaccensis]
Length=367

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 106/144 (74%), Gaps = 7/144 (5%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKSA+ GLPDI I+ E+LASD +QC+VC ++F+L +EAKQMPCKHI+HKDCI+PWLEL
Sbjct  190  PAAKSAITGLPDIKISVELLASDEAQCSVCMETFKLGDEAKQMPCKHIFHKDCILPWLEL  249

Query  599  HNSCPVCRYELPTDDPDYENRRN-----SQQPTRnnnnsfglgigglggggNQENPQAPR  435
            HNSCPVCR+ELPTDDPDYE RR      S +PT        + +GG  G   +    +PR
Sbjct  250  HNSCPVCRHELPTDDPDYEQRRGAPAALSARPT--AGIRDPVSVGGSAGAFAEGGAPSPR  307

Query  434  TVERRFRVSLPWLFGGFGSPAETS  363
            TVERRFR+SLPW F  FG+  E S
Sbjct  308  TVERRFRISLPWPFRIFGAQTEGS  331



>ref|XP_004299466.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Fragaria vesca 
subsp. vesca]
Length=379

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 102/150 (68%), Gaps = 11/150 (7%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAVE LP + ITQE+L SDSSQCAVCKDSFELDEEAKQMPCKHIYH DCI+PWLEL
Sbjct  194  PASKSAVEALPVVKITQELLDSDSSQCAVCKDSFELDEEAKQMPCKHIYHSDCILPWLEL  253

Query  599  HNSCPVCRYELPTDDPDYE-----------NRRNSQQPTRnnnnsfglgigglggggNQE  453
            HNSCPVCR+ELPTDD +YE           N  ++Q        +   G+GG  G     
Sbjct  254  HNSCPVCRHELPTDDSEYEQRVRGGGGDAANANSTQYAAGVGGANNSGGVGGSRGQAVDI  313

Query  452  NPQAPRTVERRFRVSLPWLFGGFGSPAETS  363
              QAPRTVERRF +SLP LF  FG   E  
Sbjct  314  QGQAPRTVERRFTISLPRLFRVFGGAPEAG  343



>ref|XP_006441411.1| hypothetical protein CICLE_v10020902mg [Citrus clementina]
 gb|ESR54651.1| hypothetical protein CICLE_v10020902mg [Citrus clementina]
Length=350

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 103/148 (70%), Gaps = 11/148 (7%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA+E LP I I + M++SDSSQCAVCKDSFEL+EEA+QMPCKHIYH DCIMPWLEL
Sbjct  171  PASKSAIEALPSIKINEAMMSSDSSQCAVCKDSFELNEEARQMPCKHIYHPDCIMPWLEL  230

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQEN----------  450
            HNSCPVCRYELPTDDPDYE RRN      +NNN+       LG G               
Sbjct  231  HNSCPVCRYELPTDDPDYEQRRNGNGDNNSNNNNSMNQSFNLGFGFGGGGSGGNDGESGG  290

Query  449  -PQAPRTVERRFRVSLPWLFGGFGSPAE  369
              + PRTVERR R+SLPW F  F S AE
Sbjct  291  NAETPRTVERRLRISLPWPFNAFASRAE  318



>ref|XP_008393509.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
 ref|XP_008393510.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
Length=388

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 108/155 (70%), Gaps = 16/155 (10%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA+  LP + I++E+LASDSSQCAVCKDSFEL EEAKQMPCKH+YH DCI+PWLEL
Sbjct  203  PASKSAIVALPVVKISEELLASDSSQCAVCKDSFELGEEAKQMPCKHLYHSDCILPWLEL  262

Query  599  HNSCPVCRYELPTDDPDYENR-----RNSQQPTRnnnnsfglgigglggggNQ-------  456
            HNSCPVCR+ELPTDDP+YE R      N  Q +++          G GG G+        
Sbjct  263  HNSCPVCRHELPTDDPEYEQRIRGDSGNGNQTSQSAAPGGTNISMGGGGSGSGFGLGIGT  322

Query  455  ---ENPQ-APRTVERRFRVSLPWLFGGFGSPAETS  363
               +NP  +PRTVERRF +SLP  FG  G PAETS
Sbjct  323  PSLDNPSPSPRTVERRFTISLPRFFGALGGPAETS  357



>ref|XP_006493415.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Citrus sinensis]
Length=352

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 101/150 (67%), Gaps = 13/150 (9%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA+E LP I I + M++SDSSQCAVCKDSFEL+EEA+QMPCKHIYH DCIMPWLEL
Sbjct  171  PASKSAIEALPSIKINEAMMSSDSSQCAVCKDSFELNEEARQMPCKHIYHPDCIMPWLEL  230

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQEN----------  450
            HNSCPVCRYELPTDDPDYE RRN      NN+N+          G               
Sbjct  231  HNSCPVCRYELPTDDPDYEQRRNGNGNGNNNSNNNNSMNQSFNLGFGFGGGGSGGNDGES  290

Query  449  ---PQAPRTVERRFRVSLPWLFGGFGSPAE  369
                + PRTVERR R+SLPW F  F S AE
Sbjct  291  GGNAETPRTVERRLRISLPWPFNAFASRAE  320



>gb|KDO48740.1| hypothetical protein CISIN_1g0186891mg [Citrus sinensis]
Length=352

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 101/150 (67%), Gaps = 13/150 (9%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA+E LP I I + M++SDSSQCAVCKDSFEL+EEA+QMPCKHIYH DCIMPWLEL
Sbjct  171  PASKSAIEALPSIKINEAMMSSDSSQCAVCKDSFELNEEARQMPCKHIYHPDCIMPWLEL  230

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQEN----------  450
            HNSCPVCRYELPTDDPDYE RRN      NN+N+          G               
Sbjct  231  HNSCPVCRYELPTDDPDYEQRRNGNGNGNNNSNNNNSMNQSFNLGFGFGGGGSGGNDGES  290

Query  449  ---PQAPRTVERRFRVSLPWLFGGFGSPAE  369
                + PRTVERR R+SLPW F  F S AE
Sbjct  291  GGNAETPRTVERRLRISLPWPFNAFASRAE  320



>ref|XP_010069512.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Eucalyptus 
grandis]
 gb|KCW57890.1| hypothetical protein EUGRSUZ_H00641 [Eucalyptus grandis]
Length=394

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 102/142 (72%), Gaps = 5/142 (4%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+A+ GLP + I +E LASD+SQCAVCKD+FEL EEAKQMPCKHIYH DCI+PWLEL
Sbjct  214  PASKTAINGLPVVKIDEESLASDNSQCAVCKDTFELGEEAKQMPCKHIYHSDCILPWLEL  273

Query  599  HNSCPVCRYELPTDDPDYE--NRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVE  426
            HNSCPVCR+ELPTDDPDYE  NR    Q          +     G   + ++ Q P+T+E
Sbjct  274  HNSCPVCRHELPTDDPDYEQRNRGPQAQQVLGGRTQTDVSSDLSGAPASGDSSQTPQTME  333

Query  425  RRFRVS--LPWLFG-GFGSPAE  369
            RRFR+S  LPW F   FGSPAE
Sbjct  334  RRFRISLPLPWPFNRTFGSPAE  355



>ref|XP_006374275.1| hypothetical protein POPTR_0015s05600g [Populus trichocarpa]
 gb|ABK95038.1| unknown [Populus trichocarpa]
 gb|ERP52072.1| hypothetical protein POPTR_0015s05600g [Populus trichocarpa]
Length=345

 Score =   165 bits (418),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 99/142 (70%), Gaps = 5/142 (4%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKSAVE LPD+ +T+E++ SDSSQCAVCKDSFEL E AKQ+PCKHIYHKDCIMPWLEL
Sbjct  174  PAAKSAVENLPDVKVTEELMQSDSSQCAVCKDSFELGEVAKQIPCKHIYHKDCIMPWLEL  233

Query  599  HNSCPVCRYELPTDDPDYENRR--NSQQPTRnnnnsfglgigglggggNQENPQAPRTVE  426
            HNSCPVCRYELPTDD DYE R+   S    +N       G     G  +  N Q PR  E
Sbjct  234  HNSCPVCRYELPTDDQDYEQRKGNGSNGVNQNVGGGINSGGSISDGDNSDGNAQTPR--E  291

Query  425  RRFRVSLPWLF-GGFGSPAETS  363
            RRFR+  PW F  G G  A +S
Sbjct  292  RRFRIPFPWPFSSGTGRSAGSS  313



>ref|XP_008240345.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Prunus mume]
Length=381

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 104/162 (64%), Gaps = 25/162 (15%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAVEGLP + I++E+L SDSSQCAVCKDSFEL EEAKQMPCKHIYH DCI+PWLEL
Sbjct  191  PASKSAVEGLPVVKISKELLDSDSSQCAVCKDSFELGEEAKQMPCKHIYHSDCILPWLEL  250

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggN-------------  459
            HNSCPVCRYELPTDD DYE R  S  P   N  +     GG+                  
Sbjct  251  HNSCPVCRYELPTDDTDYEQRL-SGAPANANRANQSAAAGGVNIFAGVGGGSGSGSGSGI  309

Query  458  ----------QENPQAPRTVERRFRVSLPWLFGGFGSPAETS  363
                       ++P  PRTVERRF +SLP LF  FG  AETS
Sbjct  310  GIGIGAPSLDNQSP-TPRTVERRFTISLPRLFRVFGGSAETS  350



>ref|NP_001064906.2| Os10g0487400 [Oryza sativa Japonica Group]
 dbj|BAF26820.2| Os10g0487400 [Oryza sativa Japonica Group]
Length=304

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 92/135 (68%), Gaps = 1/135 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLAS-DSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSA+  LPD+ +T  M+A+ D ++CAVCK+ F   E AKQMPCKHIYH DCIMPWL+
Sbjct  143  PAAKSALSTLPDVVVTDAMVAAADGAECAVCKEDFSPGEGAKQMPCKHIYHADCIMPWLD  202

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVER  423
            LHNSCP+CR+ELPTDDPDYE R+ S        ++             +E+ ++ R VER
Sbjct  203  LHNSCPICRFELPTDDPDYEGRKKSNPQPTAGVDAGAASGSSTAAEEREESGESARLVER  262

Query  422  RFRVSLPWLFGGFGS  378
            RF VSLPW F G GS
Sbjct  263  RFNVSLPWPFSGLGS  277



>gb|EAZ16486.1| hypothetical protein OsJ_31957 [Oryza sativa Japonica Group]
Length=336

 Score =   162 bits (411),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 92/135 (68%), Gaps = 1/135 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLAS-DSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSA+  LPD+ +T  M+A+ D ++CAVCK+ F   E AKQMPCKHIYH DCIMPWL+
Sbjct  175  PAAKSALSTLPDVVVTDAMVAAADGAECAVCKEDFSPGEGAKQMPCKHIYHADCIMPWLD  234

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVER  423
            LHNSCP+CR+ELPTDDPDYE R+ S        ++             +E+ ++ R VER
Sbjct  235  LHNSCPICRFELPTDDPDYEGRKKSNPQPTAGVDAGAASGSSTAAEEREESGESARLVER  294

Query  422  RFRVSLPWLFGGFGS  378
            RF VSLPW F G GS
Sbjct  295  RFNVSLPWPFSGLGS  309



>ref|XP_010687250.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score =   163 bits (413),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 102/148 (69%), Gaps = 9/148 (6%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKSAVEGLP I +T+E+L SDSS CAVC + FEL  EAKQMPCKH++H DCI+PWLEL
Sbjct  200  PAAKSAVEGLPSIKVTEELLNSDSSDCAVCMNEFELGAEAKQMPCKHVFHSDCILPWLEL  259

Query  599  HNSCPVCRYELPTDDPDYENR-RNSQQPTRnnnnsfglgigglggggNQEN--------P  447
            HNSCPVCRYELPTDDP+YE R R  ++ T +  N+ G G GG                  
Sbjct  260  HNSCPVCRYELPTDDPEYEERARGRRENTESGGNANGGGAGGNSNANGDGEGDGGLEEGS  319

Query  446  QAPRTVERRFRVSLPWLFGGFGSPAETS  363
            Q  RTVERRFR+SLPW F   GS AE S
Sbjct  320  QNDRTVERRFRISLPWPFSAAGSAAEGS  347



>gb|ACF84253.1| unknown [Zea mays]
Length=234

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 93/137 (68%), Gaps = 6/137 (4%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLAS-DSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSA+  LPD+ +T  M+A+ + ++CAVCK+ F   E AKQMPC HIYH DCIMPWLE
Sbjct  70   PAAKSALSSLPDVVVTHTMVAAAEGAECAVCKEDFSPGEVAKQMPCNHIYHTDCIMPWLE  129

Query  602  LHNSCPVCRYELPTDDPDYENRR--NSQQPTRnnnnsfglgigglggggNQENPQAPRTV  429
            LHNSCP+CR+ELPTDDPDYE R+  NSQQ       + G      G    QEN   PR V
Sbjct  130  LHNSCPICRFELPTDDPDYEVRKGSNSQQAVGIAAAASGSSTAAEGQMERQEN---PRVV  186

Query  428  ERRFRVSLPWLFGGFGS  378
            ERRF VSLPW F G G 
Sbjct  187  ERRFNVSLPWPFSGLGG  203



>ref|XP_011047757.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Populus euphratica]
Length=345

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 93/131 (71%), Gaps = 4/131 (3%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKSAVE LPD+ +T+E++ SDSSQCAVCKDSFE  E AKQ+PCKHIYHKDCI PWLEL
Sbjct  174  PAAKSAVENLPDVKVTEELMQSDSSQCAVCKDSFEPGEVAKQIPCKHIYHKDCITPWLEL  233

Query  599  HNSCPVCRYELPTDDPDYENRR--NSQQPTRnnnnsfglgigglggggNQENPQAPRTVE  426
            HNSCPVCRYELPTDD DYE R+   S    +N       G     G  +  N Q PR  E
Sbjct  234  HNSCPVCRYELPTDDQDYEQRKGDGSNGVNQNVGGGISSGGSFSDGDNSDGNAQTPR--E  291

Query  425  RRFRVSLPWLF  393
            RRFR+  PWLF
Sbjct  292  RRFRIPFPWLF  302



>ref|XP_007152550.1| hypothetical protein PHAVU_004G139600g [Phaseolus vulgaris]
 gb|ESW24544.1| hypothetical protein PHAVU_004G139600g [Phaseolus vulgaris]
Length=359

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 93/131 (71%), Gaps = 2/131 (2%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+AVEGLPD+++T+E+LASDSSQCAVCKD+FEL E AKQMPCKHIYH DCI+PWLE+
Sbjct  175  PASKTAVEGLPDVSVTEELLASDSSQCAVCKDTFELGETAKQMPCKHIYHADCILPWLEM  234

Query  599  HNSCPVCRYELPTDDPDYENR--RNSQQPTRnnnnsfglgigglggggNQENPQAPRTVE  426
            HNSCPVCRYELPTDDPDYE R  R S        +     +    GG    +     +  
Sbjct  235  HNSCPVCRYELPTDDPDYEQRAQRGSGGTGSGVASQVNWNLAVGPGGSADSSGGGDNSQR  294

Query  425  RRFRVSLPWLF  393
            RRFRVS  W F
Sbjct  295  RRFRVSSLWPF  305



>gb|AAL59019.1|AC087182_2 putative zinc finger protein [Oryza sativa Japonica Group]
 gb|AAP54362.1| Zinc finger, C3HC4 type family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG95571.1| unnamed protein product [Oryza sativa Japonica Group]
Length=370

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 92/135 (68%), Gaps = 1/135 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLAS-DSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSA+  LPD+ +T  M+A+ D ++CAVCK+ F   E AKQMPCKHIYH DCIMPWL+
Sbjct  209  PAAKSALSTLPDVVVTDAMVAAADGAECAVCKEDFSPGEGAKQMPCKHIYHADCIMPWLD  268

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVER  423
            LHNSCP+CR+ELPTDDPDYE R+ S        ++             +E+ ++ R VER
Sbjct  269  LHNSCPICRFELPTDDPDYEGRKKSNPQPTAGVDAGAASGSSTAAEEREESGESARLVER  328

Query  422  RFRVSLPWLFGGFGS  378
            RF VSLPW F G GS
Sbjct  329  RFNVSLPWPFSGLGS  343



>ref|XP_011003690.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Populus euphratica]
Length=346

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 97/139 (70%), Gaps = 5/139 (4%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAVE LPDI ++ E+L SDSSQCAVCKDSFEL EEAKQ+PCKHIYHKDCI+PWLEL
Sbjct  175  PASKSAVENLPDIKVSNELLESDSSQCAVCKDSFELGEEAKQIPCKHIYHKDCIIPWLEL  234

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPT--RnnnnsfglgigglggggNQENPQAPRTVE  426
            HN CPVCRYELPTDDPDYE R+ +      +N       G     G  +  N Q PR  +
Sbjct  235  HNWCPVCRYELPTDDPDYEQRKGNGNDGGYQNAGGGNSGGGSFSDGDNSDGNAQTPR--D  292

Query  425  RRFRVSLPWLF-GGFGSPA  372
            RRFR++  W F  G G P 
Sbjct  293  RRFRIAFQWPFSSGSGRPV  311



>gb|EAY78992.1| hypothetical protein OsI_34100 [Oryza sativa Indica Group]
Length=370

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 92/135 (68%), Gaps = 1/135 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLAS-DSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSA+  LPD+ +T  M+A+ D ++CAVCK+ F   E AKQMPCKH+YH DCIMPWL+
Sbjct  209  PAAKSALSTLPDVIVTDAMVAAADGAECAVCKEDFSPGEGAKQMPCKHMYHADCIMPWLD  268

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVER  423
            LHNSCP+CR+ELPTDDPDYE R+ S        ++             +E+ ++ R VER
Sbjct  269  LHNSCPICRFELPTDDPDYEGRKKSNPQPTAGVDAGAASGSSTAAEEREESGESARLVER  328

Query  422  RFRVSLPWLFGGFGS  378
            RF VSLPW F G GS
Sbjct  329  RFNVSLPWPFSGLGS  343



>ref|NP_001152117.1| RHC1A [Zea mays]
 gb|ACG45859.1| RHC1A [Zea mays]
 tpg|DAA49548.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=375

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 93/137 (68%), Gaps = 6/137 (4%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLAS-DSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSA+  LPD+ +T  M+A+ + ++CAVCK+ F   E AKQMPC HIYH DCIMPWLE
Sbjct  211  PAAKSALSSLPDVVVTHTMVAAAEGAECAVCKEDFSPGEVAKQMPCNHIYHTDCIMPWLE  270

Query  602  LHNSCPVCRYELPTDDPDYENRR--NSQQPTRnnnnsfglgigglggggNQENPQAPRTV  429
            LHNSCP+CR+ELPTDDPDYE R+  NSQQ       + G      G    QEN   PR V
Sbjct  271  LHNSCPICRFELPTDDPDYEVRKGSNSQQAVGIAAAASGSSTAAEGQMERQEN---PRVV  327

Query  428  ERRFRVSLPWLFGGFGS  378
            ERRF VSLPW F G G 
Sbjct  328  ERRFNVSLPWPFSGLGG  344



>ref|XP_002317728.2| hypothetical protein POPTR_0012s03370g [Populus trichocarpa]
 gb|EEE95948.2| hypothetical protein POPTR_0012s03370g [Populus trichocarpa]
Length=269

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAVE LPDI +T+E+L SDSSQCAVCKDSFEL EEAKQ+PCKHIYHKDCI PWLEL
Sbjct  175  PASKSAVENLPDIKVTKELLESDSSQCAVCKDSFELGEEAKQIPCKHIYHKDCITPWLEL  234

Query  599  HNSCPVCRYELPTDDPDYENRRNS  528
            HNSCPVCRYELPTDDPDYE R+ +
Sbjct  235  HNSCPVCRYELPTDDPDYEQRKGN  258



>ref|XP_009383684.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Musa acuminata 
subsp. malaccensis]
Length=359

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 90/129 (70%), Gaps = 2/129 (2%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKSAVE LPDI I+ E LASD +QCAVCKD+FE+ +EAK MPCKHIYHKDCI+PWL L
Sbjct  185  PAAKSAVESLPDIRISAESLASDEAQCAVCKDAFEMGDEAKLMPCKHIYHKDCILPWLGL  244

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCRYELPTDD DYE RR +  P     +  G   G   G   + N      ++R 
Sbjct  245  HNSCPVCRYELPTDDTDYEQRRGA--PAARTLSGVGNSGGSTAGASVEGNSPGSGMLQRS  302

