BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF025C19

Length=380
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009773066.1|  PREDICTED: elongation factor 1-alpha               136   6e-38   Nicotiana sylvestris
emb|CAA09041.1|  elongation factor 1-alpha                              135   8e-38   Cicer arietinum [garbanzo]
ref|WP_039311837.1|  hypothetical protein                               134   1e-37   
dbj|BAD94755.1|  elongation factor 1-alpha                              134   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010456401.1|  PREDICTED: elongation factor 1-alpha 1             135   1e-37   Camelina sativa [gold-of-pleasure]
gb|AGS43120.1|  elongation factor alpha5                                134   1e-37   Zea mays [maize]
gb|AAY34910.1|  elongation factor 1 alpha                               134   1e-37   Prunus armeniaca
ref|XP_010458012.1|  PREDICTED: elongation factor 1-alpha 1 isofo...    136   1e-37   Camelina sativa [gold-of-pleasure]
dbj|BAN42601.1|  putative elongation factor 1-alpha                     137   1e-37   Pyrus pyrifolia var. culta [Asian pear]
gb|ABK26215.1|  unknown                                                 134   1e-37   Picea sitchensis
dbj|BAD95246.1|  translation elongation factor eEF-1 alpha chain        135   1e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AAR83865.1|  elongation factor 1-alpha                               136   1e-37   Capsicum annuum
gb|AAT72900.1|  elongation factor 1A SMV resistance-related protein     137   2e-37   Glycine max [soybeans]
emb|CAL25349.1|  elongation factor 1 alpha                              137   2e-37   Platanus x hispanica [London plane tree]
gb|AFO68185.1|  elongation factor 1A                                    133   3e-37   Anthurium andraeanum [flamingo-lily]
dbj|BAH20400.1|  AT1G07940                                              136   3e-37   Arabidopsis thaliana [mouse-ear cress]
gb|KHN00035.1|  Elongation factor 1-alpha                               135   3e-37   Glycine soja [wild soybean]
gb|AAC06383.1|  elongation factor 1 alpha                               134   4e-37   Malus domestica [apple tree]
ref|XP_006307730.1|  hypothetical protein CARUB_v100096370mg            135   4e-37   
gb|AAK94429.1|AF398148_1  translation elongation factor 1 alpha c...    132   5e-37   Brassica rapa subsp. pekinensis [bai cai]
gb|ABR25693.1|  putative elongation factor 1-alpha                      133   5e-37   Oryza sativa Indica Group [Indian rice]
gb|ACF81592.1|  unknown                                                 135   6e-37   Zea mays [maize]
dbj|BAF75825.1|  hypothetical protein                                   135   8e-37   Malus domestica [apple tree]
gb|ADW83729.1|  elongation factor 1-alpha                               135   8e-37   Musa acuminata AAA Group [Cavendish banana]
gb|AGZ15393.1|  elongation factor 1-alpha                               138   8e-37   Phaseolus vulgaris [French bean]
emb|CAN71914.1|  hypothetical protein VITISV_026485                     136   9e-37   Vitis vinifera
ref|XP_004169868.1|  PREDICTED: elongation factor 1-alpha-like          132   1e-36   
gb|AAK72105.1|  elongation factor-1 alpha                               131   1e-36   Sinapis arvensis [charlock mustard]
emb|CAL07988.1|  translation elongation factor 1 alpha                  135   1e-36   Platanus x hispanica [London plane tree]
gb|KDP29082.1|  hypothetical protein JCGZ_16471                         136   2e-36   Jatropha curcas
dbj|BAH56641.1|  elongation factor 1a                                   138   2e-36   Nelumbo nucifera [Indian lotus]
dbj|BAF75826.1|  hypothetical protein                                   134   2e-36   Malus domestica [apple tree]
gb|ABW74483.1|  elongation factor                                       134   2e-36   Paeonia suffruticosa [moutan peony]
gb|AAL69396.1|  elongation factor 1-alpha                               139   2e-36   Elaeis oleifera
gb|KDP29085.1|  hypothetical protein JCGZ_16474                         138   3e-36   Jatropha curcas
gb|AAV92325.1|  translation elongation factor-1 alpha                   135   3e-36   Pseudotsuga menziesii var. menziesii
gb|KJB73628.1|  hypothetical protein B456_011G2414001                   132   3e-36   Gossypium raimondii
ref|XP_004173991.1|  PREDICTED: elongation factor 1-alpha-like          131   4e-36   
ref|XP_002518072.1|  elongation factor 1-alpha, putative                136   4e-36   Ricinus communis
gb|KDO48480.1|  hypothetical protein CISIN_1g0132372mg                  139   4e-36   Citrus sinensis [apfelsine]
ref|NP_001280807.1|  elongation factor 1-alpha-like                     139   4e-36   Malus domestica [apple tree]
ref|XP_002539209.1|  elongation factor 1-alpha, putative                136   4e-36   Ricinus communis
gb|AHE76183.1|  elongation factor 1-alpha                               138   4e-36   Chrysanthemum indicum
gb|AAN77897.1|  elongation factor 1 alpha                               138   5e-36   Stevia rebaudiana
ref|XP_006436251.1|  hypothetical protein CICLE_v10033471mg             138   5e-36   Citrus clementina [clementine]
gb|KJB73626.1|  hypothetical protein B456_011G2412002                   133   5e-36   Gossypium raimondii
dbj|BAN42602.1|  putative elongation factor 1-alpha                     133   5e-36   Pyrus pyrifolia var. culta [Asian pear]
gb|AEI29162.1|  EF1a-like protein                                       137   5e-36   Phalaenopsis hybrid cultivar
ref|XP_010916901.1|  PREDICTED: elongation factor 1-alpha               138   6e-36   Elaeis guineensis
gb|ACA30282.1|  putative elongation factor 1A                           131   6e-36   Cupressus sempervirens
ref|XP_007151789.1|  hypothetical protein PHAVU_004G075100g             138   6e-36   Phaseolus vulgaris [French bean]
gb|ADC68236.1|  elongation factor 1-alpha                               134   6e-36   Dendrobium nobile
gb|KHG27341.1|  Elongation factor 1-alpha                               138   7e-36   Gossypium arboreum [tree cotton]
gb|ACU31840.1|  translation elongation factor 1 alpha                   130   7e-36   Populus trichocarpa x Populus deltoides
ref|XP_002528020.1|  elongation factor 1-alpha, putative                136   7e-36   
ref|XP_007207457.1|  hypothetical protein PRUPE_ppa005717mg             138   8e-36   Prunus persica
ref|XP_010937806.1|  PREDICTED: elongation factor 1-alpha-like          137   8e-36   Elaeis guineensis
ref|XP_008385284.1|  PREDICTED: elongation factor 1-alpha-like          137   8e-36   
ref|XP_008465824.1|  PREDICTED: elongation factor 1-alpha-like          134   9e-36   Cucumis melo [Oriental melon]
ref|XP_009388387.1|  PREDICTED: elongation factor 1-alpha-like          137   9e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR16818.1|  unknown                                                 131   9e-36   Picea sitchensis
gb|ABV26710.1|  elongation factor 1 alpha                               137   1e-35   Gerbera hybrid cultivar
gb|AGH55661.1|  elongation factor 1-alpha                               135   1e-35   Atropa belladonna [deadly nightshade]
dbj|BAL14665.1|  elongation factor 1-alpha                              137   1e-35   Chrysanthemum seticuspe f. boreale
emb|CAA65453.1|  elongation factor                                      133   1e-35   Narcissus pseudonarcissus
ref|XP_008224492.1|  PREDICTED: elongation factor 1-alpha               137   1e-35   Prunus mume [ume]
dbj|BAO57272.1|  elongation factor 1-alpha                              137   1e-35   Ipomoea nil [qian niu]
gb|KDP29084.1|  hypothetical protein JCGZ_16473                         136   1e-35   Jatropha curcas
gb|KHG24249.1|  Elongation factor 1-alpha                               136   1e-35   Gossypium arboreum [tree cotton]
gb|KDP29086.1|  hypothetical protein JCGZ_16475                         137   2e-35   Jatropha curcas
gb|KDP29083.1|  hypothetical protein JCGZ_16472                         137   2e-35   Jatropha curcas
ref|XP_009392715.1|  PREDICTED: elongation factor 1-alpha-like          137   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA06245.1|  elongation factor 1-alpha (EF1-a)                      135   2e-35   Cicer arietinum [garbanzo]
gb|AAQ90154.1|  putative translation elongation factor protein          134   2e-35   Solanum tuberosum [potatoes]