Query  419  FRVSLPWLF  393
            F +SLPW F
Sbjct  303  FSISLPWPF  311



>ref|XP_008346897.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
 ref|XP_008346898.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
Length=381

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 101/155 (65%), Gaps = 16/155 (10%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA+E L  + I++E+LASDSSQCAVCKDSFEL EEAKQMPCKHIYH DCI+PWLEL
Sbjct  196  PASKSAIEALLVVKISEELLASDSSQCAVCKDSFELGEEAKQMPCKHIYHSDCILPWLEL  255

Query  599  HNSCPVCRYELPTDDPDYENR-----RNSQQPTRnnnnsfglgigglggggNQENPQ---  444
            HN+CPVCR+ELPTDD +YE R      N  Q +++          G GG  +        
Sbjct  256  HNTCPVCRHELPTDDSEYEQRIRGESGNGNQTSQSGALGGANISVGGGGSSSGFGFGIGA  315

Query  443  --------APRTVERRFRVSLPWLFGGFGSPAETS  363
                    +PRTVERRF +SLP  F   G  AETS
Sbjct  316  PSPDNQSPSPRTVERRFTISLPRFFRQLGGTAETS  350



>ref|XP_006655672.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Oryza brachyantha]
Length=332

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 96/141 (68%), Gaps = 12/141 (9%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDS-SQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSAV  LPD+ ++ +M+A+D  +QCAVC D F L  +AKQ+PCKH++HKDCI+PWL+
Sbjct  169  PAAKSAVAALPDVAVSADMMAADGGAQCAVCMDDFHLGADAKQLPCKHVFHKDCILPWLD  228

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVER  423
            LH+SCPVCR+ELPTDDPD+ +RR S QPT     +                  +PR  ER
Sbjct  229  LHSSCPVCRFELPTDDPDHGHRRGSDQPTAAAAAAAAAAAATP----------SPRVAER  278

Query  422  RFRVSLPW-LFGGFGSPAETS  363
            RFR+SLPW L   FG  AE+S
Sbjct  279  RFRISLPWPLRAAFGGQAESS  299



>ref|XP_003534093.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoformX2 [Glycine 
max]
 ref|XP_006587425.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X3 
[Glycine max]
 ref|XP_006587426.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X4 
[Glycine max]
Length=376

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 97/152 (64%), Gaps = 16/152 (11%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAVEGLPD+++T+E+LASDSSQCAVCKD+FEL E AKQ+PCKHIYH DCI+PWLEL
Sbjct  178  PASKSAVEGLPDVSVTEELLASDSSQCAVCKDTFELGETAKQIPCKHIYHADCILPWLEL  237

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTV---  429
            HNSCPVCRYELPTDDPDYE R        +  +  G G            P         
Sbjct  238  HNSCPVCRYELPTDDPDYEQRARRGGGGGSGGDGAGSGAAPQVNWNMALGPAGGSADSSG  297

Query  428  ----------ERRFRVSLPWLFGGFGSPAETS  363
                       RRFRVSLPW F  F   AETS
Sbjct  298  GGGSGGDSSQRRRFRVSLPWPFRQF---AETS  326



>ref|XP_009355932.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Pyrus x bretschneideri]
 ref|XP_009355933.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Pyrus x bretschneideri]
Length=381

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 99/155 (64%), Gaps = 16/155 (10%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ L  + I++++LASDSSQCAVCKDSFEL EEAKQMPCKHIYH DCI+PWLEL
Sbjct  196  PASKSAIDALLVVKISEDLLASDSSQCAVCKDSFELGEEAKQMPCKHIYHSDCILPWLEL  255

Query  599  HNSCPVCRYELPTDDPDYENR----------------RNSQQPTRnnnnsfglgigglgg  468
            HN+CPVCR+ELPTDDP+YE R                R     +     S      G+G 
Sbjct  256  HNTCPVCRHELPTDDPEYEQRIRVDSGNGNQTGQSGARGGANISMGGGGSSSGFGFGIGA  315

Query  467  ggNQENPQAPRTVERRFRVSLPWLFGGFGSPAETS  363
                    +PRTVERRF +SLP  F   G  AETS
Sbjct  316  PSPDNQSPSPRTVERRFTISLPRFFRPLGGTAETS  350



>gb|ACG33105.1| RHC1A [Zea mays]
Length=385

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 91/135 (67%), Gaps = 1/135 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLAS-DSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSA+  LPD+ +T  M+A+ + ++CAVCK+ F   E AKQMPCKHIYH DCI+PWLE
Sbjct  221  PAAKSALSSLPDVLVTHAMVAAAEGAECAVCKEDFSPGEVAKQMPCKHIYHTDCIVPWLE  280

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVER  423
            LHNSCP+CR+ELPTDDPDYE R+ +         +   G      G  +E  + PR VER
Sbjct  281  LHNSCPICRFELPTDDPDYEGRKGTNPQPAVGVAAAASGSSTAAEGQMEERQENPRVVER  340

Query  422  RFRVSLPWLFGGFGS  378
            RF VSLPW F G G 
Sbjct  341  RFNVSLPWPFSGLGG  355



>ref|XP_003549174.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max]
Length=369

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 98/147 (67%), Gaps = 11/147 (7%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KS VEGLPD+++T+E+LASDSSQCAVCKD+FEL E AKQ+PCKHIYH DCI+PWLEL
Sbjct  177  PASKSVVEGLPDVSVTEELLASDSSQCAVCKDTFELGETAKQIPCKHIYHADCILPWLEL  236

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsf--------glgigglggggNQENPQ  444
            HNSCPVCRYELPTDDPDYE R                       + +G  G   +  +  
Sbjct  237  HNSCPVCRYELPTDDPDYEQRARRGGSGGGGAAGSGAAPQVNWNMALGSGGSADSSGSGG  296

Query  443  APRTVERRFRVSLPWLFGGFGSPAETS  363
               +  RRFRVSLPW F  F   AETS
Sbjct  297  GDNSQRRRFRVSLPWPFRQF---AETS  320



>ref|XP_004982780.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Setaria italica]
Length=393

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 93/139 (67%), Gaps = 3/139 (2%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLAS-DSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSA+  LPD+ +T  M+A+ + ++CAVCK+ F   E AKQMPCKHIYH DCI+PWLE
Sbjct  226  PAAKSALSSLPDVVVTDAMVAAAEGAECAVCKEDFSPGEVAKQMPCKHIYHNDCIVPWLE  285

Query  602  LHNSCPVCRYELPTDDPDYENRR--NSQQPTRnnnnsfglgigglggggNQENPQAPRTV  429
            LHNSCP+CR+ELPTDDPDYE R+  N Q P      +   G      G  +E  +  R V
Sbjct  286  LHNSCPICRFELPTDDPDYEGRKASNPQPPVGIAAAAAPSGSSTSAEGRMEEREENARVV  345

Query  428  ERRFRVSLPWLFGGFGSPA  372
            ERRF VSLPW F G G  A
Sbjct  346  ERRFNVSLPWPFSGLGGQA  364



>gb|EYU35570.1| hypothetical protein MIMGU_mgv1a013774mg [Erythranthe guttata]
Length=211

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 91/133 (68%), Gaps = 6/133 (5%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKSAVE LP IT+ + ++ SD +QCAVCKD FE+    KQMPCKH+YH++CIMPWLEL
Sbjct  65   PAAKSAVEALPSITVDEALMKSDLAQCAVCKDDFEMGTVVKQMPCKHVYHEECIMPWLEL  124

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCRYELPTDDPDYE+  NS     +  N  G   G   G   +      R VERR
Sbjct  125  HNSCPVCRYELPTDDPDYESGGNSGSGGVSRGNGAGGAGGQAEGSDGE------RVVERR  178

Query  419  FRVSLPWLFGGFG  381
              +SLPWLFG F 
Sbjct  179  LTISLPWLFGEFA  191



>gb|KDP37541.1| hypothetical protein JCGZ_05980 [Jatropha curcas]
Length=311

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 91/130 (70%), Gaps = 13/130 (10%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + IT+EML S+ +QCAVCKD FE   EAKQMPCKH+YH DCI+PWLEL
Sbjct  179  PASKSAIDALPTVNITEEMLNSELNQCAVCKDEFEKGAEAKQMPCKHVYHNDCIVPWLEL  238

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCRYELPTDD DYE R    + ++ +NN+ G                  RTVERR
Sbjct  239  HNSCPVCRYELPTDDSDYETRTRVARESQGSNNTEGSVGDN-------------RTVERR  285

Query  419  FRVSLPWLFG  390
            F +SLPW FG
Sbjct  286  FSISLPWPFG  295



>ref|NP_001130953.1| uncharacterized LOC100192058 [Zea mays]
 gb|ACF79355.1| unknown [Zea mays]
 gb|AFW68526.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=385

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 90/135 (67%), Gaps = 1/135 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLAS-DSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKS +  LPD+ +T  M+A+ + ++CAVCK+ F   E AKQMPCKHIYH DCI+PWLE
Sbjct  221  PAAKSVLSSLPDVLVTHAMVAAAEGAECAVCKEDFSPGEVAKQMPCKHIYHTDCIVPWLE  280

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVER  423
            LHNSCP+CR+ELPTDDPDYE R+ +         +   G      G  +E  + PR VER
Sbjct  281  LHNSCPICRFELPTDDPDYEGRKGTNPQPAVGVAAAASGSSTAAEGQMEERQENPRVVER  340

Query  422  RFRVSLPWLFGGFGS  378
            RF VSLPW F G G 
Sbjct  341  RFNVSLPWPFSGLGG  355



>ref|XP_006661882.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Oryza brachyantha]
Length=363

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 95/136 (70%), Gaps = 3/136 (2%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLA-SDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSA+  LPD+ +T  M+A +D ++CAVCK+ F   E AKQMPCKHIYH +CIMPWLE
Sbjct  198  PAAKSALSTLPDVIVTDAMVAATDGAECAVCKEDFSPGEGAKQMPCKHIYHSNCIMPWLE  257

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQ-QPTRnnnnsfglgigglggggNQENPQAPRTVE  426
            LHNSCP+CR+ELPTDDPDYE+RR S  QP          G   +     +E+  + R+VE
Sbjct  258  LHNSCPICRFELPTDDPDYEDRRTSNPQPAVGMAAGAASGSSAVAEERGEESGDSARSVE  317

Query  425  RRFRVSLPWLFGGFGS  378
            +RF +SLPW F  FGS
Sbjct  318  QRF-MSLPWPFNRFGS  332



>ref|XP_002467049.1| hypothetical protein SORBIDRAFT_01g018800 [Sorghum bicolor]
 gb|EER94047.1| hypothetical protein SORBIDRAFT_01g018800 [Sorghum bicolor]
Length=398

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 90/136 (66%), Gaps = 4/136 (3%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLAS-DSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSA+  LPD+ +T  M+A+ + ++CAVCK+ F   E AKQMPCKHIYH DCI+PWLE
Sbjct  230  PAAKSALSSLPDVVVTHTMVAAAEGAECAVCKEDFSPGEVAKQMPCKHIYHTDCIVPWLE  289

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQP---TRnnnnsfglgigglggggNQENPQAPRT  432
            LHNSCP+CR+ELPTDDPDYE R+ S  P         +   G      G  +E    PR 
Sbjct  290  LHNSCPICRFELPTDDPDYEGRKGSNPPQPAVGIAAAAAASGSSTAADGQMEERQDNPRV  349

Query  431  VERRFRVSLPWLFGGF  384
            VERRF VSLPW F G 
Sbjct  350  VERRFNVSLPWPFSGL  365



>gb|KJB77384.1| hypothetical protein B456_012G134900 [Gossypium raimondii]
 gb|KJB77385.1| hypothetical protein B456_012G134900 [Gossypium raimondii]
 gb|KJB77386.1| hypothetical protein B456_012G134900 [Gossypium raimondii]
 gb|KJB77387.1| hypothetical protein B456_012G134900 [Gossypium raimondii]
Length=338

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 87/129 (67%), Gaps = 9/129 (7%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA+E LP + IT+  L S+ +QCAVC D FE   EAKQMPCKH+YHKDC++PWLEL
Sbjct  198  PASKSAIEALPSVNITKNNLNSEFNQCAVCMDDFEEGTEAKQMPCKHLYHKDCLLPWLEL  257

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCR+ELPTDDPDYE R    Q T           G  G    Q +    RTVER 
Sbjct  258  HNSCPVCRHELPTDDPDYERRVRGAQGT---------SAGNDGDNSGQRSDGDNRTVERS  308

Query  419  FRVSLPWLF  393
            FR+SLPW F
Sbjct  309  FRISLPWPF  317



>ref|XP_003574092.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brachypodium 
distachyon]
Length=366

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 92/136 (68%), Gaps = 2/136 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLAS-DSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSA+  LPD+ +T  M+A+ + ++CAVCK+ F   E AKQMPCKHIYH  CI+PWLE
Sbjct  206  PAAKSALSTLPDVVVTDSMVAAAEGAECAVCKEDFSPGEGAKQMPCKHIYHDYCIVPWLE  265

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQ-QPTRnnnnsfglgigglggggNQENPQAPRTVE  426
            LHNSCP+CR+ELPTDDPDYE  + S  QP     ++   G       G +E  +  R VE
Sbjct  266  LHNSCPICRFELPTDDPDYEGNKTSNPQPAVGIASAAASGNSSAAEEGREETGETARVVE  325

Query  425  RRFRVSLPWLFGGFGS  378
            RRF VSLPW FGG G 
Sbjct  326  RRFNVSLPWPFGGLGG  341



>ref|XP_003620140.1| RING finger protein [Medicago truncatula]
Length=238

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAVE LP I +T E+L SDSSQCAVCKD+F L E+AKQMPCKHIYH DCI+PWLEL
Sbjct  73   PASKSAVEKLPVIEVTGELLESDSSQCAVCKDTFALGEKAKQMPCKHIYHDDCILPWLEL  132

Query  599  HNSCPVCRYELPTDDPDYENR  537
            HNSCPVCR+ELPTDDPDYE R
Sbjct  133  HNSCPVCRFELPTDDPDYEQR  153



>gb|KHG22497.1| E3 ubiquitin-protein ligase RING1 [Gossypium arboreum]
Length=338

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 87/129 (67%), Gaps = 9/129 (7%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA+E LP + IT+  L S+ +QCAVC D FE   EAKQMPCKH+YHKDC++PWLEL
Sbjct  198  PASKSAIEALPLVNITKSNLNSEFNQCAVCMDDFEEGTEAKQMPCKHLYHKDCLLPWLEL  257

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCR+ELPTDDPDYE R    Q T           G  G    Q +    RTVER 
Sbjct  258  HNSCPVCRHELPTDDPDYERRVRGAQGT---------SGGNDGDNSGQRSDGDNRTVERS  308

Query  419  FRVSLPWLF  393
            FR+SLPW F
Sbjct  309  FRISLPWPF  317



>sp|P0CH30.1|RING1_GOSHI RecName: Full=E3 ubiquitin-protein ligase RING1; AltName: Full=RING 
finger protein 1 [Gossypium hirsutum]
 gb|ADI58769.1| RING-type ubiquitin E3 ligase [Gossypium hirsutum]
Length=338

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 87/129 (67%), Gaps = 9/129 (7%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA+E LP + IT+  L S+ +QCAVC D FE   EAKQMPCKH+YHKDC++PWLEL
Sbjct  198  PASKSAIEALPLVNITKSNLNSEFNQCAVCMDDFEEGTEAKQMPCKHLYHKDCLLPWLEL  257

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCR+ELPTDDPDYE R    Q T           G  G    Q +    RTVER 
Sbjct  258  HNSCPVCRHELPTDDPDYERRVRGAQGT---------SGGNDGDNSGQRSDGDNRTVERS  308

Query  419  FRVSLPWLF  393
            FR+SLPW F
Sbjct  309  FRISLPWPF  317



>ref|XP_007043255.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOX99086.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=343

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 93/134 (69%), Gaps = 4/134 (3%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + IT+  L S+ +QCAVC D FE   +AKQMPCKH+YHKDCI+PWLEL
Sbjct  198  PASKSAIDSLPSVKITKNHLNSEFNQCAVCMDEFEEGTQAKQMPCKHLYHKDCILPWLEL  257

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCR+ELPTDDPDYE R    Q T   N+  G G G  G     +N    RTVER 
Sbjct  258  HNSCPVCRHELPTDDPDYERRVRGAQGTGGGNDGEGSGGGDSGQRSAGDN----RTVERS  313

Query  419  FRVSLPWLFGGFGS  378
            FR+SLPW F   GS
Sbjct  314  FRISLPWPFRARGS  327



>gb|KJB49973.1| hypothetical protein B456_008G147900 [Gossypium raimondii]
 gb|KJB49974.1| hypothetical protein B456_008G147900 [Gossypium raimondii]
 gb|KJB49975.1| hypothetical protein B456_008G147900 [Gossypium raimondii]
 gb|KJB49976.1| hypothetical protein B456_008G147900 [Gossypium raimondii]
Length=331

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 91/134 (68%), Gaps = 4/134 (3%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + I++  L+S+ +QCAVC D FE   EAKQMPCKH+YHKDCI PWLEL
Sbjct  186  PASKSAMDTLPSVNISKHNLSSEFNQCAVCMDEFEDGTEAKQMPCKHLYHKDCIFPWLEL  245

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCR+ELPTDDPDYE R    Q T   N+    G+         +N    RTVER 
Sbjct  246  HNSCPVCRHELPTDDPDYERRVRGAQGTGGGNDGSSSGLADNAQRSAGDN----RTVERS  301

Query  419  FRVSLPWLFGGFGS  378
            FR+SLPW F   GS
Sbjct  302  FRISLPWPFRARGS  315



>ref|XP_004515274.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Cicer arietinum]
 ref|XP_004515275.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Cicer arietinum]
 ref|XP_004515276.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X3 
[Cicer arietinum]
Length=349

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 84/129 (65%), Gaps = 17/129 (13%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAVE LP I++T+E+L SDS+QCAVCKD+F L E+AKQMPCKHIYH DCI+PWLEL
Sbjct  186  PASKSAVEKLPVISVTEELLESDSAQCAVCKDTFALGEKAKQMPCKHIYHTDCILPWLEL  245

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCRYELPTDD DYE R                                  +  RR
Sbjct  246  HNSCPVCRYELPTDDADYEQRARGDGVGGGPGGG-----------------GVDDSQTRR  288

Query  419  FRVSLPWLF  393
            FR+SLPW F
Sbjct  289  FRMSLPWPF  297



>ref|XP_011022020.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Populus euphratica]
 ref|XP_011022021.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Populus euphratica]
Length=291

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 90/134 (67%), Gaps = 22/134 (16%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASD-SSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PA+K+A+E LP + +T+EM+ S+ ++QCAVCKD FE  EE K MPCKH++H+DCIMPWL+
Sbjct  175  PASKTAIEALPTMKVTEEMMKSEMNNQCAVCKDEFESGEEVKGMPCKHVFHEDCIMPWLK  234

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVER  423
            +HNSCPVCRYELPTDDPDYENR    Q +                        +  +VER
Sbjct  235  MHNSCPVCRYELPTDDPDYENRATGGQGSGG---------------------GSGGSVER  273

Query  422  RFRVSLPWLFGGFG  381
            RF +S+PW FGG G
Sbjct  274  RFTISIPWAFGGGG  287



>ref|XP_003620252.1| RING finger protein [Medicago truncatula]
Length=340

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAVE LP I +T E+L SDSSQCAVCKD+F L E+AKQMPCKHIYH DCI+PWLEL
Sbjct  175  PASKSAVEKLPVIEVTGELLESDSSQCAVCKDTFALGEKAKQMPCKHIYHDDCILPWLEL  234

Query  599  HNSCPVCRYELPTDDPDYENR  537
            HNSCPVCR+ELPTDDPDYE R
Sbjct  235  HNSCPVCRFELPTDDPDYEQR  255



>gb|EMS63398.1| E3 ubiquitin-protein ligase RING1 [Triticum urartu]
Length=228

 Score =   144 bits (362),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 92/136 (68%), Gaps = 5/136 (4%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLAS-DSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSA+  LPD+ +T  M+A+ + ++CAVCK+ F   + AKQMPCKHIYH DCI+PWLE
Sbjct  59   PAAKSALTTLPDVVVTDAMVAAAEGAECAVCKEDFSPGDGAKQMPCKHIYHADCIVPWLE  118

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQPTRnn----nnsfglgigglggggNQENPQAPR  435
            LHNSCP+CR+ELPTDDPDYE  + S   +         +   G  G    G +E+ +  R
Sbjct  119  LHNSCPICRFELPTDDPDYEGNKASNPQSAVGIAAAAAAAASGSSGAAEEGGEESGETAR  178

Query  434  TVERRFRVSLPWLFGG  387
             VERRF VSLPW FGG
Sbjct  179  VVERRFNVSLPWPFGG  194



>gb|KJB31865.1| hypothetical protein B456_005G211800 [Gossypium raimondii]
 gb|KJB31866.1| hypothetical protein B456_005G211800 [Gossypium raimondii]
 gb|KJB31867.1| hypothetical protein B456_005G211800 [Gossypium raimondii]
 gb|KJB31868.1| hypothetical protein B456_005G211800 [Gossypium raimondii]
 gb|KJB31869.1| hypothetical protein B456_005G211800 [Gossypium raimondii]
Length=332

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 90/129 (70%), Gaps = 6/129 (5%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + IT++ L+S S+QCAVC D FE   +AK+MPC+H+YHKDCI+PWLEL
Sbjct  189  PASKSAIDSLPSVKITKDHLSSKSNQCAVCMDDFEEGIQAKRMPCRHLYHKDCILPWLEL  248

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCR+ELPTDDPDYE R    Q T   N+    G  G    G+ +      T ER 
Sbjct  249  HNSCPVCRHELPTDDPDYERRVRGAQGTNGGNDGADTGGSGRRSAGDNQ------TAERS  302

Query  419  FRVSLPWLF  393
            FR+SLPW F
Sbjct  303  FRISLPWPF  311



>gb|AES76470.2| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=374

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAVE LP I +T E+L SDSSQCAVCKD+F L E+AKQMPCKHIYH DCI+PWLEL
Sbjct  209  PASKSAVEKLPVIEVTGELLESDSSQCAVCKDTFALGEKAKQMPCKHIYHDDCILPWLEL  268

Query  599  HNSCPVCRYELPTDDPDYENR  537
            HNSCPVCR+ELPTDDPDYE R
Sbjct  269  HNSCPVCRFELPTDDPDYEQR  289



>ref|XP_011070454.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Sesamum indicum]
 ref|XP_011070455.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Sesamum indicum]
 ref|XP_011070456.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Sesamum indicum]
Length=330

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 87/128 (68%), Gaps = 4/128 (3%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAV+ LP I + + +L SD +QCAVC D FE+    KQMPCKH+YH+DCI+PWLEL
Sbjct  182  PASKSAVDALPGINVDEALLKSDLAQCAVCMDDFEMGTVVKQMPCKHVYHQDCILPWLEL  241

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCRYELPTDDPDYE++ NS +    +  S        G      +    RTVERR
Sbjct  242  HNSCPVCRYELPTDDPDYESKGNSGR----SGVSQRNDGYNNGNDDLAGSSDGRRTVERR  297

Query  419  FRVSLPWL  396
            F ++LP L
Sbjct  298  FTITLPGL  305



>gb|EMT21882.1| RING finger protein 126 [Aegilops tauschii]
Length=336

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 92/134 (69%), Gaps = 3/134 (2%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLAS-DSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAA+SA+  LPD+ +T  M+A+ + ++CAVCK+ F   + AKQMPCKHIYH DCI+PWLE
Sbjct  169  PAAESALPTLPDVVVTDAMVAAAEGAECAVCKEDFSPGDGAKQMPCKHIYHADCIVPWLE  228

Query  602  LHNSCPVCRYELPTDDPDYENRR--NSQQPTRnnnnsfglgigglggggNQENPQAPRTV  429
            LHNSCP+CR+ELPTDDPDYE  +  N Q        +   G  G    G +E+ +  R V
Sbjct  229  LHNSCPICRFELPTDDPDYEGNKASNPQSAVGIAAAAAASGSSGAAEEGGEESGETARVV  288

Query  428  ERRFRVSLPWLFGG  387
            ERRF VSLPW FGG
Sbjct  289  ERRFNVSLPWPFGG  302



>gb|KJB79836.1| hypothetical protein B456_013G068800 [Gossypium raimondii]
Length=339

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 86/129 (67%), Gaps = 6/129 (5%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + I +  L S+ +QCAVC D FE   EAKQMPCKH+YHKDCI+PWLEL
Sbjct  194  PASKSAIDALPSVKIAKNNLNSEFNQCAVCMDEFEEGAEAKQMPCKHLYHKDCILPWLEL  253

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCR+ELPTDDPDYE R    Q T   N+    G       G+       RT ER 
Sbjct  254  HNSCPVCRHELPTDDPDYERRVRGAQATGGGNDGDSSGGDNEQRSGDN------RTAERS  307

Query  419  FRVSLPWLF  393
            FR+SLPW F
Sbjct  308  FRISLPWPF  316



>ref|XP_009357359.1| PREDICTED: E3 ubiquitin-protein ligase RING1, partial [Pyrus 
x bretschneideri]
Length=304

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ L  + I++++LASDSSQCAVCKDSFEL EEAKQMPCKHIYH DCI+PWLEL
Sbjct  196  PASKSAIDALLVVKISEDLLASDSSQCAVCKDSFELGEEAKQMPCKHIYHSDCILPWLEL  255

Query  599  HNSCPVCRYELPTDDPDYENR  537
            HN+CPVCR+ELPTDDP+YE R
Sbjct  256  HNTCPVCRHELPTDDPEYEQR  276



>gb|KHG01857.1| E3 ubiquitin-protein ligase RING1 [Gossypium arboreum]
Length=331

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 89/129 (69%), Gaps = 6/129 (5%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + IT++ L+S S+QCAV  D FE   +AK+MPC+H+YHKDCI+PWLEL
Sbjct  188  PASKSAIDSLPSVKITKDHLSSKSNQCAVFMDDFEEGIQAKRMPCRHLYHKDCILPWLEL  247

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCR+ELPTDDPDYE R    Q T       G   G   GG  Q +    +T ER 
Sbjct  248  HNSCPVCRHELPTDDPDYERRVRGAQGTN------GGNDGADTGGSGQRSAGDNQTAERS  301

Query  419  FRVSLPWLF  393
            FR+SLPW F
Sbjct  302  FRISLPWPF  310



>gb|EPS73974.1| hypothetical protein M569_00782, partial [Genlisea aurea]
Length=296

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 86/134 (64%), Gaps = 12/134 (9%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAV+ LP++ + +E+L S+ +QCAVCKD+FELD   KQMPCKH+YH+DCI PWLEL
Sbjct  166  PASKSAVQALPNVKVDEELLKSELAQCAVCKDAFELDTVVKQMPCKHVYHQDCIFPWLEL  225

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCRYELPTDD   +                            ++     R V+RR
Sbjct  226  HNSCPVCRYELPTDDAADDRDNRGNS------------SRTETSSQAEDGDDRQRVVQRR  273

Query  419  FRVSLPWLFGGFGS  378
            F ++LPWLFGG GS
Sbjct  274  FTITLPWLFGGLGS  287



>ref|XP_010533212.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Tarenaya hassleriana]
Length=322

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 88/129 (68%), Gaps = 17/129 (13%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + +T+EML S+ +QCAVC D FE   +AKQMPCKH+YH+DC++PWL+L
Sbjct  183  PASKSAIDALPTVKVTEEMLDSEMNQCAVCMDEFEKGSDAKQMPCKHVYHQDCLLPWLQL  242

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCR+ELPTDDPDYENR +  Q                 G G+ EN   P    RR
Sbjct  243  HNSCPVCRHELPTDDPDYENRTHGAQ-------------RSGDGQGSGENQPTP----RR  285

Query  419  FRVSLPWLF  393
            F +SLPW F
Sbjct  286  FSISLPWPF  294



>ref|XP_003557291.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brachypodium 
distachyon]
Length=338

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 90/141 (64%), Gaps = 7/141 (5%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDS-SQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSAV  LPD+ ++  M+A+D  +QCAVC D FEL   AKQ+PCKH++HKDCI+PWL+
Sbjct  177  PAAKSAVAALPDVAVSATMMAADGGAQCAVCMDDFELGASAKQLPCKHVFHKDCILPWLD  236

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVER  423
            LH+SCPVCR+ELPTD+PD++ R+  Q+                          +PR  ER
Sbjct  237  LHSSCPVCRHELPTDEPDHDRRQGDQRAAA-----ASAAAAAAAAAEASPGTPSPRVAER  291

Query  422  RFRVSLPW-LFGGFGSPAETS  363
            RFR+SLPW L    G   E+S
Sbjct  292  RFRISLPWPLRAALGGQVESS  312



>emb|CDP18533.1| unnamed protein product [Coffea canephora]
Length=319

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 92/141 (65%), Gaps = 12/141 (9%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+AV+GLPD+ + + M+ S+ +QCAVCKD FEL    KQMPCKH+YHKDCI+PWLEL
Sbjct  175  PASKTAVKGLPDVKVDEGMMKSELAQCAVCKDDFELGVLVKQMPCKHVYHKDCILPWLEL  234

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCRYELPTDDPDYE+R  S                  G G +  N Q  R VER 
Sbjct  235  HNSCPVCRYELPTDDPDYESRERSGSGDS--------NASSSGSGSSGGNSQGQRRVER-  285

Query  419  FRVSLPW--LFGGFGSPAETS  363
              ++LPW  L G FGS   T 
Sbjct  286  -VLTLPWSLLLGAFGSTGHTG  305



>ref|XP_009588217.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
tomentosiformis]
Length=314

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAVEGLP I + +E+L S+ +QCAVCKD FEL  + KQ+PCKH+YH+ CI+PWLEL
Sbjct  174  PASKSAVEGLPSIKVNEELLKSELAQCAVCKDDFELGLDVKQLPCKHVYHEGCILPWLEL  233

Query  599  HNSCPVCRYELPTDDPDYENR  537
            HNSCPVCRYELPTDDPDYENR
Sbjct  234  HNSCPVCRYELPTDDPDYENR  254



>ref|XP_009401852.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Musa acuminata 
subsp. malaccensis]
Length=303

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+AVE LPD+ IT+ +LASD +QC+VC D FE+D  AKQMPC H+YHK+CI+PWLEL
Sbjct  176  PASKAAVESLPDVKITEGLLASDEAQCSVCMDLFEMDAVAKQMPCNHVYHKECILPWLEL  235

Query  599  HNSCPVCRYELPTDDPDYENRR  534
            HNSCPVCRYELPTDDPDYE  R
Sbjct  236  HNSCPVCRYELPTDDPDYERHR  257



>ref|XP_008355430.1| PREDICTED: uncharacterized protein LOC103419088 [Malus domestica]
Length=531

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 95/157 (61%), Gaps = 18/157 (11%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KS +E L  + I+ E+LASDSSQ AVCKD FEL EEAKQMPCKHIYH DCI+PWLEL
Sbjct  344  PASKSTIEALLVVKISDELLASDSSQYAVCKDLFELGEEAKQMPCKHIYHSDCILPWLEL  403

Query  599  HNSCPVCRYELPTDDPDYENR-----RNSQQPTRnnnnsfglgigglgggg---------  462
            HN+C VCR+ELPTDD +Y+ R      N  Q +++          G  G           
Sbjct  404  HNTCLVCRHELPTDDSEYKQRIHGDSGNGNQTSQSGAPGEANISMGGSGSSSGFGFGIGA  463

Query  461  ----NQENPQAPRTVERRFRVSLPWLFGGFGSPAETS  363
                NQ    +PRTVERRF +SLP      G  A+TS
Sbjct  464  PSPYNQSQSPSPRTVERRFTISLPRFVRQLGGTAKTS  500



>ref|XP_010508254.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=333

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 84/129 (65%), Gaps = 17/129 (13%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + +T++ML S+ +QCAVC D FE     KQMPCKH++H+DC++PWLEL
Sbjct  193  PASKSAIDALPTVKVTKDMLKSEMNQCAVCMDEFEDGSGVKQMPCKHVFHQDCLLPWLEL  252

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCRYELPTDDPDYENR    Q + +   S              E  Q P    RR
Sbjct  253  HNSCPVCRYELPTDDPDYENRAQGVQASGDGQGSV-------------EGQQTP----RR  295

Query  419  FRVSLPWLF  393
            F + LPW F
Sbjct  296  FNIQLPWPF  304



>ref|XP_010466163.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=336

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 84/129 (65%), Gaps = 17/129 (13%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + +T++ML S+ +QCAVC D FE     KQMPCKH++H+DC++PWLEL
Sbjct  193  PASKSAIDALPTVKVTKDMLKSEMNQCAVCMDEFEDGSGVKQMPCKHVFHQDCLLPWLEL  252

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCRYELPTDDPDYENR    Q + +   S              E  Q P    RR
Sbjct  253  HNSCPVCRYELPTDDPDYENRAQGVQASGDGQGSV-------------EGQQTP----RR  295

Query  419  FRVSLPWLF  393
            F + LPW F
Sbjct  296  FNIQLPWPF  304



>ref|XP_010487953.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=332

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 84/129 (65%), Gaps = 17/129 (13%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + +T++ML S+ +QCAVC D FE     KQMPCKH++H+DC++PWLEL
Sbjct  189  PASKSAIDALPTVKVTKDMLKSEMNQCAVCMDEFEDGSGVKQMPCKHVFHQDCLLPWLEL  248

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCRYELPTDDPDYENR    Q + +   S              E  Q P    RR
Sbjct  249  HNSCPVCRYELPTDDPDYENRAQGVQGSGDGQGSV-------------EGQQTP----RR  291

Query  419  FRVSLPWLF  393
            F + LPW F
Sbjct  292  FNIQLPWPF  300



>ref|XP_006306505.1| hypothetical protein CARUB_v10012493mg [Capsella rubella]
 gb|EOA39403.1| hypothetical protein CARUB_v10012493mg [Capsella rubella]
Length=307

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 82/129 (64%), Gaps = 17/129 (13%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + +T+E+L S+ +QCAVC D FE   EAKQMPCKH+YH DC++PWL+L
Sbjct  173  PASKSAIDALPTVKVTKEILQSEMNQCAVCMDEFEDGIEAKQMPCKHVYHHDCLLPWLQL  232

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCR+ELPTDDPDYENR    Q + +                  E         RR
Sbjct  233  HNSCPVCRHELPTDDPDYENRTRGGQTSGDG-----------------EGSSGEAQTPRR  275

Query  419  FRVSLPWLF  393
            F +S PW F
Sbjct  276  FSISFPWSF  284



>ref|XP_009788594.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009788595.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Nicotiana sylvestris]
 ref|XP_009788596.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Nicotiana sylvestris]
Length=311

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAVEGLP I + +E+L S+ +QCAVCKD FEL  + KQ+PCKH+YH+ CI+PWLEL
Sbjct  172  PASKSAVEGLPSIKVNEELLKSELAQCAVCKDDFELGLDVKQLPCKHVYHEGCILPWLEL  231

Query  599  HNSCPVCRYELPTDDPDYENR  537
            HNSCPVCRY+LPTDDPDYENR
Sbjct  232  HNSCPVCRYKLPTDDPDYENR  252



>ref|XP_010557559.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Tarenaya hassleriana]
Length=333

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 83/129 (64%), Gaps = 17/129 (13%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + +T++ML SD +QCAVC D FE    AKQMPCKH YH+DC++PWL+L
Sbjct  188  PASKSAIDALPTVKVTEDMLNSDMNQCAVCMDEFEKGSAAKQMPCKHAYHQDCLLPWLQL  247

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCRYELPTDDPDYE R +  Q                   G+ +     +   RR
Sbjct  248  HNSCPVCRYELPTDDPDYETRTHGAQ-----------------ESGDGQGSGGNQPTPRR  290

Query  419  FRVSLPWLF  393
            F +SLPW F
Sbjct  291  FSISLPWPF  299



>ref|XP_010541863.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541864.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541865.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541866.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541867.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541868.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541869.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541870.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541871.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
Length=326

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 86/129 (67%), Gaps = 17/129 (13%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + +T+++L S+ +QCAVC D FE   +AKQMPCKH+YH+ C++PWL+L
Sbjct  182  PASKSAIDALPTVKVTEDLLNSEMNQCAVCMDEFEKGSDAKQMPCKHVYHQHCLLPWLQL  241

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCRYELPTDDPDYEN  +  Q                 G G  EN    +T  RR
Sbjct  242  HNSCPVCRYELPTDDPDYENMNHGAQ-------------RSGDGQGTGEN----QTTPRR  284

Query  419  FRVSLPWLF  393
            F +SLPW F
Sbjct  285  FSISLPWPF  293



>ref|XP_009145710.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brassica rapa]
Length=327

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 86/129 (67%), Gaps = 21/129 (16%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA+EGLP + ++++ML S+ +QCAVC D FE   + KQ+PCKH++H+DC+MPWLEL
Sbjct  181  PASKSAIEGLPTVKVSKDMLKSEMNQCAVCMDEFEDGGDVKQVPCKHVFHQDCLMPWLEL  240

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCRYELPTDDPDYE+R   Q                 GG  + +  Q PR+    
Sbjct  241  HNSCPVCRYELPTDDPDYESRSQGQ-----------------GGQTSGDGGQTPRS----  279

Query  419  FRVSLPWLF  393
            F V LPW F
Sbjct  280  FSVQLPWTF  288



>ref|XP_010500595.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=313

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 82/129 (64%), Gaps = 17/129 (13%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + +++E+L S+ +QCAVC D FE   EAKQMPCKH+YH DC++PWL+L
Sbjct  179  PASKSAIDALPTVKVSKEILQSEMNQCAVCMDEFEDGIEAKQMPCKHVYHHDCLLPWLQL  238

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCR+ELPTDDPDYENR    Q + +                  E         RR
Sbjct  239  HNSCPVCRHELPTDDPDYENRTRGGQTSGDG-----------------EGSSGETHTPRR  281

Query  419  FRVSLPWLF  393
            F +S PW F
Sbjct  282  FSISFPWSF  290



>ref|XP_010461879.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=311

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 82/129 (64%), Gaps = 17/129 (13%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + +++E+L S+ +QCAVC D FE   EAKQMPCKH+YH DC++PWL+L
Sbjct  177  PASKSAIDALPTVKVSKEILQSEMNQCAVCMDEFEDGIEAKQMPCKHVYHHDCLLPWLQL  236

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCR+ELPTDDPDYENR    Q + +                  E         RR
Sbjct  237  HNSCPVCRHELPTDDPDYENRTRGGQTSGDG-----------------EGSSGETHTPRR  279

Query  419  FRVSLPWLF  393
            F +S PW F
Sbjct  280  FSISFPWSF  288



>ref|XP_002883213.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59472.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=330

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 85/129 (66%), Gaps = 18/129 (14%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++GLP + +T++ML S+ +QCAVC D FE   + KQMPCKH++H+DC++PWL+L
Sbjct  192  PASKSAIDGLPTVKVTKDMLKSEMNQCAVCMDEFEDGSDVKQMPCKHVFHQDCLLPWLQL  251

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCR+ELPTDDPDYENR    Q + +   S              E  Q P     R
Sbjct  252  HNSCPVCRFELPTDDPDYENRTQGIQASGDGQGSV-------------EGQQTP-----R  293

Query  419  FRVSLPWLF  393
            F + LPW F
Sbjct  294  FSIQLPWPF  302



>emb|CDX82271.1| BnaA03g35500D [Brassica napus]
Length=213

 Score =   135 bits (339),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAV+GLP + +T++M+ S+ +QCAVC D FE   + KQMPCKH++H+DC+MPWLEL
Sbjct  78   PASKSAVDGLPSVKVTKDMVRSEMNQCAVCMDEFEDGGDVKQMPCKHVFHQDCLMPWLEL  137

Query  599  HNSCPVCRYELPTDDPDYENRRNSQ  525
            HNSCPVCRYELPTDDP+YE+R   Q
Sbjct  138  HNSCPVCRYELPTDDPEYESRGQGQ  162



>emb|CDY24592.1| BnaC05g32760D [Brassica napus]
Length=321

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA+EGLP + ++++ML S+ +QCAVC D FE   + KQMPCKH++H+DC+MPWLEL
Sbjct  181  PASKSAIEGLPTVKVSKDMLKSEMNQCAVCMDEFEDGGDVKQMPCKHVFHQDCLMPWLEL  240