ref|XP_006600131.1|  PREDICTED: elongation factor-1A isoform X1         137   2e-35   
sp|P25698.2|EF1A_SOYBN  RecName: Full=Elongation factor 1-alpha; ...    137   2e-35   Glycine max [soybeans]
ref|XP_002518073.1|  elongation factor 1-alpha, putative                137   2e-35   Ricinus communis
ref|XP_002528028.1|  elongation factor 1-alpha, putative                137   2e-35   
ref|XP_004157309.1|  PREDICTED: elongation factor 1-alpha-like          137   2e-35   
gb|AFJ04514.1|  elongation factor 1-alpha                               137   2e-35   Vernicia fordii [tung oil tree]
gb|AAD27590.1|AF121261_1  elongation factor 1-alpha 1                   137   2e-35   Lilium longiflorum [Easter lily]
ref|NP_001237425.1|  elongation factor-1A                               137   2e-35   
gb|KHN18669.1|  Elongation factor 1-alpha                               137   2e-35   Glycine soja [wild soybean]
ref|XP_002279598.1|  PREDICTED: elongation factor 1-alpha               137   2e-35   Vitis vinifera
gb|KJB76528.1|  hypothetical protein B456_012G093800                    137   2e-35   Gossypium raimondii
ref|XP_006858667.1|  hypothetical protein AMTR_s00066p00072310          137   2e-35   Amborella trichopoda
ref|XP_009342345.1|  PREDICTED: elongation factor 1-alpha-like          137   2e-35   Pyrus x bretschneideri [bai li]
ref|XP_008233357.1|  PREDICTED: elongation factor 1-alpha-like          137   2e-35   Prunus mume [ume]
ref|XP_010043711.1|  PREDICTED: elongation factor 1-alpha               137   2e-35   Eucalyptus grandis [rose gum]
ref|XP_008792062.1|  PREDICTED: elongation factor 1-alpha               137   2e-35   Phoenix dactylifera
gb|ABF00115.1|  elongation factor 1-alpha                               137   2e-35   Litchi chinensis [litchi]
ref|XP_008792073.1|  PREDICTED: elongation factor 1-alpha-like          137   2e-35   Phoenix dactylifera
ref|XP_007218005.1|  hypothetical protein PRUPE_ppa005706mg             137   2e-35   Prunus persica
ref|XP_009420035.1|  PREDICTED: elongation factor 1-alpha               137   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004307410.1|  PREDICTED: elongation factor 1-alpha               137   2e-35   Fragaria vesca subsp. vesca
ref|XP_010244958.1|  PREDICTED: elongation factor 1-alpha-like          137   2e-35   Nelumbo nucifera [Indian lotus]
gb|KGN51228.1|  Elongation factor 1-alpha                               136   2e-35   Cucumis sativus [cucumbers]
ref|XP_011089340.1|  PREDICTED: elongation factor 1-alpha isoform X2    136   2e-35   
gb|AFW76429.1|  putative translation elongation factor Tu family ...    134   2e-35   
ref|XP_002284964.1|  PREDICTED: elongation factor 1-alpha               136   2e-35   Vitis vinifera
ref|XP_008783723.1|  PREDICTED: elongation factor 1-alpha isoform X2    134   2e-35   
ref|XP_006304901.1|  hypothetical protein CARUB_v100092941mg            134   2e-35   
gb|AID52924.1|  elongation factor 1-alpha                               136   2e-35   Carthamus tinctorius
gb|AIZ68131.1|  translation elongation factor 1-alpha                   136   2e-35   Ornithogalum longebracteatum [sea-onion]
gb|ABS10822.1|  elongation factor 1-alpha                               131   2e-35   Phaseolus vulgaris [French bean]
gb|KJB53395.1|  hypothetical protein B456_009G4199001                   134   3e-35   Gossypium raimondii
gb|AHA84124.1|  elongation factor 1-alpha                               136   3e-35   Phaseolus vulgaris [French bean]
ref|XP_009613861.1|  PREDICTED: elongation factor 1-alpha-like          136   3e-35   Nicotiana tomentosiformis
emb|CDX70032.1|  BnaA10g23810D                                          135   3e-35   
ref|XP_006340223.1|  PREDICTED: elongation factor 1-alpha-like          136   3e-35   Solanum tuberosum [potatoes]
gb|KJB76560.1|  hypothetical protein B456_012G094600                    136   3e-35   Gossypium raimondii
ref|XP_009617039.1|  PREDICTED: elongation factor 1-alpha               136   3e-35   Nicotiana tomentosiformis
gb|AAP80665.1|AF479046_1  elongation factor-1 alpha                     129   3e-35   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007151593.1|  hypothetical protein PHAVU_004G060000g             136   3e-35   Phaseolus vulgaris [French bean]
sp|P34823.1|EF1A2_DAUCA  RecName: Full=Elongation factor 1-alpha;...    136   3e-35   Daucus carota [carrots]
gb|KJB53396.1|  hypothetical protein B456_009G4199001                   134   3e-35   Gossypium raimondii
ref|XP_006417745.1|  hypothetical protein EUTSA_v10007619mg             136   3e-35   Eutrema salsugineum [saltwater cress]
ref|XP_003547695.1|  PREDICTED: elongation factor 1-alpha isoform 2     136   3e-35   Glycine max [soybeans]
emb|CAC27139.1|  translation elongation factor-1 alpha                  136   3e-35   Picea abies
gb|ABK25072.1|  unknown                                                 136   3e-35   Picea sitchensis
gb|ACN40081.1|  unknown                                                 136   3e-35   Picea sitchensis
gb|ACN41180.1|  unknown                                                 136   3e-35   Picea sitchensis
ref|XP_009762748.1|  PREDICTED: elongation factor 1-alpha-like          136   3e-35   Nicotiana sylvestris
ref|XP_010937512.1|  PREDICTED: elongation factor 1-alpha               136   3e-35   Elaeis guineensis
dbj|BAA34348.1|  elongation factor-1 alpha                              136   3e-35   Nicotiana paniculata
emb|CAD60652.1|  elongation factor                                      136   4e-35   Solanum tuberosum [potatoes]
gb|ABK24265.1|  unknown                                                 136   4e-35   Picea sitchensis
ref|XP_003536362.1|  PREDICTED: elongation factor 1-alpha-like is...    136   4e-35   Glycine max [soybeans]
ref|XP_004489551.1|  PREDICTED: elongation factor 1-alpha-like          136   4e-35   Cicer arietinum [garbanzo]
gb|AGV54713.1|  elongation factor 1-alpha                               136   4e-35   Phaseolus vulgaris [French bean]
ref|NP_001077483.1|  elongation factor 1-alpha 2                        135   4e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006856244.1|  hypothetical protein AMTR_s00059p00216110          136   4e-35   Amborella trichopoda
ref|NP_001290506.1|  elongation factor 1-alpha                          135   4e-35   Elaeis guineensis
ref|XP_009793830.1|  PREDICTED: elongation factor 1-alpha-like          135   4e-35   Nicotiana sylvestris
ref|XP_006846237.1|  hypothetical protein AMTR_s00012p00237190          135   4e-35   Amborella trichopoda
gb|ADR70875.1|  eukaryotic translation elongation factor 1-alpha        135   4e-35   Hevea brasiliensis [jebe]
ref|XP_008789061.1|  PREDICTED: elongation factor 1-alpha-like          135   4e-35   Phoenix dactylifera
ref|XP_010920912.1|  PREDICTED: elongation factor 1-alpha-like          135   5e-35   Elaeis guineensis
gb|AIM48895.1|  elongation factor 1-alpha                               135   5e-35   Cinnamomum camphora
ref|XP_010937804.1|  PREDICTED: elongation factor 1-alpha-like          135   5e-35   Elaeis guineensis
gb|AGZ90153.1|  elongation factor 1-alpha                               132   5e-35   Litsea cubeba [may chang]
ref|XP_009421379.1|  PREDICTED: elongation factor 1-alpha-like          135   5e-35   
gb|AGT16893.1|  elongation factor 1-alpha                               135   5e-35   Saccharum hybrid cultivar R570
ref|NP_001234035.1|  elongation factor 1-alpha                          135   5e-35   Solanum lycopersicum
gb|ABB02622.1|  elongation factor 1-alpha-like protein                  135   5e-35   Solanum tuberosum [potatoes]
ref|XP_010542598.1|  PREDICTED: elongation factor 1-alpha-like          135   5e-35   Tarenaya hassleriana [spider flower]
ref|NP_001274875.1|  elongation factor 1-alpha-like protein             135   5e-35   Solanum tuberosum [potatoes]
ref|XP_010067278.1|  PREDICTED: elongation factor 1-alpha-like          135   5e-35   Eucalyptus grandis [rose gum]
gb|AAX54511.1|  elongation factor 1 alpha                               135   5e-35   Actinidia deliciosa [Chinese gooseberry]
ref|XP_010535587.1|  PREDICTED: elongation factor 1-alpha               135   5e-35   Tarenaya hassleriana [spider flower]
ref|XP_004962277.1|  PREDICTED: elongation factor 1-alpha-like is...    135   5e-35   Setaria italica
dbj|BAC23049.1|  Elongation factor 1-alpha                              135   5e-35   Solanum tuberosum [potatoes]
gb|AEE98365.1|  elongation factor 1-alpha                               127   5e-35   Deschampsia antarctica
emb|CDY22710.1|  BnaC08g43440D                                          135   6e-35   Brassica napus [oilseed rape]
emb|CDX88757.1|  BnaA03g08920D                                          135   6e-35   
ref|XP_004962249.1|  PREDICTED: elongation factor 1-alpha-like          135   6e-35   
gb|ABB86283.1|  elongation factor-1 alpha-like                          135   6e-35   Solanum tuberosum [potatoes]
dbj|BAM13877.1|  elongation factor 1 alpha                              135   6e-35   Arum maculatum [cuckoo-pint]
gb|AGT16628.1|  elongation factor 1 alpha                               135   6e-35   Saccharum hybrid cultivar R570
ref|NP_001275420.1|  elongation factor 1-alpha-like protein             135   6e-35   Solanum tuberosum [potatoes]
ref|XP_009381507.1|  PREDICTED: elongation factor 1-alpha-like          135   6e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABA12218.1|  translation elongation factor 1A-2                      135   6e-35   Gossypium hirsutum [American cotton]
ref|XP_006343452.1|  PREDICTED: elongation factor 1-alpha-like          135   6e-35   Solanum tuberosum [potatoes]
emb|CDY61938.1|  BnaCnng38780D                                          135   6e-35   Brassica napus [oilseed rape]
ref|XP_010542596.1|  PREDICTED: elongation factor 1-alpha-like          135   6e-35   Tarenaya hassleriana [spider flower]
gb|AFY06644.1|  elongation factor 1-alpha                               134   6e-35   Carica papaya [mamon]
gb|KCW65375.1|  hypothetical protein EUGRSUZ_G02807                     135   6e-35   Eucalyptus grandis [rose gum]
gb|AAL79775.1|  elongation factor 1 alpha                               135   6e-35   Saccharum hybrid cultivar CP72-2086
dbj|BAC22125.1|  eukaryotic elongation factor 1A                        135   6e-35   Bruguiera sexangula
ref|NP_001275481.1|  elongation factor 1-alpha-like                     135   7e-35   Solanum tuberosum [potatoes]
gb|AAK32834.1|AF361822_1  At1g07930/T6D22_3                             135   7e-35   Arabidopsis thaliana [mouse-ear cress]
sp|P43643.1|EF1A_TOBAC  RecName: Full=Elongation factor 1-alpha; ...    135   7e-35   Nicotiana tabacum [American tobacco]
ref|XP_003553292.1|  PREDICTED: elongation factor 1-alpha isoform 1     135   7e-35   Glycine max [soybeans]
gb|ADR70874.1|  eukaryotic translation elongation factor 1-alpha        135   7e-35   Hevea brasiliensis [jebe]
ref|XP_009148045.1|  PREDICTED: elongation factor 1-alpha 1             135   7e-35   Brassica rapa
ref|NP_200847.1|  elongation factor 1-alpha 4                           135   7e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280459.1|  hypothetical protein CARUB_v10026391mg             135   7e-35   Capsella rubella
emb|CAA34456.1|  elongation factor 1-alpha                              135   7e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KJB48746.1|  hypothetical protein B456_008G084000                    134   7e-35   Gossypium raimondii
ref|XP_009144204.1|  PREDICTED: elongation factor 1-alpha 1-like        135   7e-35   Brassica rapa
gb|AAL57653.1|  At1g07930/T6D22_3                                       135   7e-35   Arabidopsis thaliana [mouse-ear cress]
gb|ABA12222.1|  translation elongation factor 1A-6                      135   7e-35   Gossypium hirsutum [American cotton]
ref|XP_009126609.1|  PREDICTED: elongation factor 1-alpha 1-like        135   7e-35   Brassica rapa
ref|XP_009593325.1|  PREDICTED: elongation factor 1-alpha               135   7e-35   Nicotiana tomentosiformis
dbj|BAF02151.1|  elongation factor 1-alpha                              135   7e-35   Arabidopsis thaliana [mouse-ear cress]
gb|AAN31833.1|  putative translation elongation factor eEF-1 alph...    135   7e-35   Arabidopsis thaliana [mouse-ear cress]
gb|AAK82537.1|  At1g07930/T6D22_3                                       135   7e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007143679.1|  hypothetical protein PHAVU_007G092500g             135   7e-35   Phaseolus vulgaris [French bean]
ref|XP_004984833.1|  PREDICTED: elongation factor 1-alpha-like          135   7e-35   Setaria italica
gb|AFC88830.1|  putative elongation factor 1-alpha                      135   7e-35   Miscanthus sinensis
ref|NP_001152668.1|  LOC100286309                                       135   7e-35   Zea mays [maize]
ref|XP_002968419.1|  hypothetical protein SELMODRAFT_270693             135   7e-35   Selaginella moellendorffii
ref|XP_002970579.1|  hypothetical protein SELMODRAFT_270852             135   7e-35   Selaginella moellendorffii
gb|AAK25877.1|AF360167_1  putative translation elongation factor ...    135   7e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KJB48747.1|  hypothetical protein B456_008G084000                    135   7e-35   Gossypium raimondii
gb|AIX10769.1|  elongation factor 1 alpha                               135   8e-35   Panax notoginseng [san-qi]
emb|CDX93604.1|  BnaA06g04440D                                          135   8e-35   
ref|XP_010541344.1|  PREDICTED: elongation factor 1-alpha               135   8e-35   Tarenaya hassleriana [spider flower]
gb|ACS68200.1|  elongation factor 1 alpha                               135   8e-35   Brassica napus [oilseed rape]
gb|ABU63160.1|  elongation factor                                       135   8e-35   Saccharum officinarum [noble cane]
dbj|BAC66180.1|  elongation factor 1A                                   135   8e-35   Avicennia marina
ref|XP_004251154.1|  PREDICTED: elongation factor 1-alpha-like          135   8e-35   Solanum lycopersicum
emb|CDY58828.1|  BnaAnng15460D                                          135   8e-35   Brassica napus [oilseed rape]
gb|KHG26926.1|  Elongation factor 1-alpha                               135   8e-35   Gossypium arboreum [tree cotton]
gb|KHG28979.1|  Elongation factor 1-alpha                               135   8e-35   Gossypium arboreum [tree cotton]
gb|KHN42761.1|  Elongation factor 1-alpha                               135   9e-35   Glycine soja [wild soybean]
gb|ABA12217.1|  translation elongation factor 1A-1                      135   9e-35   Gossypium hirsutum [American cotton]
emb|CAJ38380.1|  translation elongation factor 1 alpha                  131   9e-35   Plantago major [cart-track plant]
ref|XP_007015467.1|  GTP binding Elongation factor Tu family prot...    134   9e-35   
ref|XP_009783256.1|  PREDICTED: elongation factor 1-alpha               135   9e-35   Nicotiana sylvestris
gb|ABA12220.1|  translation elongation factor 1A-4                      135   9e-35   Gossypium hirsutum [American cotton]
gb|EYU36203.1|  hypothetical protein MIMGU_mgv1a006301mg                135   9e-35   Erythranthe guttata [common monkey flower]
ref|XP_008783722.1|  PREDICTED: elongation factor 1-alpha isoform X1    135   9e-35   
gb|KHN14872.1|  Elongation factor 1-alpha                               135   9e-35   Glycine soja [wild soybean]
emb|CDX95108.1|  BnaC05g05630D                                          135   9e-35   
gb|ABA12221.1|  translation elongation factor 1A-5                      135   1e-34   Gossypium hirsutum [American cotton]
gb|AAL79774.1|AF331849_1  elongation factor 1 alpha                     135   1e-34   Saccharum hybrid cultivar CP65-357
ref|XP_011004182.1|  PREDICTED: elongation factor 1-alpha-like          135   1e-34   Populus euphratica
sp|O49169.1|EF1A_MANES  RecName: Full=Elongation factor 1-alpha; ...    135   1e-34   Manihot esculenta [manioc]
gb|ABA12223.1|  translation elongation factor 1A-7                      134   1e-34   Gossypium hirsutum [American cotton]
gb|ACR38047.1|  unknown                                                 134   1e-34   Zea mays [maize]
gb|AFQ37422.1|  translation elongation factor-1 alpha 1                 134   1e-34   Larix kaempferi [karamatsu]
ref|XP_009380678.1|  PREDICTED: elongation factor 1-alpha-like          134   1e-34   
gb|AGJ50595.1|  EF1alpha                                                134   1e-34   Pericallis cruenta
gb|ACG31866.1|  elongation factor 1-alpha                               134   1e-34   Zea mays [maize]