Query  599  HNSCPVCRYELPTDDPDYENR  537
            HNSCPVCRYELPTDDPDYENR
Sbjct  241  HNSCPVCRYELPTDDPDYENR  261



>gb|EEC79816.1| hypothetical protein OsI_21260 [Oryza sativa Indica Group]
Length=221

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 88/141 (62%), Gaps = 12/141 (9%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDS-SQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSAV  LPD+ ++ +M+A+D  +QCAVC D F L   AKQ+PCKH++HKDCI+PWL+
Sbjct  58   PAAKSAVAALPDVAVSADMMAADGGAQCAVCMDDFHLGAAAKQLPCKHVFHKDCILPWLD  117

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVER  423
            LH+SCPVCR+ELPTDDP +        PT  ++                      R  ER
Sbjct  118  LHSSCPVCRFELPTDDPHHA------HPTLGSHRPAAPASASASPSPAPPP----RLAER  167

Query  422  RFRVSLPW-LFGGFGSPAETS  363
            RFR+SLPW L   FG  AE+S
Sbjct  168  RFRISLPWPLRAAFGGQAESS  188



>ref|XP_010322969.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
Length=359

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAA+SAV GLPD+ ++ E+L SD SQCAVCKD F+LDE  KQMPCKH+YH DCI+PWLE+
Sbjct  151  PAARSAVLGLPDVRVSDELLNSDLSQCAVCKDGFKLDEMVKQMPCKHMYHNDCILPWLEM  210

Query  599  HNSCPVCRYELPTDDPDYENRR  534
             NSCPVCR+ELPTDD  YE RR
Sbjct  211  RNSCPVCRFELPTDDFAYEIRR  232



>ref|XP_002437660.1| hypothetical protein SORBIDRAFT_10g000250 [Sorghum bicolor]
 gb|EER89027.1| hypothetical protein SORBIDRAFT_10g000250 [Sorghum bicolor]
Length=321

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 83/136 (61%), Gaps = 14/136 (10%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDS-SQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSAV  LPD+ ++ +M+ +D  +QCAVC D F L   AKQ+PCKH++HKDCI+PWL+
Sbjct  157  PAAKSAVASLPDVAVSADMMQADGGAQCAVCMDDFHLGAAAKQLPCKHVFHKDCILPWLD  216

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVER  423
            LH+SCPVCR+ELPTDDPDY +    Q                             R  ER
Sbjct  217  LHSSCPVCRFELPTDDPDYNHTHQQQHAASPAPAPAPAASSSP------------RVAER  264

Query  422  RFRVSLPW-LFGGFGS  378
            RFR+SLPW L   FG+
Sbjct  265  RFRISLPWPLRAAFGA  280



>ref|XP_002307159.2| hypothetical protein POPTR_0005s09270g [Populus trichocarpa]
 gb|EEE94155.2| hypothetical protein POPTR_0005s09270g [Populus trichocarpa]
Length=290

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 83/128 (65%), Gaps = 26/128 (20%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASD-SSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PA+K+A+E LP + +T+EM+ S+ ++QCAVCKD FE  EE K MPCKH++H+DCIMPWL+
Sbjct  178  PASKTAIEALPTMKVTEEMMKSEMNNQCAVCKDEFESGEEVKGMPCKHVFHEDCIMPWLK  237

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVER  423
            +HNSCPVCRYELP DDPDYENR    Q                          +   VER
Sbjct  238  MHNSCPVCRYELPADDPDYENRATGGQ-------------------------GSGGGVER  272

Query  422  RFRVSLPW  399
            RF +S+PW
Sbjct  273  RFTISIPW  280



>ref|XP_006847820.1| hypothetical protein AMTR_s00029p00043520 [Amborella trichopoda]
 gb|ERN09401.1| hypothetical protein AMTR_s00029p00043520 [Amborella trichopoda]
Length=366

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 86/133 (65%), Gaps = 6/133 (5%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA++SA++ LP++ ++ E+L SD+SQCAVCKD+FE    AKQ+PCKHIYH DCI+PWLEL
Sbjct  168  PASESAIDSLPEVRVSSELLNSDTSQCAVCKDAFEEGSFAKQLPCKHIYHGDCILPWLEL  227

Query  599  HNSCPVCRYELPTDDPDYENRR------NSQQPTRnnnnsfglgigglggggNQENPQAP  438
            HNSCPVCRYELPTDD DYE R       N  +  RN       G     G          
Sbjct  228  HNSCPVCRYELPTDDQDYERRNQGEGRPNQGEGRRNPAGQPESGGDSGEGSAGDGGSGGQ  287

Query  437  RTVERRFRVSLPW  399
            +   RRFR+S+PW
Sbjct  288  QGQGRRFRISIPW  300



>ref|XP_010034290.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Eucalyptus grandis]
 gb|KCW51329.1| hypothetical protein EUGRSUZ_J00881 [Eucalyptus grandis]
 gb|KCW51330.1| hypothetical protein EUGRSUZ_J00881 [Eucalyptus grandis]
Length=321

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 87/131 (66%), Gaps = 12/131 (9%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAV+ LP I +T+E+  S+ + CAVC+D FE   E KQMPCKHIYH DC++PWLEL
Sbjct  192  PASKSAVKNLPTIKVTEEVQNSEMNHCAVCQDDFEKYMEVKQMPCKHIYHSDCLLPWLEL  251

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCR+ELPTDDPDYENRR++ Q              G G     EN    RTV R 
Sbjct  252  HNSCPVCRHELPTDDPDYENRRSAAQ--------GSAQGSGGGTSSGGEN----RTVRRN  299

Query  419  FRVSLPWLFGG  387
            F + LP+ F G
Sbjct  300  FSIMLPYPFRG  310



>ref|XP_006359295.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum tuberosum]
Length=322

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA++SAVEGLP I + +E++ S+ +QCAVCKD FE+  + KQMPCKH+YHKDCI+PWLEL
Sbjct  186  PASRSAVEGLPTIKVDEELMRSELAQCAVCKDDFEMGLDVKQMPCKHVYHKDCIVPWLEL  245

Query  599  HNSCPVCRYELPTDDPDYENRR  534
            H+SCPVCRYELPTDDP+ ENR+
Sbjct  246  HSSCPVCRYELPTDDPENENRQ  267



>emb|CDY25360.1| BnaA05g19240D [Brassica napus]
Length=323

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA+EGLP + ++++ML S+ +QCAVC D FE   + KQMPCKH++H+DC+MPWLEL
Sbjct  180  PASKSAIEGLPTVKVSKDMLKSEMNQCAVCMDEFEDGGDVKQMPCKHVFHQDCLMPWLEL  239

Query  599  HNSCPVCRYELPTDDPDYENR  537
            HNSCPVCRYELPTDDPDYE+R
Sbjct  240  HNSCPVCRYELPTDDPDYESR  260



>emb|CDY36069.1| BnaC03g41290D [Brassica napus]
Length=217

 Score =   133 bits (334),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAV+GLP + +T++ML S+ +QCAVC D FE   + KQMPCKH++H+DC+MPWLEL
Sbjct  78   PASKSAVDGLPTVKVTKDMLRSEMNQCAVCMDEFEDGGDVKQMPCKHVFHQDCLMPWLEL  137

Query  599  HNSCPVCRYELPTDDPDYENR  537
            HNSCPVCR+ELPTDDP+YE+R
Sbjct  138  HNSCPVCRFELPTDDPEYESR  158



>ref|NP_001056529.1| Os06g0101300 [Oryza sativa Japonica Group]
 dbj|BAD69377.1| putative ring finger protein 126 isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAD67937.1| putative ring finger protein 126 isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF18443.1| Os06g0101300 [Oryza sativa Japonica Group]
 gb|EAZ35517.1| hypothetical protein OsJ_19796 [Oryza sativa Japonica Group]
 dbj|BAH00711.1| unnamed protein product [Oryza sativa Japonica Group]
Length=338

 Score =   135 bits (341),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 88/141 (62%), Gaps = 12/141 (9%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDS-SQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSAV  LPD+ ++ +M+A+D  +QCAVC D F L   AKQ+PCKH++HKDCI+PWL+
Sbjct  175  PAAKSAVAALPDVAVSADMMAADGGAQCAVCMDDFHLGAAAKQLPCKHVFHKDCILPWLD  234

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVER  423
            LH+SCPVCR+ELPTDDP +        PT  ++                      R  ER
Sbjct  235  LHSSCPVCRFELPTDDPHHA------HPTLGSHRPAAPASASASPSPAPPP----RLAER  284

Query  422  RFRVSLPW-LFGGFGSPAETS  363
            RFR+SLPW L   FG  AE+S
Sbjct  285  RFRISLPWPLRAAFGGQAESS  305



>ref|XP_010479486.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=308

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 81/129 (63%), Gaps = 17/129 (13%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + +++E+L S+ +QCAVC D FE   EAKQMPCKH+YH DC++PWL+L
Sbjct  174  PASKSAIDALPTVKVSKEILQSEMNQCAVCMDEFEDGIEAKQMPCKHVYHHDCLLPWLQL  233

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCR+ELPTDD DYENR    Q + +                  E         RR
Sbjct  234  HNSCPVCRHELPTDDLDYENRTRGGQTSGDG-----------------EGSSGETHTPRR  276

Query  419  FRVSLPWLF  393
            F +S PW F
Sbjct  277  FSISFPWSF  285



>emb|CDY72364.1| BnaAnng40830D, partial [Brassica napus]
Length=222

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + +T +ML S+ +QCAVC D FE   + KQMPCKH++H+DC+MPWLEL
Sbjct  81   PASKSAIDALPTVKVTLDMLNSEMNQCAVCMDEFEDGGDVKQMPCKHVFHQDCLMPWLEL  140

Query  599  HNSCPVCRYELPTDDPDYENR  537
            HNSCPVCRYELPTDDPDYE+R
Sbjct  141  HNSCPVCRYELPTDDPDYESR  161



>ref|XP_004964254.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Setaria italica]
Length=323

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 89/142 (63%), Gaps = 9/142 (6%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDS-SQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSAV  LPD+ ++ +M+ +D  +QCAVC D F L   AKQ+PC H++HKDCI+PWL+
Sbjct  159  PAAKSAVAALPDVAVSADMMQADGGAQCAVCMDDFHLGAAAKQLPCNHVFHKDCILPWLD  218

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVER  423
            LH+SCPVCRYELPTDDPDY  ++  +  +                  +       R  ER
Sbjct  219  LHSSCPVCRYELPTDDPDYHQQQQQRAASAPAPAPAPAPAPAPAAASSP------RVAER  272

Query  422  RFRVSLPW-LFGGFGSP-AETS  363
            RFR+SLPW L   FG+  AE+S
Sbjct  273  RFRISLPWPLRAAFGAAQAESS  294



>ref|XP_009135656.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brassica rapa]
Length=302

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAV+GLP + +T++M+ S+ +QCAVC D FE   + KQMPCKH++H+DC+MPWLEL
Sbjct  166  PASKSAVDGLPSVKVTKDMVRSEMNQCAVCMDEFEDGGDVKQMPCKHVFHQDCLMPWLEL  225

Query  599  HNSCPVCRYELPTDDPDYENR  537
            HNSCPVCRYELPTDDP+YE+R
Sbjct  226  HNSCPVCRYELPTDDPEYESR  246



>ref|NP_188629.1| E3 ubiquitin-protein ligase RING1-like protein [Arabidopsis thaliana]
 sp|Q8LPN7.1|RNG1L_ARATH RecName: Full=E3 ubiquitin-protein ligase RING1-like; AltName: 
Full=RING finger protein 1 [Arabidopsis thaliana]
 gb|AAM19951.1| AT3g19950/MPN9_19 [Arabidopsis thaliana]
 gb|AAN18152.1| At3g19950/MPN9_19 [Arabidopsis thaliana]
 gb|AEE76311.1| E3 ubiquitin-protein ligase RING1-like protein [Arabidopsis thaliana]
Length=328

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + +T++ML S+ +QCAVC D FE   + KQMPCKH++H+DC++PWLEL
Sbjct  190  PASKSAIDALPTVKVTKDMLKSEMNQCAVCMDEFEDGSDVKQMPCKHVFHQDCLLPWLEL  249

Query  599  HNSCPVCRYELPTDDPDYENR  537
            HNSCPVCR+ELPTDDPDYENR
Sbjct  250  HNSCPVCRFELPTDDPDYENR  270



>ref|XP_004236843.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
Length=309

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 85/135 (63%), Gaps = 17/135 (13%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+++AVEGLP I + +E++ S+ +QCAVCKD FE+  +  QMPCKH+YHKDCI+PWLEL
Sbjct  186  PASRAAVEGLPTIKVDEELMRSELAQCAVCKDDFEMGSDVIQMPCKHVYHKDCIIPWLEL  245

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            H+SCPVCRYELPTD+P+ ENR+                    G      +        RR
Sbjct  246  HSSCPVCRYELPTDEPENENRQRDND----------------GDSSGDGSASGSGGSGRR  289

Query  419  F-RVSLPWLFGGFGS  378
            F  +SLPW  G FG+
Sbjct  290  FTTISLPWPLGSFGA  304



>dbj|BAB01310.1| unnamed protein product [Arabidopsis thaliana]
Length=386

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + +T++ML S+ +QCAVC D FE   + KQMPCKH++H+DC++PWLEL
Sbjct  248  PASKSAIDALPTVKVTKDMLKSEMNQCAVCMDEFEDGSDVKQMPCKHVFHQDCLLPWLEL  307

Query  599  HNSCPVCRYELPTDDPDYENR  537
            HNSCPVCR+ELPTDDPDYENR
Sbjct  308  HNSCPVCRFELPTDDPDYENR  328



>ref|XP_008659413.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Zea mays]
 gb|AFW86264.1| putative RING zinc finger domain superfamily protein isoform 
1 [Zea mays]
 gb|AFW86265.1| putative RING zinc finger domain superfamily protein isoform 
2 [Zea mays]
Length=310

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 86/136 (63%), Gaps = 13/136 (10%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDS-SQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAK+AV  LPD+ ++ +M+ +D  +QCAVC D F L   AKQ+PCKH++HKDCI+PWL+
Sbjct  152  PAAKAAVASLPDVAVSADMMQADGGAQCAVCMDDFHLGAAAKQLPCKHVFHKDCIVPWLD  211

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVER  423
            LH+SCPVCR+ELPTDDPDY N  + Q                           +PR  ER
Sbjct  212  LHSSCPVCRFELPTDDPDY-NHTHQQH----------GDSSAPAPPSPAPAVSSPRVAER  260

Query  422  RFRVSLPW-LFGGFGS  378
            RFR+SLPW L   FG+
Sbjct  261  RFRISLPWPLRAAFGA  276



>ref|XP_006406436.1| hypothetical protein EUTSA_v10021059mg [Eutrema salsugineum]
 gb|ESQ47889.1| hypothetical protein EUTSA_v10021059mg [Eutrema salsugineum]
Length=345

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 85/129 (66%), Gaps = 15/129 (12%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + +T++ML S+ +QCAVC D FE   + KQMPCKH++H+DC++PWL+L
Sbjct  195  PASKSAIDALPTVKVTKDMLKSEMNQCAVCMDEFEDGSDVKQMPCKHVFHQDCLLPWLQL  254

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCRYELPTDDPDYENR   Q    + +    +           E  Q PR+    
Sbjct  255  HNSCPVCRYELPTDDPDYENRAQGQGGQSSGDGQGSV-----------EGQQTPRS----  299

Query  419  FRVSLPWLF  393
            F + LPW F
Sbjct  300  FSIQLPWPF  308



>ref|XP_006297993.1| hypothetical protein CARUB_v10014036mg, partial [Capsella rubella]
 gb|EOA30891.1| hypothetical protein CARUB_v10014036mg, partial [Capsella rubella]
Length=361

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 85/129 (66%), Gaps = 17/129 (13%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + +T++ML S+ +QCAVC D FE   + KQMPCKH++H+DC++PWL+L
Sbjct  218  PASKSAIDALPTVKVTKDMLKSEMNQCAVCMDEFEDGSDVKQMPCKHVFHQDCLLPWLQL  277

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCPVCR+EL TDDPDYE+R    Q +               G G+ E  Q P    RR
Sbjct  278  HNSCPVCRFELSTDDPDYEHRAQGIQAS-------------GDGQGSSEGQQTP----RR  320

Query  419  FRVSLPWLF  393
            F + LPW F
Sbjct  321  FSIQLPWPF  329



>ref|XP_009111341.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brassica rapa]
 ref|XP_009111349.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brassica rapa]
Length=325

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + +T +ML S+ +QCAVC D FE   + KQMPCKH++H+DC+MPWLEL
Sbjct  178  PASKSAIDALPTVKVTLDMLNSEMNQCAVCMDEFEDGGDVKQMPCKHVFHQDCLMPWLEL  237

Query  599  HNSCPVCRYELPTDDPDYENR  537
            HNSCPVCRYELPTDDPDYE+R
Sbjct  238  HNSCPVCRYELPTDDPDYESR  258



>gb|ABK96352.1| unknown [Populus trichocarpa x Populus deltoides]
Length=296

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASD-SSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PA+K A+E LP + +T+EM+ S+ ++QCAVCKD FE  EE K MPCKH++H+DCI+PWL 
Sbjct  177  PASKKAIEALPTMKVTEEMMKSEMNNQCAVCKDEFEGGEEVKGMPCKHVFHEDCIIPWLN  236

Query  602  LHNSCPVCRYELPTDDPDYENR  537
            +HNSCPVCRYELPTDDPDYENR
Sbjct  237  MHNSCPVCRYELPTDDPDYENR  258



>ref|XP_002310643.2| hypothetical protein POPTR_0007s07510g [Populus trichocarpa]
 gb|EEE91093.2| hypothetical protein POPTR_0007s07510g [Populus trichocarpa]
Length=297

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASD-SSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PA+K A+E LP + +T+EM+ S+ ++QCAVCKD FE  EE K MPCKH++H+DCI+PWL 
Sbjct  177  PASKKAIEALPTMKVTEEMMKSEMNNQCAVCKDEFEGGEEVKGMPCKHVFHEDCIIPWLN  236

Query  602  LHNSCPVCRYELPTDDPDYENR  537
            +HNSCPVCRYELPTDDPDYENR
Sbjct  237  MHNSCPVCRYELPTDDPDYENR  258



>ref|XP_002990229.1| hypothetical protein SELMODRAFT_18755, partial [Selaginella moellendorffii]
 ref|XP_002992456.1| hypothetical protein SELMODRAFT_7748, partial [Selaginella moellendorffii]
 gb|EFJ06394.1| hypothetical protein SELMODRAFT_7748, partial [Selaginella moellendorffii]
 gb|EFJ08789.1| hypothetical protein SELMODRAFT_18755, partial [Selaginella moellendorffii]
Length=99

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+A+E +P ++IT E ++ D  QCAVCKD FEL  E +QMPCKH+YH DCI+PWL  
Sbjct  19   PASKTAIEAMPVVSITSEHMSGDGGQCAVCKDEFELGSEVRQMPCKHLYHGDCILPWLAQ  78

Query  599  HNSCPVCRYELPTDDPDYEN  540
            HNSCPVCR+E+PTDDP+Y N
Sbjct  79   HNSCPVCRHEMPTDDPEYNN  98



>ref|XP_002523963.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF38331.1| zinc finger protein, putative [Ricinus communis]
Length=116

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 70/106 (66%), Gaps = 12/106 (11%)
 Frame = -2

Query  707  SQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDYENRRNS  528
            +QCAVCKD FE   EAKQMPCKH+YH DCI+PWLELHNSCPVCRYELPTDD DYE+R   
Sbjct  2    NQCAVCKDEFEKGAEAKQMPCKHVYHNDCIVPWLELHNSCPVCRYELPTDDSDYESR---  58

Query  527  QQPTRnnnnsfglgigglggggNQENPQAPRTVERRFRVSLPWLFG  390
               TR             G  G+       RTVERRF +SLPW FG
Sbjct  59   ---TRGGAEGGQGSNEVAGTTGDN------RTVERRFSISLPWPFG  95



>gb|EPS72590.1| hypothetical protein M569_02175, partial [Genlisea aurea]
Length=122