ref|XP_008380544.1|  PREDICTED: elongation factor 1-alpha-like          134   1e-34   Malus domestica [apple tree]
sp|Q41011.1|EF1A_PEA  RecName: Full=Elongation factor 1-alpha; Sh...    134   1e-34   Pisum sativum [garden pea]
gb|ACG34498.1|  elongation factor 1-alpha                               134   1e-34   Zea mays [maize]
ref|XP_001763198.1|  predicted protein                                  133   1e-34   
ref|XP_008656153.1|  PREDICTED: elongation factor 1-alpha-like          134   1e-34   Zea mays [maize]
ref|XP_006381487.1|  hypothetical protein POPTR_0006s13310g             134   1e-34   Populus trichocarpa [western balsam poplar]
ref|NP_001183947.1|  uncharacterized protein LOC100502553               134   1e-34   
ref|WP_033581549.1|  elongation factor 1-alpha                          128   1e-34   
ref|XP_008380545.1|  PREDICTED: elongation factor 1-alpha-like          134   1e-34   Malus domestica [apple tree]
gb|AHB86963.1|  elongation factor 1-alpha                               134   1e-34   Sedum alfredii
ref|XP_008656156.1|  PREDICTED: elongation factor 1-alpha-like is...    134   1e-34   Zea mays [maize]
gb|AEQ75495.1|  elongation factor 1-alpha                               134   1e-34   Rosa multiflora [Japanese rose]
ref|NP_001288407.1|  elongation factor 1-alpha-like                     134   1e-34   Zea mays [maize]
ref|XP_007222129.1|  hypothetical protein PRUPE_ppa005702mg             134   1e-34   Prunus persica
ref|XP_010939624.1|  PREDICTED: elongation factor 1-alpha-like          134   1e-34   Elaeis guineensis
sp|O24534.1|EF1A_VICFA  RecName: Full=Elongation factor 1-alpha; ...    134   1e-34   Vicia faba [broad bean]
ref|XP_008224543.1|  PREDICTED: elongation factor 1-alpha               134   1e-34   Prunus mume [ume]
ref|XP_007205199.1|  hypothetical protein PRUPE_ppa005718mg             134   1e-34   Prunus persica
gb|AAC15413.1|  translation elongation factor-1 alpha                   134   1e-34   Oryza sativa Japonica Group [Japonica rice]
gb|AAD56020.1|AF181492_1  elongation factor-1 alpha 3                   134   1e-34   Lilium longiflorum [Easter lily]
ref|XP_002968422.1|  hypothetical protein SELMODRAFT_169717             134   1e-34   Selaginella moellendorffii
gb|EEE58429.1|  hypothetical protein OsJ_09630                          134   2e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004309880.1|  PREDICTED: elongation factor 1-alpha               134   2e-34   Fragaria vesca subsp. vesca
dbj|BAM13874.1|  elongation factor 1 alpha                              134   2e-34   Symplocarpus renifolius
dbj|BAA23658.1|  EF-1 alpha                                             134   2e-34   Oryza sativa [red rice]
ref|XP_002970583.1|  hypothetical protein SELMODRAFT_171512             134   2e-34   Selaginella moellendorffii
ref|XP_006424633.1|  hypothetical protein CICLE_v10028443mg             134   2e-34   Citrus clementina [clementine]
ref|NP_001151074.1|  elongation factor 1-alpha                          134   2e-34   
gb|KGN47308.1|  hypothetical protein Csa_6G290890                       132   2e-34   Cucumis sativus [cucumbers]
gb|EPS66340.1|  elongation factor 1-alpha                               134   2e-34   Genlisea aurea
ref|NP_001049145.1|  Os03g0177400                                       134   2e-34   
gb|ACI96243.1|  elongation factor 1-alpha                               134   2e-34   Prunus persica
ref|XP_006646939.1|  PREDICTED: elongation factor 1-alpha-like          134   2e-34   Oryza brachyantha
ref|XP_002460859.1|  hypothetical protein SORBIDRAFT_02g036420          134   2e-34   Sorghum bicolor [broomcorn]
gb|ABF94276.1|  Elongation factor 1-alpha, putative, expressed          134   2e-34   Oryza sativa Japonica Group [Japonica rice]
gb|KHG20498.1|  Elongation factor 1-alpha                               134   2e-34   Gossypium arboreum [tree cotton]
gb|AFQ37423.1|  translation elongation factor-1 alpha 2                 134   2e-34   Larix kaempferi [karamatsu]
ref|XP_009403341.1|  PREDICTED: elongation factor 1-alpha-like          134   2e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABD66517.1|  EF-1 alpha                                              134   2e-34   Gymnadenia conopsea
gb|AGC94754.1|  elongation factor 1 alpha                               134   2e-34   Euphorbia lathyris
gb|EPS66069.1|  elongation factor 1-alpha                               134   2e-34   Genlisea aurea
ref|NP_001105587.1|  elongation factor 1-alpha                          134   2e-34   Zea mays [maize]
gb|ADI24333.1|  elongation factor 1-alpha                               134   2e-34   Miscanthus sinensis
sp|Q41803.1|EF1A_MAIZE  RecName: Full=Elongation factor 1-alpha; ...    134   2e-34   Zea mays [maize]
ref|XP_011031783.1|  PREDICTED: elongation factor 1-alpha-like          134   2e-34   Populus euphratica
ref|XP_007015466.1|  GTP binding Elongation factor Tu family prot...    134   2e-34   Theobroma cacao [chocolate]
ref|XP_007015463.1|  GTP binding Elongation factor Tu family protein    134   2e-34   
ref|XP_004143833.1|  PREDICTED: uncharacterized protein LOC101220517    137   2e-34   
gb|KHG01531.1|  Elongation factor 1-alpha                               134   2e-34   Gossypium arboreum [tree cotton]
ref|XP_011026991.1|  PREDICTED: elongation factor 1-alpha isoform X1    134   2e-34   Populus euphratica
ref|XP_011026992.1|  PREDICTED: elongation factor 1-alpha isoform X2    134   2e-34   Populus euphratica
ref|XP_010557310.1|  PREDICTED: elongation factor 1-alpha-like          134   2e-34   Tarenaya hassleriana [spider flower]
gb|ABA12225.1|  translation elongation factor 1A-9                      134   2e-34   Gossypium hirsutum [American cotton]
gb|AAR82894.1|  elongation factor 1-alpha                               134   2e-34   Cichorium intybus [radicchio]
ref|XP_007009760.1|  GTP binding Elongation factor Tu family prot...    134   2e-34   
ref|XP_008790814.1|  PREDICTED: elongation factor 1-alpha-like          134   2e-34   
ref|XP_010521772.1|  PREDICTED: elongation factor 1-alpha-like          134   2e-34   
gb|KHG23927.1|  Elongation factor 1-alpha                               134   2e-34   
ref|XP_010669658.1|  PREDICTED: elongation factor 1-alpha-like          134   2e-34   
ref|XP_009358244.1|  PREDICTED: elongation factor 1-alpha-like          134   3e-34   
ref|XP_009342341.1|  PREDICTED: elongation factor 1-alpha               134   3e-34   
ref|NP_001105617.1|  elongation factor alpha3                           134   3e-34   
ref|NP_001105933.1|  elongation factor alpha2                           134   3e-34   
ref|XP_010032225.1|  PREDICTED: elongation factor 1-alpha-like          134   3e-34   
gb|AGH32502.1|  translation elongation factor-1 alpha                   133   3e-34   
ref|XP_008358325.1|  PREDICTED: elongation factor 1-alpha               133   3e-34   
ref|NP_001104939.1|  elongation factor alpha6                           133   3e-34   
ref|NP_001288465.1|  elongation factor 1-alpha-like                     133   3e-34   
gb|AFW77593.1|  putative translation elongation factor Tu family ...    133   3e-34   
dbj|BAC22127.1|  eukaryotic elongation factor 1A                        133   3e-34   
ref|XP_002277159.1|  PREDICTED: elongation factor 1-alpha               133   3e-34   
ref|XP_008457229.1|  PREDICTED: elongation factor 1-alpha               133   4e-34   
ref|XP_010032223.1|  PREDICTED: elongation factor 1-alpha isoform X2    133   4e-34   
ref|XP_010032227.1|  PREDICTED: elongation factor 1-alpha-like          133   4e-34   
gb|AAY56337.1|  elongation factor-1 alpha                               133   4e-34   
ref|XP_007027265.1|  GTP binding Elongation factor Tu family protein    134   4e-34   
ref|XP_010032224.1|  PREDICTED: elongation factor 1-alpha isoform X3    133   4e-34   
gb|AEN79476.1|  elongation factor 1-alpha                               133   4e-34   
ref|XP_010669660.1|  PREDICTED: elongation factor 1-alpha-like          133   4e-34   
ref|XP_009403064.1|  PREDICTED: elongation factor 1-alpha-like          133   4e-34   
ref|XP_010669657.1|  PREDICTED: elongation factor 1-alpha               133   4e-34   
ref|XP_004309883.1|  PREDICTED: elongation factor 1-alpha-like          133   4e-34   
ref|XP_010032221.1|  PREDICTED: elongation factor 1-alpha isoform X1    133   4e-34   
gb|ABK24843.1|  unknown                                                 133   4e-34   
gb|KEH43533.1|  GTP-binding elongation factor Tu family protein         132   4e-34   
dbj|BAH19898.1|  AT1G07930                                              133   4e-34   
ref|XP_010521578.1|  PREDICTED: elongation factor 1-alpha               133   5e-34   
gb|KJB09231.1|  hypothetical protein B456_001G130700                    133   5e-34   
ref|XP_006424629.1|  hypothetical protein CICLE_v10028446mg             133   5e-34   
ref|XP_011091454.1|  PREDICTED: elongation factor 1-alpha-like          133   5e-34   
ref|XP_009126611.1|  PREDICTED: elongation factor 1-alpha 1-like        133   5e-34   
ref|XP_008463920.1|  PREDICTED: elongation factor 1-alpha               133   5e-34   
ref|XP_011089874.1|  PREDICTED: elongation factor 1-alpha               132   5e-34   
ref|XP_011089339.1|  PREDICTED: elongation factor 1-alpha isoform X1    132   5e-34   
ref|XP_006378755.1|  hypothetical protein POPTR_0010s22560g             132   5e-34   
ref|XP_001766482.1|  predicted protein                                  132   5e-34   
gb|ABA12219.1|  translation elongation factor 1A-3                      132   5e-34   
ref|XP_004149547.1|  PREDICTED: elongation factor 1-alpha-like          132   6e-34   
ref|XP_001753167.1|  predicted protein                                  132   6e-34   
ref|XP_004163381.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    132   6e-34   
ref|XP_001763194.1|  predicted protein                                  132   6e-34   
ref|XP_001763201.1|  predicted protein                                  132   6e-34   
gb|ABB72813.1|  elongation factor 1-alpha-like protein                  132   6e-34   
gb|AAF99703.1|  elongation factor                                       132   6e-34   
gb|AES74993.2|  GTP-binding elongation factor Tu family protein         132   6e-34   
ref|XP_001753181.1|  predicted protein                                  132   6e-34   
ref|XP_002892424.1|  T6D22.2                                            135   7e-34   
ref|XP_008782124.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    127   7e-34   
gb|EMS49772.1|  Elongation factor 1-alpha                               132   9e-34   
gb|AAF79822.1|AC026875_2  T6D22.2                                       135   9e-34   
gb|KEH43536.1|  GTP-binding elongation factor Tu family protein         132   9e-34   
gb|AES62210.2|  GTP-binding elongation factor Tu family protein         132   9e-34   
ref|NP_001105565.1|  elongation factor alpha5                           132   9e-34   
gb|AAD56019.1|AF181491_1  elongation factor-1 alpha 2                   132   9e-34   
gb|KGN51227.1|  hypothetical protein Csa_5G495940                       130   1e-33   
gb|AES59072.2|  GTP-binding elongation factor Tu family protein         132   1e-33   
gb|KGN61480.1|  hypothetical protein Csa_2G139820                       130   1e-33   
ref|XP_004512426.1|  PREDICTED: elongation factor 1-alpha-like          132   1e-33   
ref|XP_003588821.1|  Elongation factor 1-alpha                          132   1e-33   
ref|XP_002315287.1|  hypothetical protein POPTR_0010s22620g             132   1e-33   
dbj|BAL41369.1|  elongation factor 1-alpha                              125   1e-33   
ref|XP_003591959.1|  Elongation factor 1-alpha                          132   1e-33   
gb|AFP44110.1|  elongation factor 1-alpha                               132   1e-33   
sp|Q40034.1|EF1A2_HORVU  RecName: Full=Elongation factor 1-alpha;...    131   1e-33   
sp|P34824.1|EF1A1_HORVU  RecName: Full=Elongation factor 1-alpha;...    131   1e-33   
sp|P29521.1|EF1A1_DAUCA  RecName: Full=Elongation factor 1-alpha;...    131   1e-33   
gb|AER42621.1|  elongation factor 1 alpha                               131   1e-33   
gb|AGY80449.1|  elongation factor 1-alpha                               131   1e-33   
gb|ABA12224.1|  translation elongation factor 1A-8                      131   1e-33   
ref|NP_001105934.1|  elongation factor alpha7                           131   1e-33   
gb|ABD66072.1|  elongation factor 1-alpha                               128   2e-33   
ref|XP_003604823.1|  Elongation factor 1-alpha                          131   2e-33   
gb|EYU18863.1|  hypothetical protein MIMGU_mgv1a006280mg                131   2e-33   
gb|ACN40740.1|  unknown                                                 131   2e-33   
gb|ABR17675.1|  unknown                                                 131   2e-33   
gb|EMT12343.1|  Elongation factor 1-alpha                               131   2e-33   
ref|XP_004138964.1|  PREDICTED: elongation factor 1-alpha-like          131   2e-33   
gb|AAL32631.1|  putative elongation factor 1-a                          131   2e-33   
gb|AIZ74328.1|  translation elongation factor 1-alpha                   131   2e-33   
ref|XP_006387491.1|  hypothetical protein POPTR_0966s00200g             131   2e-33   
gb|AGD99674.1|  eukaryotic elongation factor 1A                         130   3e-33   
dbj|BAC22126.1|  eukaryotic elongation factor 1A                        130   3e-33   
ref|XP_003558459.1|  PREDICTED: elongation factor 1-alpha               130   3e-33   
ref|XP_007009751.1|  GTP binding Elongation factor Tu family prot...    130   3e-33   
ref|XP_011031786.1|  PREDICTED: elongation factor 1-alpha-like          129   4e-33   
ref|NP_001104938.1|  elongation factor 1 alpha                          130   4e-33   
gb|AEE98364.1|  elongation factor 1-alpha                               130   5e-33   
ref|XP_006373866.1|  hypothetical protein POPTR_0016s08780g             129   5e-33   
gb|ABQ81942.1|  elongation factor 1-alpha                               126   5e-33   
ref|NP_001105935.1|  elongation factor alpha8                           129   7e-33   
gb|AGI15328.1|  elongation factor 1                                     129   7e-33   
ref|XP_009917077.1|  PREDICTED: elongation factor 1-alpha 1             128   7e-33   
ref|XP_003618775.1|  Elongation factor 1-alpha                          132   8e-33   
ref|XP_011040946.1|  PREDICTED: elongation factor 1-alpha-like is...    129   9e-33   
gb|AAF63516.1|AF242732_1  translation elongation factor 1a              129   1e-32   
gb|AHZ58493.1|  translation elongation factor alpha                     129   1e-32   
ref|XP_002528021.1|  hypothetical protein RCOM_1100760                  120   2e-32   
ref|XP_009131916.1|  PREDICTED: elongation factor 1-alpha 1-like        128   3e-32   
ref|XP_002311107.1|  ADR12-2 family protein                             128   3e-32   
ref|XP_002312029.1|  ADR12-2 family protein                             128   3e-32   
ref|XP_001753059.1|  predicted protein                                  127   4e-32   
gb|EMS59091.1|  Elongation factor 1-alpha                               127   6e-32   
gb|ADK73624.1|  elongation factor 1 alpha                               125   7e-32   
ref|XP_002311106.1|  ADR12-2 family protein                             127   7e-32   
sp|Q03033.1|EF1A_WHEAT  RecName: Full=Elongation factor 1-alpha; ...    127   8e-32   
ref|XP_003604587.1|  Elongation factor 1-alpha                          127   8e-32   
gb|EMS52529.1|  Elongation factor 1-alpha                               127   8e-32   
ref|XP_011031813.1|  PREDICTED: LOW QUALITY PROTEIN: HBS1-like pr...    129   9e-32   
gb|EMS65134.1|  Elongation factor 1-alpha                               127   2e-31   
gb|KHG15275.1|  Elongation factor 1-alpha                               125   2e-31   
gb|EMT09703.1|  Elongation factor 1-alpha                               127   4e-31   
gb|ABQ81936.1|  elongation factor 1-alpha                               124   7e-31   
gb|AGI78242.1|  elongation factor 1 alpha                               124   7e-31   
dbj|BAK08819.1|  elongation factor 1-alpha                              124   7e-31   
dbj|BAK08744.1|  elongation factor 1-alpha                              124   7e-31   
dbj|BAK08818.1|  elongation factor 1-alpha                              124   7e-31   
gb|ADP36952.1|  hypothetical protein                                    115   7e-30   
ref|XP_002316349.2|  hypothetical protein POPTR_0010s22610g             117   2e-29   
dbj|BAO73915.1|  elongation factor 1-alpha                              112   4e-29   