 Score =   124 bits (312),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA++SA++GL D+ IT  +L SDS+ CAVCKD+F + ++AKQMPC HIYH DCI+PWL L
Sbjct  30   PASQSAIDGLTDVIITDRVLDSDSTPCAVCKDAFVIGDKAKQMPCTHIYHTDCILPWLNL  89

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQ  522
             N+CP CR++LPTDDP YEN R + Q
Sbjct  90   RNTCPSCRFQLPTDDPVYENARRTLQ  115



>ref|XP_006393160.1| hypothetical protein EUTSA_v10011690mg [Eutrema salsugineum]
 gb|ESQ30446.1| hypothetical protein EUTSA_v10011690mg [Eutrema salsugineum]
Length=305

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ LP + +T+++L S+ +QCAVC D FE   +AK+MPCKH+YH DC++PWL+L
Sbjct  171  PASKSAIDALPTVKVTKDILQSEMNQCAVCMDEFEDGVDAKEMPCKHLYHHDCLLPWLQL  230

Query  599  HNSCPVCRYELPTDDPDYENRR  534
            HNSCPVCR+ELPTDDPDYENR 
Sbjct  231  HNSCPVCRHELPTDDPDYENRN  252



>ref|XP_003592721.1| RING finger protein [Medicago truncatula]
 gb|AES62972.1| E3 ubiquitin-protein ligase RING1-like protein [Medicago truncatula]
Length=315

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 92/142 (65%), Gaps = 10/142 (7%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K AV+ LP +T+   +L+S+ +QCAVC+D FE   + KQMPCKH+YH DC++PWLEL
Sbjct  168  PASKEAVKNLPTVTVDDALLSSELNQCAVCQDEFEKGMQVKQMPCKHVYHDDCLLPWLEL  227

Query  599  HNSCPVCRYELPTDDPDYENRR---NSQQPTRnnnnsfglgigglggggNQENPQAPRTV  429
            HNSCPVCR+ELPTDD DYENR    NS    R+       G GG GGG         R V
Sbjct  228  HNSCPVCRHELPTDDADYENRGRDDNSGDGLRSVVGGNSTGGGGSGGG------GGNRPV  281

Query  428  ERRFRVSLPWLFGGFGSPAETS  363
             R FR+SL + FG  G  A+ S
Sbjct  282  HRTFRISLRYPFGS-GDSAQDS  302



>ref|XP_009382108.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Musa acuminata 
subsp. malaccensis]
Length=295

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+AVE LPD+ + +E+LASD +QC VC D FE+   AKQMPC HIYHK CI+ WL+L
Sbjct  169  PASKAAVEILPDVEVGEELLASDDAQCLVCMDPFEIGTVAKQMPCSHIYHKQCILRWLDL  228

Query  599  HNSCPVCRYELPTDDPDYENRR  534
            HNSCPVCRYELPTDDP+YE+ +
Sbjct  229  HNSCPVCRYELPTDDPEYEHYK  250



>emb|CDY33437.1| BnaC01g32880D [Brassica napus]
Length=324

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA++ L  + +T +ML S+ +QCAVC D FE   + KQMPCKH++H+DC+MPWLEL
Sbjct  180  PASKSAIDALLTVKVTLDMLNSEMNQCAVCMDEFEDGRDVKQMPCKHVFHQDCLMPWLEL  239

Query  599  HNSCPVCRYELPTDDPDYENR  537
            HNSCPVCRYELPTDDPDYE+R
Sbjct  240  HNSCPVCRYELPTDDPDYESR  260



>ref|XP_011002257.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase RING1-like 
[Populus euphratica]
Length=292

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 81/130 (62%), Gaps = 22/130 (17%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASD-SSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            P +K A+E LP + +T+EM+ S+ ++QCAVCKD FE  EE K MPCKH++H+DCIMPWL 
Sbjct  171  PTSKKAIEALPTMKVTEEMMKSEMNNQCAVCKDEFEGGEEVKGMPCKHVFHEDCIMPWLN  230

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVER  423
            +HNSC VCRYELPTDDPDY+NR    Q                     +    +   +ER
Sbjct  231  MHNSCLVCRYELPTDDPDYDNRSPRGQ---------------------ESGGGSVGGMER  269

Query  422  RFRVSLPWLF  393
            RF +S+P  F
Sbjct  270  RFTISIPRAF  279



>ref|XP_004149872.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis sativus]
 ref|XP_004168858.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis sativus]
 gb|KGN50936.1| hypothetical protein Csa_5G350590 [Cucumis sativus]
Length=299

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 82/130 (63%), Gaps = 8/130 (6%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA+E L  IT+T+++L S+ +QCAVC D F      KQMPCKH++H  C++PWLEL
Sbjct  169  PASKSAIEKLSTITVTEDLLNSEMNQCAVCIDDFGKGIVVKQMPCKHVFHDYCLLPWLEL  228

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVERR  420
            HNSCP+CR+ELPTDD DYENR    +                   G+  +  + R VERR
Sbjct  229  HNSCPICRFELPTDDSDYENRTRGNR--------MQGNESSGEESGSGSSGSSMRRVERR  280

Query  419  FRVSLPWLFG  390
            FRV L W FG
Sbjct  281  FRVPLWWPFG  290



>gb|AFG53307.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53308.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53309.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53310.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53311.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53312.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53313.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53314.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53315.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53316.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53319.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53320.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
Length=146

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = -2

Query  749  PDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLELHNSCPVCRYE  570
            P I ITQ++L +DS+QCAVCKD FE+  E +QMPCKH+YH  CI+PWLE HNSCPVCRYE
Sbjct  1    PTIKITQDLLVTDSTQCAVCKDEFEVGTEVRQMPCKHMYHSVCILPWLEQHNSCPVCRYE  60

Query  569  LPTDDPDYENRRNSQQPTR  513
            +PTDD +YE  R+S Q + 
Sbjct  61   MPTDDVEYEQARSSGQSSH  79



>gb|AFG53317.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53318.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
Length=146

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = -2

Query  749  PDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLELHNSCPVCRYE  570
            P I ITQ++L +DS+QCAVCKD FE+  E +QMPCKH+YH  CI+PWLE HNSCPVCRYE
Sbjct  1    PTIKITQDLLVTDSTQCAVCKDEFEVGTEVRQMPCKHMYHSVCILPWLEQHNSCPVCRYE  60

Query  569  LPTDDPDYENRRNSQQPTR  513
            +PTDD +YE  R+S Q + 
Sbjct  61   MPTDDVEYEQARSSGQSSH  79



>ref|XP_007142767.1| hypothetical protein PHAVU_007G015200g [Phaseolus vulgaris]
 gb|ESW14761.1| hypothetical protein PHAVU_007G015200g [Phaseolus vulgaris]
Length=306

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAK A+E LP +T+  E+L S+ +QCAVC+D FE D + KQMPC+H YH DC++PWL L
Sbjct  158  PAAKDAIENLPTVTVDDELLNSEMNQCAVCQDEFEKDTQVKQMPCRHAYHADCLIPWLRL  217

Query  599  HNSCPVCRYELPTDDPDYENR  537
            HNSCPVCRYELPTDD +YENR
Sbjct  218  HNSCPVCRYELPTDDSEYENR  238



>gb|ABR17677.1| unknown [Picea sitchensis]
Length=451

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+++  +P I ITQ++L +DS+QCAVCKD FE+  E +QMPCKH+YH  CI+PWLE 
Sbjct  206  PASKASIGTMPTIKITQDLLVTDSTQCAVCKDEFEVGTEVRQMPCKHMYHSVCILPWLEQ  265

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPT  516
            HNSCPVCRYE+PTDD +YE  R+  Q +
Sbjct  266  HNSCPVCRYEMPTDDVEYEQVRSRGQSS  293



>ref|XP_001777565.1| predicted protein [Physcomitrella patens]
 gb|EDQ57608.1| predicted protein [Physcomitrella patens]
Length=560

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAVE +P I I+QE L +D+ QCAVCKD FEL    +QMPCKH+YH DCI+PWL  
Sbjct  340  PASKSAVEAMPTIQISQEHLGTDAMQCAVCKDEFELGALVRQMPCKHMYHADCILPWLAQ  399

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPT  516
            HNSCPVCRYE+PTDD  Y    ++  P 
Sbjct  400  HNSCPVCRYEMPTDDHSYNQSHSNSIPA  427



>ref|XP_008659414.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Zea mays]
Length=264

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 67/83 (81%), Gaps = 1/83 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDS-SQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAK+AV  LPD+ ++ +M+ +D  +QCAVC D F L   AKQ+PCKH++HKDCI+PWL+
Sbjct  152  PAAKAAVASLPDVAVSADMMQADGGAQCAVCMDDFHLGAAAKQLPCKHVFHKDCIVPWLD  211

Query  602  LHNSCPVCRYELPTDDPDYENRR  534
            LH+SCPVCR+ELPTDDPDY +  
Sbjct  212  LHSSCPVCRFELPTDDPDYNHTH  234



>ref|XP_003555841.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max]
Length=298

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAK AVE LP IT+  E+L S+ +QCAVC+D FE      QMPCKH YH DC++PWL L
Sbjct  153  PAAKDAVENLPTITVDDELLNSELNQCAVCQDEFEKGSLVTQMPCKHAYHGDCLIPWLRL  212

Query  599  HNSCPVCRYELPTDDPDYEN  540
            HNSCPVCRYELPTDD DYEN
Sbjct  213  HNSCPVCRYELPTDDADYEN  232



>ref|XP_003536735.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max]
Length=286

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAK AVE LP +T+  ++L S+ +QCAVC+D FE   +  QMPCKH YH DC++PWL L
Sbjct  154  PAAKDAVENLPTVTVDDDLLNSELNQCAVCQDEFEKGSKVTQMPCKHAYHGDCLIPWLRL  213

Query  599  HNSCPVCRYELPTDDPDYEN  540
            HNSCPVCRYELPTDD DYEN
Sbjct  214  HNSCPVCRYELPTDDADYEN  233



>dbj|BAJ95268.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=330

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 84/128 (66%), Gaps = 9/128 (7%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDS-SQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAK+AV  LPD+ ++ +M+A+D  +QCAVC D F L   AKQ+PC H++HKDCI+PWL+
Sbjct  175  PAAKAAVAALPDVAVSADMMAADGGAQCAVCMDDFLLGAAAKQLPCNHVFHKDCILPWLD  234

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQPTRnnnnsfglgigglggggNQENPQAPRTVER  423
            LH+SCPVCR+E+PTDDPDY+N +           +      G G           R +ER
Sbjct  235  LHSSCPVCRHEMPTDDPDYDNHQRQAAAAAPAPAAAAPASPGGGPSP--------RVMER  286

Query  422  RFRVSLPW  399
            RFR+SLPW
Sbjct  287  RFRISLPW  294



>emb|CDY42507.1| BnaC06g03510D [Brassica napus]
Length=339

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAVE LP + +T+EML SD  QCAVC + FE     K+MPC+H+YH DC++PWL L
Sbjct  150  PASKSAVEALPTVKLTEEMLRSDKKQCAVCMEEFEDGVGVKEMPCRHVYHHDCLLPWLRL  209

Query  599  HNSCPVCRYELPTDDPDYEN  540
            HN+CPVCR+ELPTDD DYEN
Sbjct  210  HNTCPVCRHELPTDDVDYEN  229



>emb|CCA20603.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=315

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAK A+E LP ++ITQE + ++S +CAVCKD F L EEA++MPC H +H DCI+PWL+ 
Sbjct  224  PAAKEAIEKLPVLSITQEDINTNS-ECAVCKDDFNLAEEARRMPCTHTFHPDCILPWLKQ  282

Query  599  HNSCPVCRYELPTDDPDYENRR  534
            HNSCPVCRYELPTDD DYE +R
Sbjct  283  HNSCPVCRYELPTDDADYERQR  304



>gb|ABK21010.1| unknown [Picea sitchensis]
 gb|ABR17400.1| unknown [Picea sitchensis]
Length=325

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 84/133 (63%), Gaps = 9/133 (7%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA++SAVE +P + I++  L+SD SQCAVC + FEL  EA+QMPCKH++H DCI PWL+L
Sbjct  166  PASRSAVEAMPAVEISESHLSSDVSQCAVCLEEFELGSEARQMPCKHMFHSDCIQPWLKL  225

Query  599  HNSCPVCRYELPTDDPDYENRR------NSQQPTRnnnnsfglgigglggggNQENPQAP  438
            H+SCPVCR+++P DD D +  +      NS + +R +            GG   E+ QA 
Sbjct  226  HSSCPVCRFQMPVDDEDDDTEKRQAEESNSAEDSRRDGAESEANTSDSEGG---EHGQAG  282

Query  437  RTVERRFRVSLPW  399
                R F +++PW
Sbjct  283  SERRREFSLAIPW  295



>emb|CCI42106.1| unnamed protein product [Albugo candida]
Length=258

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 69/92 (75%), Gaps = 4/92 (4%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAK A+E LP + ITQE + + + +CAVCKD F L EEA++MPC H +H DCI+PWL+ 
Sbjct  167  PAAKEAIEKLPMLAITQEDI-NINPECAVCKDEFNLAEEARRMPCTHTFHPDCILPWLKQ  225

Query  599  HNSCPVCRYELPTDDPDYENRR---NSQQPTR  513
            HNSCP+CRYELPTDD DYE +R   N +  TR
Sbjct  226  HNSCPICRYELPTDDADYERQRTPSNQENGTR  257



>ref|XP_002514591.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF47697.1| zinc finger protein, putative [Ricinus communis]
Length=479

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKS VE LP + +T+E + S+++ CAVCKD   + E+AKQ+PC H YH DCI+PWL +
Sbjct  386  PAAKSVVEKLPSVVLTKEDVESNNALCAVCKDEINVGEKAKQLPCTHRYHGDCILPWLGI  445

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPT  516
             N+CPVCRYELPTDD DYE R+ +Q+  
Sbjct  446  RNTCPVCRYELPTDDADYERRKAAQRAV  473



>ref|XP_001773353.1| predicted protein [Physcomitrella patens]
 gb|EDQ61891.1| predicted protein, partial [Physcomitrella patens]
Length=74

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAVE +P I I+QE L +D++QCAVCKD FEL    +QMPC+H+YH DCI+PWL  
Sbjct  4    PASKSAVEAMPTIQISQEHLGTDAAQCAVCKDEFELGASVRQMPCRHMYHADCILPWLAQ  63

Query  599  HNSCPVCRYEL  567
            HNSCPVCRYE+
Sbjct  64   HNSCPVCRYEM  74



>ref|XP_010243363.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
 ref|XP_010243364.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
Length=348

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K++VE +P I I+   LASD+  CA+CKD FE+D EAKQ+PCKHIYH DCI+PWL  
Sbjct  167  PASKASVESIPTIKISGNFLASDTILCAICKDEFEIDGEAKQLPCKHIYHSDCILPWLSQ  226

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTR  513
            HNSCPVCR+ LPTD+ D    R ++   R
Sbjct  227  HNSCPVCRFCLPTDEADRRPCRRTRVAVR  255



>gb|KDP31400.1| hypothetical protein JCGZ_11776 [Jatropha curcas]
Length=497

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKS VE LP + +T   L S+++ CAVCKD   + E+AKQ+PC H+YH +CI+PWL +
Sbjct  404  PAAKSVVEKLPSVVLTNVDLESNNALCAVCKDEINVGEKAKQLPCTHLYHGECIVPWLRI  463

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPT  516
             N+CPVCRYELPTDD DYE R+ +Q+  
Sbjct  464  RNTCPVCRYELPTDDADYERRKAAQRAV  491



>ref|XP_010453731.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Camelina sativa]
Length=232

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSS-QCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PA+K  V+ LP + IT E L++ ++  CA+CKD   +DE+AK++PCKH YH DCI+PWL 
Sbjct  138  PASKRVVDDLPAVVITSEQLSNGNTIVCAICKDDIVVDEKAKRLPCKHYYHGDCIVPWLG  197

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQ  522
            + N+CPVCRYELPTDDPDYE  R  Q+
Sbjct  198  IRNTCPVCRYELPTDDPDYERNRRLQR  224



>ref|XP_010942240.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Elaeis guineensis]
Length=423

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKS VE LP + +T+E +A+DS+ CAVCKD   L E AK++PC H YH  CI+PWL +
Sbjct  316  PAAKSVVENLPSVLVTEEDVANDSTCCAVCKDEISLGEMAKRLPCSHHYHGGCIVPWLGI  375

Query  599  HNSCPVCRYELPTDDPDYEN  540
             N+CPVCRYELPTDDP+YEN
Sbjct  376  RNTCPVCRYELPTDDPEYEN  395



>ref|XP_010261518.1| PREDICTED: uncharacterized protein LOC104600329 [Nelumbo nucifera]
Length=481

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAK+ VE LP I +TQ+ + +++  CAVCKD     E+AK++PC H YH DCI+PWL +
Sbjct  376  PAAKTVVENLPSIFLTQDDVQNNNVLCAVCKDEISTSEQAKRLPCSHHYHGDCIIPWLSI  435

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTR  513
             N+CPVCRYELPTDDPDYE RR  +   R
Sbjct  436  RNTCPVCRYELPTDDPDYERRRTQRAGHR  464



>ref|XP_002968394.1| hypothetical protein SELMODRAFT_451322 [Selaginella moellendorffii]
 gb|EFJ30648.1| hypothetical protein SELMODRAFT_451322 [Selaginella moellendorffii]
Length=613

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKSAV+ LP I I Q  L   S+ CAVCKD+  + E AKQMPC H+YH DCI+PWL+ 
Sbjct  347  PAAKSAVDTLPTILIEQAHLDDGSAVCAVCKDTVCVGEPAKQMPCLHLYHADCILPWLDS  406

Query  599  HNSCPVCRYELPTDDPDYENRR  534
             NSCPVCR+ELPTDDPDYE+++
Sbjct  407  RNSCPVCRFELPTDDPDYEDQK  428



>ref|XP_002988229.1| hypothetical protein SELMODRAFT_451319 [Selaginella moellendorffii]
 gb|EFJ10648.1| hypothetical protein SELMODRAFT_451319 [Selaginella moellendorffii]
Length=517

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKSAV+ L  + I Q  + S  + CA+CK+   LDE AKQ+PC H+YH+DCI+PWL  
Sbjct  303  PAAKSAVDELEMVKIAQHHIDSGIAVCAICKEQLMLDEPAKQLPCLHLYHQDCILPWLGS  362

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQ  522
             NSCPVCRYELPTDDPDYE ++N ++
Sbjct  363  RNSCPVCRYELPTDDPDYEEQKNGRK  388



>ref|XP_008797578.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like isoform X2 [Phoenix 
dactylifera]
Length=430

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAA+S VE LP + +T+E +A+D   CAVCKD   L E AK++PC H YH  CI+PWL +
Sbjct  304  PAAQSVVENLPSVVVTKEDVANDIIFCAVCKDEISLGETAKRLPCSHHYHGGCIVPWLGI  363

Query  599  HNSCPVCRYELPTDDPDYENRR  534
             N+CPVCRYELPTDDP+YEN+R
Sbjct  364  RNTCPVCRYELPTDDPEYENQR  385



>ref|XP_010087330.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis]
 gb|EXB28904.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis]
Length=449

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+ VE LP + +TQE + ++++ CAVCKD   + E+AKQ+PC H YH DCIMPWL +
Sbjct  360  PASKTVVENLPSVVLTQEDVENNNALCAVCKDEMGVGEKAKQLPCSHRYHGDCIMPWLGI  419

Query  599  HNSCPVCRYELPTDDPDYENRR  534
             N+CPVCR+ELPTDD DYE RR
Sbjct  420  RNTCPVCRHELPTDDADYERRR  441



>gb|EYU44258.1| hypothetical protein MIMGU_mgv1a026933mg [Erythranthe guttata]
Length=417

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 65/88 (74%), Gaps = 3/88 (3%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQ---CAVCKDSFELDEEAKQMPCKHIYHKDCIMPW  609
            PAAKS VE LP + +T+E    D +    CAVCKD F LDE   ++PC H+YH +CI+PW
Sbjct  312  PAAKSVVENLPLVVLTKEEFGGDDNNVAACAVCKDEFALDESVAKLPCCHLYHGECILPW  371

Query  608  LELHNSCPVCRYELPTDDPDYENRRNSQ  525
            L++ N+CPVCRYELPTDD DYE RR+++
Sbjct  372  LDIRNTCPVCRYELPTDDADYEKRRSNR  399