gb|AGO97079.1|  elongation factor 1-alpha                               114   6e-29   
gb|ABE01407.1|  translation elongation factor 1a-1                      112   1e-28   
gb|ABE01408.1|  translation elongation factor 1a-2                      112   1e-28   
ref|NP_174788.1|  elongation factor Tu C-terminal domain-containi...    110   2e-28   
ref|WP_043641907.1|  hypothetical protein                               110   3e-28   
gb|AIM46989.1|  translation elongation factor 1-alpha                   117   3e-28   
gb|AEO97326.1|  translation elongation factor 1 alpha                   110   3e-28   
gb|AGO97080.1|  elongation factor 1-alpha                               112   4e-28   
gb|AGO97078.1|  elongation factor 1-alpha                               112   5e-28   
ref|XP_005650451.1|  translation elongation factor                      115   6e-28   
gb|AAM90311.1|  elongation factor 1-alpha                               108   2e-27   
gb|AJF94634.1|  elongation factor 1-alpha                               109   2e-27   
ref|XP_010898590.1|  PREDICTED: elongation factor 1-alpha, oocyte...    110   2e-27   
gb|KJB30602.1|  hypothetical protein B456_005G151200                    112   2e-27   
gb|AAV34150.1|  EF-1 alpha                                              111   2e-27   
gb|ACO50115.1|  elongation factor 1 alpha                               114   3e-27   
gb|AAH99609.1|  Eef1a1 protein                                          108   3e-27   
gb|ADK90073.1|  elongation factor 1 alpha                               114   4e-27   
gb|EDL26402.1|  mCG15232, isoform CRA_c                                 107   4e-27   
gb|ABD64137.1|  elongation factor-1 alpha                               108   4e-27   
gb|AEI29163.1|  EF1a-like protein                                       106   4e-27   
gb|ACO50109.1|  elongation factor 1 alpha                               112   4e-27   
gb|ABD14421.1|  eukaryotic translation elongation factor 1 alpha 1      107   4e-27   
gb|ACL97367.1|  elongation factor-1 alpha                               113   5e-27   
emb|CEJ91279.1|  Putative Elongation factor 1-alpha                     113   5e-27   
ref|XP_002806374.1|  PREDICTED: elongation factor 1-alpha 1-like        107   6e-27   
ref|XP_001525782.1|  elongation factor 1-alpha                          113   6e-27   
ref|XP_004622541.1|  PREDICTED: elongation factor 1-alpha-like          112   8e-27   
gb|EMS24916.1|  translation elongation factor EF-1 alpha subunit        108   9e-27   
gb|EDL26405.1|  mCG15232, isoform CRA_f                                 108   1e-26   
emb|CCE43063.1|  hypothetical protein CPAR2_207060                      112   1e-26   
gb|EDL77720.1|  rCG25445, isoform CRA_b                                 108   1e-26   
gb|AAZ81003.1|  eukaryotic translation elongation factor 1 alpha 1      108   1e-26   
gb|AAH12509.1|  EEF1A1 protein                                          108   1e-26   
gb|ACO50110.1|  elongation factor 1 alpha                               112   1e-26   
gb|EPY25861.1|  elongation factor 1-alpha                               111   1e-26   
gb|ABQ81935.1|  elongation factor 1-alpha                               112   1e-26   
gb|AGW80518.1|  elongation factor 1-alpha 1                             108   1e-26   
gb|KIJ68393.1|  hypothetical protein HYDPIDRAFT_185471                  112   2e-26   
gb|EPY33803.1|  elongation factor 1-alpha                               111   2e-26   
emb|CEI96289.1|  Putative Elongation factor 1-alpha                     107   2e-26   
gb|KHK00115.1|  Translation elongation factor 1 alpha subunit           110   2e-26   
gb|ACL97366.1|  elongation factor-1 alpha                               111   2e-26   
ref|XP_003627053.1|  Elongation factor 1-alpha                          111   2e-26   
ref|XP_002619019.1|  elongation factor 1-alpha                          111   2e-26   
gb|KIK43550.1|  hypothetical protein CY34DRAFT_699467                   111   2e-26   
gb|KIO08245.1|  hypothetical protein M404DRAFT_997171                   111   2e-26   
gb|AFN42763.1|  elongation factor 1-alpha                               109   2e-26   
gb|EPY27955.1|  elongation factor 1-alpha                               111   2e-26   
gb|ACF70735.1|  eukaryotic translation elongation factor 1              108   2e-26   
gb|KFG35331.1|  elongation factor 1-alpha                               105   3e-26   
gb|EWC64676.1|  hypothetical protein W893_14860                         107   3e-26   
gb|KHJ95470.1|  putative translation elongation factor EF-1, subu...    110   3e-26   
gb|ADK90074.1|  elongation factor 1 alpha                               111   3e-26   
emb|CCW70819.1|  unnamed protein product                                108   3e-26   
ref|XP_007762783.1|  translation elongation factor 1a                   111   3e-26   
gb|KDR85040.1|  hypothetical protein GALMADRAFT_233641                  111   4e-26   
ref|XP_010730917.1|  PREDICTED: elongation factor 1-alpha 1             110   4e-26   
emb|CAR63684.1|  putative elongation factor 1 alpha                     105   4e-26   
ref|XP_006454380.1|  hypothetical protein AGABI2DRAFT_133083            110   4e-26   
ref|XP_002418726.1|  ef-1-alpha, putative; elongation factor 1-al...    110   4e-26   
gb|EDL26404.1|  mCG15232, isoform CRA_e                                 108   4e-26   
ref|XP_005805806.1|  PREDICTED: elongation factor 1-alpha 1-like        110   4e-26   
gb|ABB46371.1|  elongation factor-1 alpha                               107   4e-26   
ref|XP_007567352.1|  PREDICTED: elongation factor 1-alpha 1             110   4e-26   
gb|ACL97363.1|  elongation factor-1 alpha                               110   4e-26   
gb|KGQ90498.1|  elongation factor 1-alpha                               110   4e-26   
ref|XP_002417435.1|  translation elongation factor 1-alpha, putative    110   4e-26   
ref|XP_711899.1|  probable translation elongation factor EF-1 alpha     110   4e-26   
gb|ESA10680.1|  hypothetical protein GLOINDRAFT_348113                  110   4e-26   
ref|XP_002547526.1|  elongation factor 1-alpha                          110   4e-26   
ref|XP_001382687.1|  Elongation factor 1-alpha (EF-1-alpha)             110   4e-26   
gb|KGU36629.1|  elongation factor 1-alpha                               110   4e-26   
ref|XP_005675615.1|  PREDICTED: elongation factor 1-alpha 1-like        108   5e-26   
ref|XP_710148.1|  probable translation elongation factor EF-1 alpha     110   5e-26   
ref|XP_717655.1|  probable translation elongation factor EF-1 alpha     110   5e-26   
gb|KGR02570.1|  elongation factor 1-alpha                               110   5e-26   
gb|KHC39870.1|  elongation factor 1-alpha                               110   5e-26   
gb|ADG23104.1|  elongation factor 1-alpha                               106   5e-26   
ref|XP_007314394.1|  hypothetical protein SERLADRAFT_458623             110   5e-26   
ref|XP_007921049.1|  hypothetical protein MYCFIDRAFT_209593             110   6e-26   
ref|XP_001551786.1|  elongation factor 1-alpha                          110   6e-26   
ref|XP_007374445.1|  putative translation elongation factor EF-1 ...    110   6e-26   
emb|CCU97773.1|  unnamed protein product                                110   6e-26   
gb|AAA41105.1|  EF-1-alpha                                              107   6e-26   
gb|ESW96056.1|  Elongation factor 1-alpha 1                             110   6e-26   
gb|EGA80599.1|  Tef1p                                                   107   6e-26   
gb|KDQ12968.1|  hypothetical protein BOTBODRAFT_34109                   110   6e-26   
emb|CDP93913.1|  Protein Bm5195, isoform h                              107   6e-26   
ref|XP_011125707.1|  hypothetical protein AOL_s00169g48                 110   6e-26   
gb|KIK82926.1|  hypothetical protein PAXRUDRAFT_832117                  110   6e-26   
ref|XP_003716248.1|  elongation factor 1-alpha                          110   6e-26   
gb|ADO22142.1|  translation elongation factor 1 alpha                   110   6e-26   
gb|ESZ89813.1|  elongation factor 1-alpha                               110   7e-26   
gb|KIJ21706.1|  hypothetical protein PAXINDRAFT_65274                   110   7e-26   
ref|XP_009387472.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    106   7e-26   



>ref|XP_009773066.1| PREDICTED: elongation factor 1-alpha, partial [Nicotiana sylvestris]
Length=149

 Score =   136 bits (343),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  67   TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  126

Query  197  VIKSVDKKDPTG  162
            VIK+VDKKDPTG
Sbjct  127  VIKNVDKKDPTG  138



>emb|CAA09041.1| elongation factor 1-alpha [Cicer arietinum]
Length=130

 Score =   135 bits (341),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  48   TKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  107

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  108  VIKSVEKKDPTG  119



>ref|WP_039311837.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91110.1| hypothetical protein QW71_36580, partial [Paenibacillus sp. IHB 
B 3415]
Length=98

 Score =   134 bits (338),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  16   TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  75

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  76   VIKSVEKKDPSG  87



>dbj|BAD94755.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=94

 Score =   134 bits (337),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  10   TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  69

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  70   VIKSVDKKDPTG  81



>ref|XP_010456401.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 dbj|BAD94936.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CDY69678.1| BnaAnng31190D [Brassica napus]
 emb|CDY67376.1| BnaC03g71530D [Brassica napus]
 emb|CDY06288.1| BnaA09g49150D [Brassica napus]
 emb|CDY06290.1| BnaA09g49130D [Brassica napus]
Length=115

 Score =   135 bits (339),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  31   TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  90

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  91   VIKSVDKKDPTG  102



>gb|AGS43120.1| elongation factor alpha5, partial [Zea mays]
Length=94

 Score =   134 bits (337),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF +YPPLGRFAVRDMRQTVAVG
Sbjct  17   TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVG  76

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  77   VIKSVEKKDPTG  88



>gb|AAY34910.1| elongation factor 1 alpha [Prunus armeniaca]
Length=85

 Score =   134 bits (336),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKMLPTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  3    TKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  62

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  63   VIKSVEKKDPSG  74



>ref|XP_010458012.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Camelina sativa]
Length=165

 Score =   136 bits (343),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  81   TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  140

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  141  VIKSVDKKDPTG  152



>dbj|BAN42601.1| putative elongation factor 1-alpha, partial [Pyrus pyrifolia 
var. culta]
Length=201

 Score =   137 bits (345),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  119  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  178

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  179  VIKSVEKKDPTG  190



>gb|ABK26215.1| unknown [Picea sitchensis]
Length=113

 Score =   134 bits (338),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TK+ RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  31   TKVDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  90

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDPTG
Sbjct  91   VIKAVEKKDPTG  102



>dbj|BAD95246.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
Length=143

 Score =   135 bits (341),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  59   TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  118

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  119  VIKSVDKKDPTG  130



>gb|AAR83865.1| elongation factor 1-alpha [Capsicum annuum]
Length=167

 Score =   136 bits (342),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  84   TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  143

Query  197  VIKSVDKKDPTG  162
            V+K+VDKKDPTG
Sbjct  144  VVKNVDKKDPTG  155



>gb|AAT72900.1| elongation factor 1A SMV resistance-related protein [Glycine 
max]
Length=193

 Score =   137 bits (344),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  111  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  170

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDPTG
Sbjct  171  VIKNVEKKDPTG  182



>emb|CAL25349.1| elongation factor 1 alpha [Platanus x acerifolia]
Length=199

 Score =   137 bits (344),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  117  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  176

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  177  VIKSVEKKDPSG  188



>gb|AFO68185.1| elongation factor 1A, partial [Anthurium andraeanum]
Length=101

 Score =   133 bits (335),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  19   TKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  78

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDPTG
Sbjct  79   VIKAVEKKDPTG  90



>dbj|BAH20400.1| AT1G07940 [Arabidopsis thaliana]
Length=186

 Score =   136 bits (342),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  102  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  161

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  162  VIKSVDKKDPTG  173



>gb|KHN00035.1| Elongation factor 1-alpha [Glycine soja]
Length=155

 Score =   135 bits (339),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G+VKM+PTKPMVVETF EYPPLGRF+VRDMRQTVAVG
Sbjct  74   TKIDRRSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFSVRDMRQTVAVG  133

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  134  VIKSVEKKDPTG  145



>gb|AAC06383.1| elongation factor 1 alpha, partial [Malus domestica]
Length=143

 Score =   134 bits (338),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKMLPTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  61   TKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  120

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  121  VIKSVEKKDPSG  132



>ref|XP_006307730.1| hypothetical protein CARUB_v100096370mg, partial [Capsella rubella]
 gb|EOA40628.1| hypothetical protein CARUB_v100096370mg, partial [Capsella rubella]
Length=188

 Score =   135 bits (341),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  104  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  163

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  164  VIKSVDKKDPTG  175



>gb|AAK94429.1|AF398148_1 translation elongation factor 1 alpha chain [Brassica rapa subsp. 
pekinensis]
Length=97

 Score =   132 bits (333),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD   VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  13   TKIDRRSGKEIEKEPKFLKNGDAAMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  72

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  73   VIKSVDKKDPTG  84



>gb|ABR25693.1| putative elongation factor 1-alpha [Oryza sativa Indica Group]
Length=108

 Score =   133 bits (334),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  26   TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  85

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDPTG
Sbjct  86   VIKNVEKKDPTG  97



>gb|ACF81592.1| unknown [Zea mays]
Length=184

 Score =   135 bits (340),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF +YPPLGRFAVRDMRQTVAVG
Sbjct  102  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVG  161

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  162  VIKSVEKKDPTG  173



>dbj|BAF75825.1| hypothetical protein [Malus domestica]
Length=184

 Score =   135 bits (339),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKMLPTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  102  TKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  161

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  162  VIKSVEKKDPSG  173



>gb|ADW83729.1| elongation factor 1-alpha [Musa acuminata AAA Group]
Length=191

 Score =   135 bits (339),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGK LEKEPKFLKNGD GFVKM+P+KPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  109  TKIDRRSGKALEKEPKFLKNGDAGFVKMIPSKPMVVETFSEYPPLGRFAVRDMRQTVAVG  168

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  169  VIKSVEKKDPTG  180



>gb|AGZ15393.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=305

 Score =   138 bits (347),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  211  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  270

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  271  VIKSVEKKDPTG  282



>emb|CAN71914.1| hypothetical protein VITISV_026485 [Vitis vinifera]
Length=226

 Score =   136 bits (342),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  144  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  203

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  204  VIKSVEKKDPSG  215



>ref|XP_004169868.1| PREDICTED: elongation factor 1-alpha-like, partial [Cucumis sativus]
Length=101