>ref|XP_002970557.1| hypothetical protein SELMODRAFT_451325 [Selaginella moellendorffii]
 gb|EFJ28687.1| hypothetical protein SELMODRAFT_451325 [Selaginella moellendorffii]
Length=614

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKSAV+ LP I I Q  L   S+ CAVCKD+  + E AKQMPC H+YH DCI+PWL+ 
Sbjct  344  PAAKSAVDTLPTILIEQAHLDDGSAVCAVCKDTVCVGEPAKQMPCLHLYHADCILPWLDS  403

Query  599  HNSCPVCRYELPTDDPDYENRR  534
             NSCPVCR+ELPTDDPDYE+++
Sbjct  404  RNSCPVCRFELPTDDPDYEDQK  425



>ref|XP_010678387.1| PREDICTED: uncharacterized protein LOC104893943 [Beta vulgaris 
subsp. vulgaris]
Length=464

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K  VE LP +  T+E + ++ + CAVCKD  E+ E+ KQ+PC H YH DCI+PWL +
Sbjct  375  PASKVVVEKLPSVITTKEDVVNEKALCAVCKDQIEIGEDGKQLPCLHRYHGDCILPWLGI  434

Query  599  HNSCPVCRYELPTDDPDYENRR  534
             N+CP+CRYELPTDDPDYE RR
Sbjct  435  RNTCPLCRYELPTDDPDYEQRR  456



>ref|XP_008797580.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like isoform X4 [Phoenix 
dactylifera]
Length=422

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAA+S VE LP + +T+E +A+D   CAVCKD   L E AK++PC H YH  CI+PWL +
Sbjct  304  PAAQSVVENLPSVVVTKEDVANDIIFCAVCKDEISLGETAKRLPCSHHYHGGCIVPWLGI  363

Query  599  HNSCPVCRYELPTDDPDYENRR  534
             N+CPVCRYELPTDDP+YEN+R
Sbjct  364  RNTCPVCRYELPTDDPEYENQR  385



>ref|XP_008797579.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like isoform X3 [Phoenix 
dactylifera]
Length=427

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAA+S VE LP + +T+E +A+D   CAVCKD   L E AK++PC H YH  CI+PWL +
Sbjct  304  PAAQSVVENLPSVVVTKEDVANDIIFCAVCKDEISLGETAKRLPCSHHYHGGCIVPWLGI  363

Query  599  HNSCPVCRYELPTDDPDYENRR  534
             N+CPVCRYELPTDDP+YEN+R
Sbjct  364  RNTCPVCRYELPTDDPEYENQR  385



>gb|ETO72364.1| hypothetical protein F444_11492 [Phytophthora parasitica P1976]
Length=284

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAK  VE LP + ITQ +    S++C VCKD F +D+E  ++PC+H +H DCI+PWL+ 
Sbjct  198  PAAKEVVEKLPKVKITQ-VEVDGSAECPVCKDFFAVDDEVHRLPCEHSFHPDCILPWLKQ  256

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPT  516
            HNSCP+CR+ELPTDDPDYE RR S   T
Sbjct  257  HNSCPLCRFELPTDDPDYERRRASSSST  284



>ref|XP_008907457.1| hypothetical protein PPTG_13494 [Phytophthora parasitica INRA-310]
 gb|ETI43684.1| hypothetical protein F443_11427 [Phytophthora parasitica P1569]
 gb|ETK83780.1| hypothetical protein L915_11118 [Phytophthora parasitica]
 gb|ETL37191.1| hypothetical protein L916_11015 [Phytophthora parasitica]
 gb|ETL90350.1| hypothetical protein L917_10924 [Phytophthora parasitica]
 gb|ETM43657.1| hypothetical protein L914_10948 [Phytophthora parasitica]
 gb|ETN07081.1| hypothetical protein PPTG_13494 [Phytophthora parasitica INRA-310]
 gb|ETP13502.1| hypothetical protein F441_11345 [Phytophthora parasitica CJ01A1]
 gb|ETP41604.1| hypothetical protein F442_11316 [Phytophthora parasitica P10297]
Length=284

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAK  VE LP + ITQ +    S++C VCKD F +D+E  ++PC+H +H DCI+PWL+ 
Sbjct  198  PAAKEVVEKLPKVKITQ-VEVDGSAECPVCKDFFAVDDEVHRLPCEHSFHPDCILPWLKQ  256

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPT  516
            HNSCP+CR+ELPTDDPDYE RR S   T
Sbjct  257  HNSCPLCRFELPTDDPDYERRRASSSST  284



>ref|XP_010453730.1| PREDICTED: E3 ubiquitin-protein ligase Praja-1-like isoform X1 
[Camelina sativa]
Length=344

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSS-QCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PA+K  V+ LP + IT E L++ ++  CA+CKD   +DE+AK++PCKH YH DCI+PWL 
Sbjct  250  PASKRVVDDLPAVVITSEQLSNGNTIVCAICKDDIVVDEKAKRLPCKHYYHGDCIVPWLG  309

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQ  522
            + N+CPVCRYELPTDDPDYE  R  Q+
Sbjct  310  IRNTCPVCRYELPTDDPDYERNRRLQR  336



>ref|XP_002273441.1| PREDICTED: uncharacterized protein LOC100268065 [Vitis vinifera]
Length=439

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KS V+ LP + +TQ  + ++++ CAVCKD   + E AKQ+PC H YH DCIMPWL +
Sbjct  351  PASKSVVKNLPVVVLTQGDVENNNALCAVCKDEINVGELAKQLPCSHRYHGDCIMPWLGI  410

Query  599  HNSCPVCRYELPTDDPDYENRRN  531
             N+CPVCRYELPTDDP YE RRN
Sbjct  411  RNTCPVCRYELPTDDPQYEQRRN  433



>ref|XP_004141480.1| PREDICTED: uncharacterized protein LOC101208708 [Cucumis sativus]
Length=415

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 68/89 (76%), Gaps = 2/89 (2%)
 Frame = -2

Query  779  PAAKSAVEGLPDITI-TQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSAVE LP + + T+  LA +   CAVCKD F ++E+ +++PC H YH DCI+PWL 
Sbjct  311  PAAKSAVENLPLVELKTENTLAEEVVVCAVCKDKFSMEEKVRKLPCGHYYHDDCILPWLN  370

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQPT  516
            + N+CPVCR+ELPTDDPDYE RR SQ+ +
Sbjct  371  IRNTCPVCRHELPTDDPDYE-RRQSQRAS  398



>ref|XP_004156174.1| PREDICTED: uncharacterized protein LOC101225971 [Cucumis sativus]
Length=417

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 68/89 (76%), Gaps = 2/89 (2%)
 Frame = -2

Query  779  PAAKSAVEGLPDITI-TQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSAVE LP + + T+  LA +   CAVCKD F ++E+ +++PC H YH DCI+PWL 
Sbjct  313  PAAKSAVENLPLVELKTENTLAEEVVVCAVCKDKFSMEEKVRKLPCGHYYHDDCILPWLN  372

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQPT  516
            + N+CPVCR+ELPTDDPDYE RR SQ+ +
Sbjct  373  IRNTCPVCRHELPTDDPDYE-RRQSQRAS  400



>dbj|BAC42901.1| unknown protein [Arabidopsis thaliana]
Length=121

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  725  MLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLELHNSCPVCRYELPTDDPDY  546
            ML S+ +QCAVC D FE   + KQMPCKH++H+DC++PWLELHNSCPVCR+ELPTDDPDY
Sbjct  1    MLKSEMNQCAVCMDEFEDGSDVKQMPCKHVFHQDCLLPWLELHNSCPVCRFELPTDDPDY  60

Query  545  ENR  537
            ENR
Sbjct  61   ENR  63



>gb|KGN52539.1| hypothetical protein Csa_5G642700 [Cucumis sativus]
Length=432

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 68/89 (76%), Gaps = 2/89 (2%)
 Frame = -2

Query  779  PAAKSAVEGLPDITI-TQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSAVE LP + + T+  LA +   CAVCKD F ++E+ +++PC H YH DCI+PWL 
Sbjct  328  PAAKSAVENLPLVELKTENTLAEEVVVCAVCKDKFSMEEKVRKLPCGHYYHDDCILPWLN  387

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQPT  516
            + N+CPVCR+ELPTDDPDYE RR SQ+ +
Sbjct  388  IRNTCPVCRHELPTDDPDYE-RRQSQRAS  415



>ref|XP_010257498.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
 ref|XP_010257499.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
 ref|XP_010257500.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
Length=345

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KS+VE +P I IT   L+SD+  CAVCKD F +D EAKQ+PCKHIYH +CI+PWL  
Sbjct  158  PASKSSVESIPTIKITSSFLSSDTILCAVCKDEFVVDVEAKQLPCKHIYHSNCILPWLSQ  217

Query  599  HNSCPVCRYELPTDD  555
            HNSCPVCR+ LPTD+
Sbjct  218  HNSCPVCRFRLPTDE  232



>emb|CDO98521.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAK+ V+ LP + + +E L  +S  CAVCKD   + E+A+Q+PC H YH DCI+PWL +
Sbjct  348  PAAKNVVKSLPLVILCEEDLKKNSLICAVCKDEMGVGEKARQLPCNHRYHGDCILPWLGI  407

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPT  516
             N+CPVCRYELPTDDPDYE R+  Q+ T
Sbjct  408  RNTCPVCRYELPTDDPDYERRKRDQRAT  435



>ref|XP_008797577.1| PREDICTED: uncharacterized protein LOC103712744 isoform X1 [Phoenix 
dactylifera]
Length=495

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAA+S VE LP + +T+E +A+D   CAVCKD   L E AK++PC H YH  CI+PWL +
Sbjct  304  PAAQSVVENLPSVVVTKEDVANDIIFCAVCKDEISLGETAKRLPCSHHYHGGCIVPWLGI  363

Query  599  HNSCPVCRYELPTDDPDYENRR  534
             N+CPVCRYELPTDDP+YEN+R
Sbjct  364  RNTCPVCRYELPTDDPEYENQR  385



>gb|AFG68993.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG68994.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG68995.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG68996.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG68997.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG68998.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG68999.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69000.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69001.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69002.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69003.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69004.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69005.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69006.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69007.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69008.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69009.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69010.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
Length=138

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAA+S +E LP I I Q      SS CA+CKDS  L ++AKQ+PC H+YH +CI+PWL  
Sbjct  52   PAAQSVIEQLPLIIIRQAHEEDGSSVCAICKDSLALGDQAKQLPCMHLYHPNCILPWLGA  111

Query  599  HNSCPVCRYELPTDDPDYENRR  534
             NSCPVCRYELPTDDP+YE  +
Sbjct  112  RNSCPVCRYELPTDDPEYEEEK  133



>ref|XP_008459416.1| PREDICTED: uncharacterized protein LOC103498560 [Cucumis melo]
Length=426

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = -2

Query  779  PAAKSAVEGLPDITI-TQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSAVE LP + + T+  LA +   CAVCKD F ++E+ +++PC H YH DCI+PWL 
Sbjct  322  PAAKSAVENLPLVELKTENTLAEEVVVCAVCKDKFSMEEKVRKLPCGHYYHDDCILPWLN  381

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQ  522
            + N+CPVCR+ELPTDDPDYE RR SQ+
Sbjct  382  IRNTCPVCRHELPTDDPDYE-RRQSQR  407



>gb|ADN34278.1| zinc finger protein [Cucumis melo subsp. melo]
Length=409

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = -2

Query  779  PAAKSAVEGLPDITI-TQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKSAVE LP + + T+  LA +   CAVCKD F ++E+ +++PC H YH DCI+PWL 
Sbjct  305  PAAKSAVENLPLVELKTENTLAEEVVVCAVCKDKFSMEEKVRKLPCGHYYHDDCILPWLN  364

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQ  522
            + N+CPVCR+ELPTDDPDYE RR SQ+
Sbjct  365  IRNTCPVCRHELPTDDPDYE-RRQSQR  390



>emb|CBI15364.3| unnamed protein product [Vitis vinifera]
Length=1427

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -2

Query  779   PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
             PA+KS V+ LP + +TQ  + ++++ CAVCKD   + E AKQ+PC H YH DCIMPWL +
Sbjct  1271  PASKSVVKNLPVVVLTQGDVENNNALCAVCKDEINVGELAKQLPCSHRYHGDCIMPWLGI  1330

Query  599   HNSCPVCRYELPTDDPDYENRRN  531
              N+CPVCRYELPTDDP YE RRN
Sbjct  1331  RNTCPVCRYELPTDDPQYEQRRN  1353



>gb|KJB19466.1| hypothetical protein B456_003G104200 [Gossypium raimondii]
Length=474

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KS VE LP + +TQE + ++++ CAVCKD   L E+ KQ+PC H YH DCI+PWL +
Sbjct  385  PASKSVVENLPCVVVTQEDVVNNNALCAVCKDEVNLGEKMKQLPCAHRYHGDCIIPWLGI  444

Query  599  HNSCPVCRYELPTDDPDYENRRN  531
             N+CPVCR+ELPTDD DYE RR+
Sbjct  445  RNTCPVCRHELPTDDADYERRRS  467



>emb|CAN63309.1| hypothetical protein VITISV_017174 [Vitis vinifera]
Length=310

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKS V+ LP + +TQ+ L  ++  CAVCKD   L+E+ K++PC H YH DCI+PWL +
Sbjct  221  PAAKSVVQNLPVVELTQQYLEKNNVVCAVCKDEILLEEKVKRLPCSHHYHGDCIVPWLSI  280

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTR  513
             N+CPVCRYELPTDDP+YE+ + SQ+  R
Sbjct  281  RNTCPVCRYELPTDDPEYEHMK-SQRTGR  308



>ref|XP_002991361.1| hypothetical protein SELMODRAFT_429694 [Selaginella moellendorffii]
 gb|EFJ07473.1| hypothetical protein SELMODRAFT_429694 [Selaginella moellendorffii]
Length=512

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKSAV+ L  + I Q  + S  + CA+CK+   LDE AKQ+PC H+YH+DCI+PWL  
Sbjct  298  PAAKSAVDELEMVKIAQHHIDSGIAVCAICKEQLMLDEPAKQLPCLHLYHQDCILPWLGS  357

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQ  522
             NSCPVCRYELPTDDPDYE ++  ++
Sbjct  358  RNSCPVCRYELPTDDPDYEEQKKGRK  383



>emb|CDP02365.1| unnamed protein product [Coffea canephora]
Length=402

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKS VE LP + +T E L ++   CAVCKD   L  E  ++PC H YH+DCIMPWL +
Sbjct  299  PAAKSVVENLPSVVLTTEDLMANDVVCAVCKDEISLGVEVTRLPCSHHYHQDCIMPWLSI  358

Query  599  HNSCPVCRYELPTDDPDYENRRN  531
             N+CP+CR+ELPTDD DYE R+N
Sbjct  359  RNTCPLCRFELPTDDVDYERRKN  381



>ref|XP_007037687.1| Zinc finger protein, putative isoform 2, partial [Theobroma cacao]
 gb|EOY22188.1| Zinc finger protein, putative isoform 2, partial [Theobroma cacao]
Length=446

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K  VE LP + +TQE + + ++ CAVCKD   L E+ KQ+PC H YH DCI+PWL +
Sbjct  357  PASKYVVENLPSVVVTQEDVVNGNALCAVCKDEVNLGEKMKQLPCAHRYHGDCIIPWLGI  416

Query  599  HNSCPVCRYELPTDDPDYENRR  534
             N+CPVCR+ELPTDD DYE RR
Sbjct  417  RNTCPVCRHELPTDDADYERRR  438



>ref|XP_009515775.1| hypothetical protein PHYSODRAFT_294053 [Phytophthora sojae]
 gb|EGZ28500.1| hypothetical protein PHYSODRAFT_294053 [Phytophthora sojae]
Length=297

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAK  VE LP + ITQ  +   S++C VCKD F +D+E  ++PC+H +H DCI+PWL+ 
Sbjct  211  PAAKEVVEKLPKVKITQSDVDG-SAECPVCKDFFAVDDEVHRLPCEHSFHPDCILPWLKD  269

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPT  516
            HNSCP+CR+ELPTDDPDYE RR +   T
Sbjct  270  HNSCPLCRFELPTDDPDYERRRAASATT  297



>ref|XP_008878243.1| hypothetical protein H310_12817 [Aphanomyces invadans]
 gb|ETV93221.1| hypothetical protein H310_12817 [Aphanomyces invadans]
Length=313

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAK+ +E LP + I+Q  +  D   CAVCKD +EL EEA ++PC H +H DCIMPWL+ 
Sbjct  218  PAAKTVLESLPKVHISQGEV-DDKHDCAVCKDVYELKEEAIRLPCSHDFHTDCIMPWLKQ  276

Query  599  HNSCPVCRYELPTDDPDYENRR  534
            HNSCPVCRYELPTDD +YE  R
Sbjct  277  HNSCPVCRYELPTDDQEYETAR  298



>ref|XP_002906712.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY66113.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=266

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAK  V+ LP + ITQ  +   S++C VCKD F +D+E  ++PC+H +H DCI+PWL+ 
Sbjct  180  PAAKEVVDKLPKVKITQGEV-DGSAECPVCKDFFAVDDEVHRLPCEHSFHPDCILPWLKQ  238

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPT  516
            HNSCP+CR+ELPTDDPDYE RR +   T
Sbjct  239  HNSCPLCRFELPTDDPDYERRRAASTST  266



>ref|XP_002317961.2| hypothetical protein POPTR_0012s06680g [Populus trichocarpa]
 gb|EEE96181.2| hypothetical protein POPTR_0012s06680g [Populus trichocarpa]
Length=423

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKS VE LP + +T+  + S+++ CAVCKD   + E  KQ+PC H YH +CI+PWL +
Sbjct  330  PAAKSVVEKLPSMVVTKGDVESNNAVCAVCKDDTNVGERVKQLPCMHRYHGECIVPWLGI  389

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPT  516
             N+CPVCRYELPTDD DYE R+ +++P 
Sbjct  390  RNTCPVCRYELPTDDADYERRKVAERPA  417



>ref|XP_010660538.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Vitis vinifera]
Length=397

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKS V+ LP + +TQ+ L  ++  CAVCKD   L+E+ K++PC H YH DCI+PWL +
Sbjct  308  PAAKSVVQNLPVVELTQQYLEKNNVVCAVCKDEILLEEKVKRLPCSHHYHGDCIVPWLSI  367

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTR  513
             N+CPVCRYELPTDDP+YE+ + SQ+  R
Sbjct  368  RNTCPVCRYELPTDDPEYEHMK-SQRTGR  395



>ref|XP_007037686.1| Zinc finger protein, putative isoform 1 [Theobroma cacao]
 ref|XP_007037688.1| Zinc finger protein, putative isoform 1 [Theobroma cacao]
 gb|EOY22187.1| Zinc finger protein, putative isoform 1 [Theobroma cacao]
 gb|EOY22189.1| Zinc finger protein, putative isoform 1 [Theobroma cacao]
Length=471

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K  VE LP + +TQE + + ++ CAVCKD   L E+ KQ+PC H YH DCI+PWL +
Sbjct  382  PASKYVVENLPSVVVTQEDVVNGNALCAVCKDEVNLGEKMKQLPCAHRYHGDCIIPWLGI  441

Query  599  HNSCPVCRYELPTDDPDYENRR  534
             N+CPVCR+ELPTDD DYE RR
Sbjct  442  RNTCPVCRHELPTDDADYERRR  463



>ref|XP_008803022.1| PREDICTED: E3 ubiquitin-protein ligase Praja-2 [Phoenix dactylifera]
 ref|XP_008803024.1| PREDICTED: E3 ubiquitin-protein ligase Praja-2 [Phoenix dactylifera]
 ref|XP_008803025.1| PREDICTED: E3 ubiquitin-protein ligase Praja-2 [Phoenix dactylifera]
 ref|XP_008803026.1| PREDICTED: E3 ubiquitin-protein ligase Praja-2 [Phoenix dactylifera]
Length=536

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAA S V  LP + I+++   +DS  CAVCKD   ++ EAKQ+PCKH+YH  CI+PWL  
Sbjct  329  PAAASFVASLPSVIISKDHERNDSLICAVCKDPLPINTEAKQLPCKHLYHPSCILPWLAA  388

Query  599  HNSCPVCRYELPTDDPDYENRRN  531
             NSCPVCRYELPTDDP+YE +RN
Sbjct  389  RNSCPVCRYELPTDDPEYEGKRN  411



>ref|XP_009415542.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Musa acuminata 
subsp. malaccensis]
Length=382

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKS +E LP + +T+E +A  ++ CAVCKD   + E  KQ+PC H+YH+DCI+PWL +
Sbjct  275  PAAKSVIESLPSVLLTEEDVAKANALCAVCKDGILVGERVKQLPCCHLYHEDCILPWLGI  334

Query  599  HNSCPVCRYELPTDDPDYE  543
             N+CPVCR+ELPTDDP+YE
Sbjct  335  RNTCPVCRFELPTDDPEYE  353



>ref|NP_197086.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 emb|CAC01781.1| putative protein [Arabidopsis thaliana]
 gb|AAL15297.1| AT5g15820/F14F8_200 [Arabidopsis thaliana]
 gb|AAM47324.1| AT5g15820/F14F8_200 [Arabidopsis thaliana]
 gb|AED92211.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=348

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KS V+GLPD+ +T E L+S S  CA+CKD     E+ K++PCKH YH +CI+PWL +
Sbjct  265  PASKSVVDGLPDVELTIEELSSVSIVCAICKDEVVFKEKVKRLPCKHYYHGECIIPWLGI  324

Query  599  HNSCPVCRYELPTDDPDYENRR  534
             N+CPVCR+ELPTDD +YE +R
Sbjct  325  RNTCPVCRHELPTDDLEYERKR  346



>gb|ABK25012.1| unknown [Picea sitchensis]
Length=377

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 69/88 (78%), Gaps = 2/88 (2%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA++SAV+ +P + I ++ L  +S  CAVC D FE+  EA++MPCKHIYH DCI+PWL  
Sbjct  186  PASRSAVDAMPTVRIAEKHLCIES-HCAVCTDEFEIGGEAREMPCKHIYHADCILPWLAQ  244

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPT  516
            HNSCPVCR+E+PTDD +Y +R++++ PT
Sbjct  245  HNSCPVCRHEMPTDDENY-DRQSARSPT  271



>ref|XP_008384934.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
Length=366

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 64/84 (76%), Gaps = 5/84 (6%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAVE +P I I +  + SDS  CAVCK++FEL  EA++MPCKHIYH DCI+PWL +
Sbjct  160  PASKSAVESMPVILIAETHVVSDS-HCAVCKEAFELGSEAREMPCKHIYHPDCILPWLSM  218

Query  599  HNSCPVCRYELPTDDPDYENRRNS  528
             NSCPVCR+ELP D    +N RNS
Sbjct  219  RNSCPVCRHELPAD----QNNRNS  238



>ref|XP_010654254.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Vitis vinifera]
Length=365

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+AVE LP I I    + S+S  CAVCK+ FELD EA+++PCKHIYH DCI+PWL L
Sbjct  162  PASKAAVESLPTIKIVASHVLSES-HCAVCKEPFELDSEARELPCKHIYHSDCILPWLSL  220

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQP  519
             NSCPVCR+ELPTD  +  +  + Q P
Sbjct  221  RNSCPVCRHELPTDSHEGGSSGHLQSP  247



>ref|XP_010420259.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=195

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSS-QCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PA+K  V+ LP + IT E L++ ++  CA+CKD   +DE+AK++PC H YH +CI+PWL 
Sbjct  101  PASKRVVDDLPAVVITSEQLSNGNTIVCAICKDDIVVDEKAKRLPCNHYYHGECIVPWLG  160

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQ  522
            + N+CPVCRYELPTDDP+YE  R  Q+
Sbjct  161  IRNTCPVCRYELPTDDPEYERNRRLQR  187



>emb|CDX75998.1| BnaA04g02620D [Brassica napus]
Length=192

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKS+++ LP + I Q+ L S  S C VCK+ FEL  EAKQMPCKH+YH DCI+PWL  
Sbjct  42   PAAKSSIDALPTVKIIQKHLKSSDSHCPVCKEEFELKSEAKQMPCKHVYHSDCIVPWLVQ  101

Query  599  HNSCPVCRYELPT  561
            HN+CPVCR ELP+
Sbjct  102  HNTCPVCRKELPS  114



>ref|XP_006345087.1| PREDICTED: uncharacterized protein LOC102578405 [Solanum tuberosum]
Length=432

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+ V  LP + ++++ L  +++ CA+CKD   L E+A+Q+PC H YH DCI PWL +
Sbjct  339  PASKTVVRDLPTVAVSKDDLEKNNATCAICKDELNLGEKARQLPCAHRYHGDCIQPWLGI  398

Query  599  HNSCPVCRYELPTDDPDYENRRNSQ  525
             N+CPVCRYELPTDDP YE RR  Q
Sbjct  399  RNTCPVCRYELPTDDPGYERRRRVQ  423



>ref|XP_007151431.1| hypothetical protein PHAVU_004G045600g [Phaseolus vulgaris]
 gb|ESW23425.1| hypothetical protein PHAVU_004G045600g [Phaseolus vulgaris]
Length=379

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 64/83 (77%), Gaps = 1/83 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITIT-QEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PAAKS VE LP + ++ +E+L   +  CA+CKD   L+E+ +++PC H YH DCI+PWLE
Sbjct  279  PAAKSVVESLPLVELSKEELLQGKNLACAICKDEILLEEKVRRLPCSHCYHGDCILPWLE  338

Query  602  LHNSCPVCRYELPTDDPDYENRR  534
            + N+CPVCR+ELPTDDPDYE R+
Sbjct  339  IRNTCPVCRFELPTDDPDYEQRK  361



>gb|AFG56549.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
Length=135

 Score =   107 bits (266),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA++SAVE +  + I+QE L+SD SQCAVC + FE+  EA++MPCKH++H DCI PWL+L
Sbjct  40   PASRSAVEAMAAVKISQEHLSSDLSQCAVCLEEFEVGSEAREMPCKHMFHSDCIQPWLKL  99

Query  599  HNSCPVCRYELP  564
            H+SCPVCRY++P
Sbjct  100  HSSCPVCRYQMP  111



>ref|XP_009375922.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Pyrus x bretschneideri]
Length=366

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 64/84 (76%), Gaps = 5/84 (6%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAVE +P I I +  + SDS  CAVCK++FEL  EA++MPCKHIYH DCI+PWL +
Sbjct  160  PASKSAVESMPVIQIAETHVVSDS-HCAVCKEAFELGSEAREMPCKHIYHPDCILPWLSM  218

Query  599  HNSCPVCRYELPTDDPDYENRRNS  528
             NSCPVCR+ELP D    +N RNS
Sbjct  219  RNSCPVCRHELPAD----QNNRNS  238



>ref|XP_008356868.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
Length=366

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 63/84 (75%), Gaps = 5/84 (6%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAVE +P I I    + SDS  CAVCK++FEL  EA++MPCKHIYH DCI+PWL +
Sbjct  160  PASKSAVESMPVIQIADTHVGSDS-HCAVCKEAFELGSEAREMPCKHIYHPDCILPWLSM  218

Query  599  HNSCPVCRYELPTDDPDYENRRNS  528
             NSCPVCR+ELP D    +N RNS
Sbjct  219  RNSCPVCRHELPAD----QNNRNS  238



>ref|XP_009346389.1| PREDICTED: uncharacterized protein LOC103938109 [Pyrus x bretschneideri]
Length=482

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAA + VE LP + +TQE +   ++ CAVCKD  +  E+AKQ+PC H YH DCI+PWL +
Sbjct  386  PAANAVVESLPSVVLTQEDVEKGNALCAVCKDEMKSGEQAKQLPCTHRYHGDCIVPWLRI  445

Query  599  HNSCPVCRYELPTDDPDYENRRN  531
             N+CPVCR+ELPTDD  YE RRN
Sbjct  446  RNTCPVCRHELPTDDATYERRRN  468



>ref|XP_004307482.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Fragaria vesca 
subsp. vesca]
Length=385

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKSAVE LP I +    +A D S CAVCK++FEL  EA++MPCKHIYH DCI+PWL  
Sbjct  160  PAAKSAVESLPTIELKDSHVA-DESHCAVCKEAFELGNEAREMPCKHIYHSDCILPWLAQ  218

Query  599  HNSCPVCRYELPTD  558
             NSCPVCR+ELPTD
Sbjct  219  RNSCPVCRFELPTD  232



>ref|XP_009139092.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brassica rapa]
Length=236

 Score =   109 bits (272),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKS+++ LP + I Q+ L S  S C VCK+ FEL  EAKQMPCKH+YH DCI+PWL  
Sbjct  86   PAAKSSIDALPTVKIIQKHLKSSDSHCPVCKEEFELKSEAKQMPCKHVYHSDCIVPWLVQ  145

Query  599  HNSCPVCRYELPT  561
            HN+CPVCR ELP+
Sbjct  146  HNTCPVCRKELPS  158



>ref|XP_010463639.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Camelina 
sativa]
Length=424

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKS +E LP + +T E L+  +  CAVCKD   ++E+ +++PC H+YH DCIMPWL +
Sbjct  326  PAAKSVIEDLPVVELTVEELSKGNIVCAVCKDEIVVEEKVRRLPCSHLYHGDCIMPWLGI  385

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQ  522
             N+CPVCRYELPTDD +YE  ++SQ+
Sbjct  386  RNTCPVCRYELPTDDLEYERHKSSQR  411



>ref|XP_010474409.1| PREDICTED: E3 ubiquitin-protein ligase Praja-2-like [Camelina 
sativa]
Length=419

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKS +E LP + +T E L   ++ CAVCKD   ++E+ +++PC H YH DCIMPWL +
Sbjct  320  PAAKSVIEDLPVVELTVEELNKGNNVCAVCKDEIVVEEKVRRLPCSHFYHGDCIMPWLGI  379

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQ  522
             N+CPVCRYELPTDD +YE  ++SQ+
Sbjct  380  RNTCPVCRYELPTDDLEYERHKSSQR  405



>ref|XP_009364363.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Pyrus x bretschneideri]
Length=366

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 63/84 (75%), Gaps = 5/84 (6%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSAVE +P I I    + SDS  CAVCK++FEL  EA++MPCKHIYH DCI+PWL +
Sbjct  160  PASKSAVESMPVIQIADTHVGSDS-HCAVCKEAFELGSEAREMPCKHIYHPDCILPWLSM  218

Query  599  HNSCPVCRYELPTDDPDYENRRNS  528
             NSCPVCR+ELP D    +N RNS
Sbjct  219  RNSCPVCRHELPAD----QNNRNS  238



>gb|EEE62065.1| hypothetical protein OsJ_16849 [Oryza sativa Japonica Group]
Length=243

 Score =   109 bits (272),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 60/74 (81%), Gaps = 1/74 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K++VE +P +TI    + +DS  CAVCK+ FEL +EA++MPC HIYH+DCI+PWL L
Sbjct  28   PASKASVESMPTVTIAASHVGADS-HCAVCKEPFELGDEAREMPCSHIYHQDCILPWLAL  86

Query  599  HNSCPVCRYELPTD  558
             NSCPVCR+E+PTD
Sbjct  87   RNSCPVCRHEMPTD  100



>ref|XP_006654903.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like, partial [Oryza 
brachyantha]
Length=260

 Score =   109 bits (273),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+AVE +P +TI    + +DS  CAVCK+ FEL  EA++MPC HIYH+DCI+PWL L
Sbjct  45   PASKAAVESMPTVTIAASHVGADS-HCAVCKEPFELGVEAREMPCSHIYHQDCILPWLAL  103

Query  599  HNSCPVCRYELPTD  558
             NSCPVCR+E+PTD
Sbjct  104  RNSCPVCRHEMPTD  117



>ref|XP_006288146.1| hypothetical protein CARUB_v10001383mg [Capsella rubella]
 gb|EOA21044.1| hypothetical protein CARUB_v10001383mg [Capsella rubella]
Length=336

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSS-QCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLE  603
            PA+K  V+ LP + IT E +++ ++  CA+CKD   ++E+AK++PCKH YH DCI+PWL 
Sbjct  237  PASKRVVDDLPAVVITSEQVSNGNTIVCAICKDDIVVEEKAKRLPCKHFYHGDCIVPWLG  296

Query  602  LHNSCPVCRYELPTDDPDYENRRNSQQ  522
            + N+CPVCRYELPTDD +YE  R SQ+
Sbjct  297  IRNTCPVCRYELPTDDVEYERTRRSQR  323



>emb|CDX94901.1| BnaC05g07700D [Brassica napus]
Length=314

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKS+++ LP I ITQ+ L S  S C VCK+ FEL  EAKQMPCKH+YH DCI+PWL  
Sbjct  165  PAAKSSIDALPTIKITQKHLKSSDSHCPVCKEEFELKSEAKQMPCKHVYHSDCIVPWLVQ  224

Query  599  HNSCPVCRYELP  564
            HN+CPVCR ELP
Sbjct  225  HNTCPVCRKELP  236



>ref|XP_002465271.1| hypothetical protein SORBIDRAFT_01g035310 [Sorghum bicolor]
 gb|EER92269.1| hypothetical protein SORBIDRAFT_01g035310 [Sorghum bicolor]
Length=285

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAA+S+++ +P + ITQ  L+ DS  C VCK+ FEL  EA++MPCKH+YH DCI+PWLE 
Sbjct  162  PAAQSSIDAMPTVKITQRHLSGDS-HCPVCKEKFELGSEAREMPCKHLYHSDCIVPWLEQ  220

Query  599  HNSCPVCRYELPT  561
            HNSCPVCRYELPT
Sbjct  221  HNSCPVCRYELPT  233



>emb|CAN82964.1| hypothetical protein VITISV_000345 [Vitis vinifera]
Length=364

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+AVE LP I I    + S+S  CAVCK+ FELD EA+++PCKHIYH DCI+PWL L
Sbjct  161  PASKAAVESLPTIKIVASHVLSES-HCAVCKEPFELDSEARELPCKHIYHSDCILPWLSL  219

Query  599  HNSCPVCRYELPTD  558
             NSCPVCR+ELPTD
Sbjct  220  RNSCPVCRHELPTD  233



>ref|XP_002322048.2| hypothetical protein POPTR_0015s03560g [Populus trichocarpa]
 gb|EEF06175.2| hypothetical protein POPTR_0015s03560g [Populus trichocarpa]
Length=465

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA KS VE LP +  T+E + S+++ CAVCKD   + E  KQ+PC H YH +CI+PWL +
Sbjct  374  PATKSVVEKLPSVVFTKEDVESNNALCAVCKDDINVGERVKQLPCLHRYHGECIVPWLGI  433

Query  599  HNSCPVCRYELPTDDPDYENRR  534
             N+CPVCRYELPTDD DYE R+
Sbjct  434  RNTCPVCRYELPTDDADYEQRK  455



>dbj|BAA77204.1| ring finger protein [Cicer arietinum]
Length=131

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            P AKS VE LP + +T+E L      CAVCKD   L+E+ +++PC H YH DCI+PWL +
Sbjct  50   PTAKSFVENLPLVELTEEELKGKDIVCAVCKDEVMLEEKVRKLPCSHCYHGDCILPWLSI  109

Query  599  HNSCPVCRYELPTDDPDYENRR  534
             N+CPVCR+ELPTDD DYE  +
Sbjct  110  RNTCPVCRFELPTDDADYERSK  131



>ref|XP_011010366.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Populus euphratica]
Length=363

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA KS VE LP +  T+E + S+++ CAVCKD   + E  KQ+PC H YH +CI+PWL +
Sbjct  272  PATKSVVEKLPSVVFTKEDVESNNALCAVCKDDINVGERVKQLPCLHRYHGECIVPWLGI  331

Query  599  HNSCPVCRYELPTDDPDYENRRNSQ  525
             N+CPVCRYELPTDD DYE R+ ++
Sbjct  332  RNTCPVCRYELPTDDADYEQRKMAE  356



>gb|AEW08272.1| hypothetical protein 2_4925_01, partial [Pinus radiata]
Length=135

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA++SAVE +  + I+QE L+SD SQCAVC + FEL  EA++MPCKH++H DCI PWL+L
Sbjct  40   PASRSAVEAMAAVKISQEHLSSDLSQCAVCLEEFELGSEAREMPCKHMFHSDCIQPWLKL  99

Query  599  HNSCPVCRYEL  567
            H+SCPVCRY++
Sbjct  100  HSSCPVCRYQM  110



>ref|XP_011006162.1| PREDICTED: uncharacterized protein LOC105112236 [Populus euphratica]
Length=491

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKS VE LP + +T+  + S+++ CAVCKD   L E  KQ+PC H YH +CI+PWL +
Sbjct  398  PAAKSVVEKLPSMILTKGDMESNNAVCAVCKDDINLGERVKQLPCMHPYHGECIVPWLGI  457

Query  599  HNSCPVCRYELPTDDPDYENRR  534
             N+CPVCRYELPTDD DYE R+
Sbjct  458  RNTCPVCRYELPTDDADYERRK  479



>ref|XP_004301091.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Fragaria 
vesca subsp. vesca]
Length=460

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKS VE L  + +TQE +   ++ CAVCKD   L E+ K++PC H YH DCI+PWL +
Sbjct  366  PAAKSVVETLSSVVVTQEDVEKGNALCAVCKDDITLGEQGKKLPCAHRYHGDCIVPWLRI  425

Query  599  HNSCPVCRYELPTDDPDYENRRN  531
             N+CPVCRYELPTDD  YE RR+
Sbjct  426  RNTCPVCRYELPTDDAAYERRRS  448



>gb|EPS71485.1| hypothetical protein M569_03274 [Genlisea aurea]
Length=420

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+A+E LP I I  + ++ DS  CAVCKD FEL  EA++MPCKHIYH+DC+ PWL L
Sbjct  169  PASKAAIESLPKIEIVDQHISFDS-HCAVCKDPFELGIEAREMPCKHIYHQDCLFPWLSL  227

Query  599  HNSCPVCRYELPTDD  555
             NSCPVCRYELP+D+
Sbjct  228  RNSCPVCRYELPSDN  242



>ref|XP_008461689.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis melo]
Length=383

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+A+E +P I I +  LA++S  CAVCK++FEL  EA++MPCKHIYH DCI+PWL L
Sbjct  163  PASKAAIESMPTIQICENHLATES-HCAVCKEAFELGNEAREMPCKHIYHCDCILPWLSL  221

Query  599  HNSCPVCRYELPTDD  555
             NSCPVCR+ELP+D+
Sbjct  222  RNSCPVCRHELPSDN  236



>emb|CDM85845.1| unnamed protein product [Triticum aestivum]
Length=288

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA++S+++ +P + IT   L  DS  C VCKD FEL+ EA++MPCKH+YH DCI+PWLE 
Sbjct  163  PASQSSIDAMPSVRITARHLTGDS-HCPVCKDKFELESEAREMPCKHLYHSDCILPWLEQ  221

Query  599  HNSCPVCRYELPT  561
            HNSCPVCRYELPT
Sbjct  222  HNSCPVCRYELPT  234



>emb|CDY22483.1| BnaC03g22930D [Brassica napus]
Length=303

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA +S+++ LP I I Q  L S  S CAVCKD FEL  EAKQMPC HIYH DCI+PWL  
Sbjct  155  PAPRSSIDALPTIKIAQRHLRSSDSNCAVCKDEFELGAEAKQMPCNHIYHSDCIVPWLVQ  214

Query  599  HNSCPVCRYELPT  561
            HNSCPVCR ELP+
Sbjct  215  HNSCPVCRQELPS  227



>ref|XP_007209983.1| hypothetical protein PRUPE_ppa005133mg [Prunus persica]
 gb|EMJ11182.1| hypothetical protein PRUPE_ppa005133mg [Prunus persica]
Length=475

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAA + VE LP + +TQE + + ++ CAVCKD   + E+AKQ+PC H YH DCI+PWL +
Sbjct  369  PAANAVVENLPSVVLTQEDVDNSNALCAVCKDDMNIGEQAKQLPCAHRYHGDCIVPWLRI  428

Query  599  HNSCPVCRYELPTDDPDYENRR  534
             N+CPVCR+ELPTDD  YE RR
Sbjct  429  RNTCPVCRHELPTDDAAYEGRR  450



>gb|EMT01795.1| RING finger protein 126 [Aegilops tauschii]
Length=266

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA++S+++ +P + IT   L  DS  C VCKD FEL  EA++MPCKH+YH DCI+PWLE 
Sbjct  140  PASQSSIDAMPSVRITARHLTGDS-HCPVCKDKFELGSEAREMPCKHLYHSDCILPWLEQ  198

Query  599  HNSCPVCRYELPT  561
            HNSCPVCRYELPT
Sbjct  199  HNSCPVCRYELPT  211



>ref|XP_010540537.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Tarenaya hassleriana]
Length=365

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+AVE +P I I +  + S+ S CAVCK+ FEL+ EA++MPCKHIYH DCI+PWL L
Sbjct  155  PASKAAVESMPVIKIAENHV-SEESYCAVCKEPFELESEAREMPCKHIYHSDCILPWLSL  213

Query  599  HNSCPVCRYELPTDDPDYENRRNS  528
             NSCPVCR+ELPTD       RNS
Sbjct  214  RNSCPVCRHELPTDANASNIGRNS  237



>gb|EYU19927.1| hypothetical protein MIMGU_mgv1a007795mg [Erythranthe guttata]
Length=395

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 68/85 (80%), Gaps = 4/85 (5%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+A+E +P I I  + +A +S  CAVCK++FEL  EA++MPCKH+YH+DCI+PWL L
Sbjct  176  PASKAAIESMPTIEIVDQHVAVES-HCAVCKEAFELGIEAREMPCKHLYHQDCILPWLTL  234

Query  599  HNSCPVCRYELPTDDPDYENRRNSQ  525
             NSCPVCR+ELPTD+   ENR +S+
Sbjct  235  RNSCPVCRHELPTDN---ENRESSE  256



>ref|XP_011085033.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
Length=390

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+A+E +P + I+ + +A +S  CAVCK++F+L  +A++MPCKH+YH+DCI+PWL L
Sbjct  168  PASKAAIESMPTVEISDQHIAIES-YCAVCKEAFDLGSQAREMPCKHLYHQDCILPWLSL  226

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTR  513
             NSCPVCR+ELPTD+ +    R++ +  R
Sbjct  227  RNSCPVCRHELPTDNENVNGNRDASEVNR  255



>ref|XP_008374682.1| PREDICTED: uncharacterized protein LOC103437931 [Malus domestica]
Length=480

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAA + VE LP + +TQE +   ++ CAVCKD  +  E+AKQ+PC H YH DCI+PWL +
Sbjct  384  PAANAVVESLPSVVLTQEDVEKGNAVCAVCKDEMKSGEQAKQLPCTHRYHGDCIVPWLRI  443

Query  599  HNSCPVCRYELPTDDPDYENRRN  531
             N+CPVCR+ELP+DD  YE RRN
Sbjct  444  RNTCPVCRHELPSDDATYERRRN  466



>ref|XP_002531579.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF30815.1| zinc finger protein, putative [Ricinus communis]
Length=335

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA+E +P + I  EM  S  S CAVCK++FELD EA++MPCKHIYH +CI+PWL +
Sbjct  162  PASKSAIESMPTVIIN-EMHTSTESHCAVCKEAFELDSEAREMPCKHIYHNECILPWLSI  220

Query  599  HNSCPVCRYELPTD  558
             NSCPVCR+ELP D
Sbjct  221  RNSCPVCRHELPAD  234



>ref|XP_010516266.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=329

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA KS+++ LP I ITQ+ L S  S C VCKD FEL  EAKQMPC HIYH DCI+PWL  
Sbjct  170  PAPKSSIDALPTIKITQKHLKSSDSHCPVCKDEFELKAEAKQMPCNHIYHSDCIVPWLVQ  229

Query  599  HNSCPVCRYELP  564
            HNSCPVCR ELP
Sbjct  230  HNSCPVCRKELP  241



>ref|XP_009133459.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brassica rapa]
 emb|CDY35437.1| BnaA03g19230D [Brassica napus]
Length=317

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA +S+++ LP I I Q  L S  S CAVCKD FEL  EAKQMPC HIYH DCI+PWL  
Sbjct  155  PAPRSSIDALPTIKIAQRHLRSSDSNCAVCKDEFELGTEAKQMPCNHIYHSDCIVPWLVQ  214

Query  599  HNSCPVCRYELPT  561
            HNSCPVCR ELP+
Sbjct  215  HNSCPVCRQELPS  227



>gb|KHN07574.1| E3 ubiquitin-protein ligase RING1 [Glycine soja]
Length=246

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+A++ LP I I    LA +S  CAVCK++FEL    ++MPCKHIYH +CI+PWL L
Sbjct  32   PASKAAIDSLPTIEIDDTHLAMES-HCAVCKEAFELGTAVREMPCKHIYHPECILPWLAL  90

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQ  522
            HNSCPVCR+ELP D P+    +N  Q
Sbjct  91   HNSCPVCRHELPADTPNPNQNQNPSQ  116



>ref|XP_010427489.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
 ref|XP_010427490.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=330

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA KS+++ LP I ITQ+ L S  S C VCKD FEL  EAKQMPC HIYH DCI+PWL  
Sbjct  169  PAPKSSIDALPTIKITQKHLKSSDSHCPVCKDEFELKAEAKQMPCNHIYHSDCIVPWLVQ  228

Query  599  HNSCPVCRYELP  564
            HNSCPVCR ELP
Sbjct  229  HNSCPVCRKELP  240



>ref|XP_009787392.1| PREDICTED: uncharacterized protein LOC104235354 [Nicotiana sylvestris]
Length=439

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+ V  LP + ++++ +  + + CA+CKD   L E A+Q+PC H YH DCI+PWL +
Sbjct  347  PASKTVVRNLPTVALSKDDIEKNDATCAICKDEMNLGERARQLPCAHRYHGDCIVPWLGI  406

Query  599  HNSCPVCRYELPTDDPDYENRR  534
             N+CPVCR+ELPTDDPDYE RR
Sbjct  407  RNTCPVCRHELPTDDPDYERRR  428



>ref|NP_001054437.2| Os05g0110000 [Oryza sativa Japonica Group]
 gb|AAU44196.1| putative ring-H2 finger protein [Oryza sativa Japonica Group]
 dbj|BAF16351.2| Os05g0110000 [Oryza sativa Japonica Group]
Length=333

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 60/74 (81%), Gaps = 1/74 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K++VE +P +TI    + +DS  CAVCK+ FEL +EA++MPC HIYH+DCI+PWL L
Sbjct  118  PASKASVESMPTVTIAASHVGADS-HCAVCKEPFELGDEAREMPCSHIYHQDCILPWLAL  176

Query  599  HNSCPVCRYELPTD  558
             NSCPVCR+E+PTD
Sbjct  177  RNSCPVCRHEMPTD  190



>ref|XP_002283212.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Vitis vinifera]
Length=388

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+AVE +P I I    + ++   CAVCK++F+L  EA++MPCKHIYH DCI+PWL L
Sbjct  163  PASKAAVESMPTIEIVSSHIVTEL-HCAVCKEAFQLGSEAREMPCKHIYHSDCILPWLSL  221

Query  599  HNSCPVCRYELPTDDPDYEN  540
             NSCPVCR+ELPTD P   N
Sbjct  222  RNSCPVCRHELPTDVPGTRN  241



>ref|XP_010504561.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
 ref|XP_010504562.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=332

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA KS+++ LP I ITQ+ L S  S C VCKD FEL  EAKQMPC HIYH DCI+PWL  
Sbjct  169  PAPKSSIDALPTIKITQKHLKSSDSHCPVCKDEFELKAEAKQMPCNHIYHSDCIVPWLVQ  228

Query  599  HNSCPVCRYELP  564
            HNSCPVCR ELP
Sbjct  229  HNSCPVCRKELP  240



>ref|NP_567039.1| E3 ubiquitin ligase [Arabidopsis thaliana]
 ref|NP_974448.1| E3 ubiquitin ligase [Arabidopsis thaliana]
 ref|NP_001030874.1| E3 ubiquitin ligase [Arabidopsis thaliana]
 gb|AAK76657.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20263.1| unknown protein [Arabidopsis thaliana]
 gb|AAY57600.1| RING finger family protein [Arabidopsis thaliana]
 gb|AEE79537.1| E3 ubiquitin ligase [Arabidopsis thaliana]
 gb|AEE79538.1| E3 ubiquitin ligase [Arabidopsis thaliana]
 gb|AEE79539.1| E3 ubiquitin ligase [Arabidopsis thaliana]
Length=320

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA KS+++ LP I ITQ+ L S  S C VCKD FEL  EAKQMPC HIYH DCI+PWL  
Sbjct  160  PAPKSSIDALPTIKITQKHLKSSDSHCPVCKDEFELKSEAKQMPCHHIYHSDCIVPWLVQ  219

Query  599  HNSCPVCRYELP  564
            HNSCPVCR ELP
Sbjct  220  HNSCPVCRKELP  231



>gb|ABD96901.1| hypothetical protein [Cleome spinosa]
Length=339

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAK  V+ LP +  T E L      C+VCKD   ++E+ +++PC+H YH DCI+PWL +
Sbjct  194  PAAKRVVKDLPLVEFTVEKLGKGEVVCSVCKDKIAIEEKVRRLPCRHYYHGDCILPWLGI  253

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTR  513
             N+CPVCRYELPTDDPD+E  R  Q+  R
Sbjct  254  RNTCPVCRYELPTDDPDHERTRRQQRSDR  282



>ref|XP_004240370.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Solanum lycopersicum]
Length=385

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KSA+E +P I I    + S++  CAVCK++F+L  EA++MPCKHIYH DCI+PWL L
Sbjct  154  PASKSAIESMPIIQIASNHVNSET-HCAVCKEAFDLGSEAREMPCKHIYHSDCILPWLSL  212

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQP  519
             NSCPVCR+ELPT+  +  N  N  +P
Sbjct  213  RNSCPVCRHELPTESTETTNSDNISRP  239



>ref|XP_010558535.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase Praja-1 
[Tarenaya hassleriana]
Length=397

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAK  V+ LP +  T E L      C+VCKD   ++E+ +++PC+H YH DCI+PWL +
Sbjct  302  PAAKRVVKDLPLVEFTVEKLGKGEVVCSVCKDKIAIEEKVRRLPCRHYYHGDCILPWLGI  361

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQPTR  513
             N+CPVCRYELPTDDPD+E  R  Q+  R
Sbjct  362  RNTCPVCRYELPTDDPDHERTRRQQRSDR  390



>ref|XP_004486987.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cicer arietinum]
Length=328

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+A+E +  + IT E + S++  CAVCK++FEL  EA++MPCKH+YH DCI+PWL +
Sbjct  151  PASKAAIESMATVEITDEEVESET-HCAVCKEAFELGSEARKMPCKHLYHSDCILPWLSM  209

Query  599  HNSCPVCRYELPTDDPDYENRRNSQ  525
             NSCPVCR+ELP+D    E R + Q
Sbjct  210  RNSCPVCRHELPSDQNSSETRISGQ  234



>ref|XP_004161919.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis sativus]
Length=380

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+A+E +P I I +  LA++S  CAVCK++FEL  EA++MPCKHIYH DCI+PWL +
Sbjct  160  PASKAAIESMPTIQICENYLATES-HCAVCKEAFELGTEAREMPCKHIYHCDCILPWLSI  218

Query  599  HNSCPVCRYELPTDD  555
             NSCPVCR+ELP+D+
Sbjct  219  RNSCPVCRHELPSDN  233



>ref|XP_003547238.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max]
Length=314

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 66/85 (78%), Gaps = 1/85 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+A+E +P + IT+  +AS+++ CAVCK++FEL E A++MPCKH+YH DCI+PWL +
Sbjct  128  PASKAAIESMPTLEITESHVASETT-CAVCKEAFELGELAREMPCKHLYHSDCILPWLSM  186

Query  599  HNSCPVCRYELPTDDPDYENRRNSQ  525
             NSCPVCR+ELP++    E R   Q
Sbjct  187  RNSCPVCRHELPSEQAAPETRVAGQ  211



>ref|XP_008452807.1| PREDICTED: E3 ubiquitin-protein ligase AIP2 [Cucumis melo]
Length=315

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLA--SDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWL  606
            PA+K  V  LP  TIT E+LA      QCA+CK+ F +DE+ +++PCKH +H+DC+ PWL
Sbjct  207  PASKEFVANLPLFTITDEILAKLGKDVQCAICKEDFAVDEKIQELPCKHAFHQDCLKPWL  266

Query  605  ELHNSCPVCRYELPTDDPDYEN  540
            E +NSCP+CRYELPTDD +YEN
Sbjct  267  ESNNSCPICRYELPTDDQEYEN  288



>ref|XP_004147682.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis sativus]
 gb|KGN50563.1| hypothetical protein Csa_5G182680 [Cucumis sativus]
Length=383

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+A+E +P I I +  LA++S  CAVCK++FEL  EA++MPCKHIYH DCI+PWL +
Sbjct  163  PASKAAIESMPTIQICENYLATES-HCAVCKEAFELGTEAREMPCKHIYHCDCILPWLSI  221

Query  599  HNSCPVCRYELPTDD  555
             NSCPVCR+ELP+D+
Sbjct  222  RNSCPVCRHELPSDN  236



>ref|XP_010096594.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis]
 gb|EXB65262.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis]
Length=390

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+A+E +P I I    ++++S  CAVCK+ FEL  EA++MPCKHIYH +CI+PWL L
Sbjct  171  PASKAAIESMPTIEIDDSHISTES-HCAVCKEPFELGTEAREMPCKHIYHPECILPWLSL  229

Query  599  HNSCPVCRYELPTDDPDYENRRNSQ  525
            HNSCPVCR+ELP D P+     N Q
Sbjct  230  HNSCPVCRHELPADAPNSSEPENGQ  254



>ref|XP_010492431.1| PREDICTED: E3 ubiquitin-protein ligase Praja-1-like [Camelina 
sativa]
Length=346

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 65/86 (76%), Gaps = 1/86 (1%)
 Frame = -2

Query  776  AAKSAVEGLPDITITQEMLASDSS-QCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            A+K  V+ LP + IT E L++ ++  CA+CKD   +DE+AK++PCKH YH +CI+PWL +
Sbjct  253  ASKRVVDDLPAVVITSEQLSNGNTIVCAICKDDIVVDEKAKRLPCKHYYHGECIVPWLGI  312

Query  599  HNSCPVCRYELPTDDPDYENRRNSQQ  522
             N+CPVCRYELPTDDP+YE  R  Q+
Sbjct  313  RNTCPVCRYELPTDDPEYERNRKMQR  338



>ref|NP_001050120.1| Os03g0351800 [Oryza sativa Japonica Group]
 gb|ABF95940.1| Zinc finger, C3HC4 type family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12034.1| Os03g0351800 [Oryza sativa Japonica Group]
 gb|EAZ26918.1| hypothetical protein OsJ_10846 [Oryza sativa Japonica Group]
 dbj|BAG91984.1| unnamed protein product [Oryza sativa Japonica Group]
Length=283

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA +S+++ +P + ITQ  L+ DS  C VCKD FEL  EA++MPCKH+YH DCI+PWLE 
Sbjct  162  PATQSSIDAMPTVKITQRHLSGDS-HCPVCKDKFELGSEAREMPCKHLYHSDCIVPWLEQ  220

Query  599  HNSCPVCRYELP  564
            HNSCPVCRYELP
Sbjct  221  HNSCPVCRYELP  232



>ref|XP_004984362.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Setaria italica]
Length=285

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAA+S+++ +P + ITQ  L+ DS  C VCK+ FEL  EA++MPC H+YH DCI+PWLE 
Sbjct  162  PAAQSSIDAMPTVKITQRHLSGDS-HCPVCKEKFELGSEAREMPCNHLYHSDCIVPWLEQ  220

Query  599  HNSCPVCRYELPT  561
            HNSCPVCRYELPT
Sbjct  221  HNSCPVCRYELPT  233



>gb|KDO29293.1| hypothetical protein SPRG_05830 [Saprolegnia parasitica CBS 223.65]
Length=311

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+KS VE LP + IT+E +A +   CAVCKD F L +E +++PC H +H DCI+PWL  
Sbjct  216  PASKSVVESLPVVHITEEDVAKNQD-CAVCKDMFALHDEIRRLPCTHDFHPDCILPWLAQ  274

Query  599  HNSCPVCRYELPTDDPDYENRRNSQ  525
            HNSCPVCR+ELPTDD +YEN +++ 
Sbjct  275  HNSCPVCRFELPTDDQEYENHKHAN  299



>dbj|BAJ87106.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=137

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA++S+++ +P + IT   L  DS  C VCKD FEL  EA++MPC H+YH DCI+PWLE 
Sbjct  11   PASQSSIDAMPRVRITARHLTGDS-HCPVCKDKFELGSEAREMPCNHLYHSDCILPWLEQ  69

Query  599  HNSCPVCRYELPT  561
            HNSCPVCRYELPT
Sbjct  70   HNSCPVCRYELPT  82



>gb|KJB36692.1| hypothetical protein B456_006G171100 [Gossypium raimondii]
Length=354

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+A+E +P I I    + SDS  CAVCK+ FELD EA++MPCKHIYH DCI+PWL +
Sbjct  163  PASKAAIESMPVIRIVGRHIRSDS-HCAVCKEPFELDSEAREMPCKHIYHSDCIVPWLSI  221

Query  599  HNSCPVCRYELPTDD  555
             NSCPVCR+ELP +D
Sbjct  222  RNSCPVCRHELPMED  236



>ref|XP_006402974.1| hypothetical protein EUTSA_v10006102mg [Eutrema salsugineum]
 gb|ESQ44427.1| hypothetical protein EUTSA_v10006102mg [Eutrema salsugineum]
Length=323

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA +S+++ LP I ITQ+ L S  S C VCKD FEL  EAKQMPC HIYH DCI+PWL  
Sbjct  167  PAPRSSIDALPTIKITQKHLKSSDSHCPVCKDEFELKSEAKQMPCNHIYHSDCIVPWLVQ  226

Query  599  HNSCPVCRYELP  564
            HNSCPVCR ELP
Sbjct  227  HNSCPVCRKELP  238



>ref|XP_010100889.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis]
 gb|EXB85813.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis]
Length=392

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PAAKS VE LP + +T E L  + + CAVCKD F + E+ +++PC H YH DCI PWL +
Sbjct  295  PAAKSVVENLPFVELTMEELRGEVAACAVCKDEFLVGEKVQKLPCCHCYHGDCIAPWLGI  354

Query  599  HNSCPVCRYELPTDDPDYE  543
             N+CP+CR+ELPTDDPDYE
Sbjct  355  RNTCPICRFELPTDDPDYE  373



>ref|XP_011089490.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Sesamum indicum]
Length=355

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K AV  LP + I    + SD+  CAVC D+F L  EA++MPCKHIYH DCI PWL L
Sbjct  148  PASKQAVASLPTVEILPSHVDSDA-HCAVCTDAFTLGSEAREMPCKHIYHSDCIFPWLNL  206

Query  599  HNSCPVCRYELPTDDPD  549
            HNSCPVCR+ELP+D+PD
Sbjct  207  HNSCPVCRHELPSDEPD  223



>ref|XP_011099174.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Sesamum indicum]
Length=404

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 63/84 (75%), Gaps = 2/84 (2%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQ--CAVCKDSFELDEEAKQMPCKHIYHKDCIMPWL  606
            PAAKS VE LP + +T+E +  +++   CAVCKD F + ++  +MPC H+YH +CI+PWL
Sbjct  295  PAAKSVVENLPSVVLTKEEIEENNNVVVCAVCKDEFAVGDKVTRMPCCHLYHGECILPWL  354

Query  605  ELHNSCPVCRYELPTDDPDYENRR  534
             + N+CPVCRY+LPTDD DYE RR
Sbjct  355  SIRNTCPVCRYQLPTDDADYEKRR  378



>emb|CDP00121.1| unnamed protein product [Coffea canephora]
Length=392

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 65/88 (74%), Gaps = 3/88 (3%)
 Frame = -2

Query  779  PAAKSAVEGLPDITITQEMLASDSSQCAVCKDSFELDEEAKQMPCKHIYHKDCIMPWLEL  600
            PA+K+A+E +P I I Q    ++S  CAVCK+ FEL  EA++MPCKHIYH DCI+PWL L
Sbjct  172  PASKAAIESMPTIEINQSHTTTES-HCAVCKEPFELGCEAREMPCKHIYHSDCILPWLSL  230

Query  599  HNSCPVCRYELPTD--DPDYENRRNSQQ  522
             NSCPVCR+ELPTD  D    NR +++Q
Sbjct  231  RNSCPVCRHELPTDARDSGESNRASNEQ  258



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1534440539150