 Score =   132 bits (331),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF  YPPLGRFAVRDMRQTVAVG
Sbjct  17   TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVG  76

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKD +G
Sbjct  77   VIKAVEKKDASG  88



>gb|AAK72105.1| elongation factor-1 alpha, partial [Sinapis arvensis]
Length=89

 Score =   131 bits (330),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAV DMRQTVAVG
Sbjct  5    TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVGDMRQTVAVG  64

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  65   VIKSVDKKDPTG  76



>emb|CAL07988.1| translation elongation factor 1 alpha [Platanus x acerifolia]
Length=236

 Score =   135 bits (341),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  154  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  213

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  214  VIKSVEKKDPSG  225



>gb|KDP29082.1| hypothetical protein JCGZ_16471 [Jatropha curcas]
Length=247

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  165  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  224

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  225  VIKSVEKKDPSG  236



>dbj|BAH56641.1| elongation factor 1a, partial [Nelumbo nucifera]
Length=355

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  284  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  343

Query  197  VIKSVDKKDPTG  162
            VIK+VDKKDPTG
Sbjct  344  VIKAVDKKDPTG  355



>dbj|BAF75826.1| hypothetical protein [Malus domestica]
Length=184

 Score =   134 bits (336),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  102  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  161

Query  197  VIKSVDKKDPTG  162
            VIKSV+KK+PTG
Sbjct  162  VIKSVEKKEPTG  173



>gb|ABW74483.1| elongation factor [Paeonia suffruticosa]
Length=186

 Score =   134 bits (336),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMR+TVAVG
Sbjct  102  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRRTVAVG  161

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  162  VIKSVDKKDPTG  173



>gb|AAL69396.1| elongation factor 1-alpha [Elaeis oleifera]
Length=447

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/72 (94%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKMLPTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|KDP29085.1| hypothetical protein JCGZ_16474 [Jatropha curcas]
Length=418

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  262  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  321

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  322  VIKSVEKKDPSG  333



>gb|AAV92325.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92326.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92327.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92328.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92329.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92330.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92331.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92332.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92333.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92334.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92335.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92336.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92337.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92338.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92339.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92340.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92341.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii]
 gb|AAV92342.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92343.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92344.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92345.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92346.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92347.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92348.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii]
 gb|AAV92349.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii]
 gb|AAV92350.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii]
 gb|AAV92351.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii]
Length=247

 Score =   135 bits (339),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TK+ RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  165  TKVDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  224

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDPTG
Sbjct  225  VIKAVEKKDPTG  236



>gb|KJB73628.1| hypothetical protein B456_011G2414001, partial [Gossypium raimondii]
Length=131

 Score =   132 bits (331),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G +KM+PTKPMVVETF  YPPLGRFAVRDMRQTVAVG
Sbjct  47   TKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSAYPPLGRFAVRDMRQTVAVG  106

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  107  VIKSVEKKDPSG  118



>ref|XP_004173991.1| PREDICTED: elongation factor 1-alpha-like, partial [Cucumis sativus]
Length=112

 Score =   131 bits (329),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF  YPPLGRFAVRDMRQTVAVG
Sbjct  28   TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVG  87

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKD +G
Sbjct  88   VIKAVEKKDASG  99



>ref|XP_002518072.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44205.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=295

 Score =   136 bits (342),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  211  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  270

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  271  VIKSVEKKDPSG  282



>gb|KDO48480.1| hypothetical protein CISIN_1g0132372mg [Citrus sinensis]
Length=447

 Score =   139 bits (349),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDP+G
Sbjct  425  VIKSVDKKDPSG  436



>ref|NP_001280807.1| elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008349742.1| PREDICTED: elongation factor 1-alpha isoform X1 [Malus domestica]
 ref|XP_008366354.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 emb|CAA11705.1| elongation factor 1 alpha subunit [Malus domestica]
Length=447

 Score =   139 bits (349),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/72 (94%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKMLPTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_002539209.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF23174.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=295

 Score =   136 bits (342),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  211  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  270

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  271  VIKSVEKKDPSG  282



>gb|AHE76183.1| elongation factor 1-alpha [Chrysanthemum indicum]
Length=449

 Score =   138 bits (348),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/72 (94%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKMLPTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  425  VIKSVDKKDPTG  436



>gb|AAN77897.1| elongation factor 1 alpha [Stevia rebaudiana]
Length=449

 Score =   138 bits (348),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/72 (94%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKMLPTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  425  VIKSVDKKDPTG  436



>ref|XP_006436251.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
 ref|XP_006485903.1| PREDICTED: elongation factor 1-alpha 1-like [Citrus sinensis]
 gb|ESR49491.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
Length=447

 Score =   138 bits (348),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDP+G
Sbjct  425  VIKSVDKKDPSG  436



>gb|KJB73626.1| hypothetical protein B456_011G2412002, partial [Gossypium raimondii]
Length=187

 Score =   133 bits (334),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G +KM+PTKPMVVETF  YPPLGRFAVRDMRQTVAVG
Sbjct  104  TKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSAYPPLGRFAVRDMRQTVAVG  163

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  164  VIKSVEKKDPTG  175



>dbj|BAN42602.1| putative elongation factor 1-alpha, partial [Pyrus pyrifolia 
var. culta]
Length=201

 Score =   133 bits (335),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKMLPT+PMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  119  TKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTRPMVVETFSEYPPLGRFAVRDMRQTVAVG  178

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  179  VIKSVEKKDPSG  190



>gb|AEI29162.1| EF1a-like protein [Phalaenopsis hybrid cultivar]
Length=398

 Score =   137 bits (346),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  316  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  375

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  376  VIKSVEKKDPTG  387



>ref|XP_010916901.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010910504.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|ACA30282.1| putative elongation factor 1A [Cupressus sempervirens]
Length=138

 Score =   131 bits (330),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/67 (93%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = -1

Query  362  RSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVGVIKSV  183
            RSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVGVIKSV
Sbjct  1    RSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV  60

Query  182  DKKDPTG  162
            +KK+PTG
Sbjct  61   EKKEPTG  67



>ref|XP_007151789.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
 gb|ESW23783.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
Length=447

 Score =   138 bits (347),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|ADC68236.1| elongation factor 1-alpha [Dendrobium nobile]
Length=238

 Score =   134 bits (337),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PT+PMVVETF +YPPLGRFAVRDMRQTVAVG
Sbjct  157  TKIDRRSGKELEKEPKFLKNGDAGFVKMVPTRPMVVETFSQYPPLGRFAVRDMRQTVAVG  216

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  217  VIKSVEKKDPTG  228



>gb|KHG27341.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   138 bits (347),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|ACU31840.1| translation elongation factor 1 alpha, partial [Populus trichocarpa 
x Populus deltoides]
Length=106

 Score =   130 bits (326),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G +KM+PTKPMVVETF  YPPLGRFAVRDMRQTVA G
Sbjct  22   TKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAXG  81

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  82   VIKSVEKKDPSG  93



>ref|XP_002528020.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34338.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=348

 Score =   136 bits (343),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  264  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  323

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  324  VIKSVEKKDPSG  335



>ref|XP_007207457.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
 gb|EMJ08656.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
Length=447

 Score =   138 bits (347),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_010937806.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   137 bits (346),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_008385284.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_009338279.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   137 bits (346),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_008465824.1| PREDICTED: elongation factor 1-alpha-like [Cucumis melo]
Length=273

 Score =   134 bits (338),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  189  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  248

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKD +G
Sbjct  249  VIKAVEKKDASG  260



>ref|XP_009388387.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   137 bits (346),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|ABR16818.1| unknown [Picea sitchensis]
Length=167

 Score =   131 bits (330),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TK+ RRSGKELE+EPKFLKNGD GF+KM+P+KPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  84   TKVDRRSGKELEREPKFLKNGDAGFIKMIPSKPMVVETFSEYPPLGRFAVRDMRQTVAVG  143

Query  197  VIKSVDKKDPT  165
            VIK+V+KKDPT
Sbjct  144  VIKAVEKKDPT  154



>gb|ABV26710.1| elongation factor 1 alpha [Gerbera hybrid cultivar]
Length=449

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  425  VIKSVDKKDPTG  436



>gb|AGH55661.1| elongation factor 1-alpha, partial [Atropa belladonna]
Length=333

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  252  TKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  311

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  312  VIKSVDKKDPTG  323



>dbj|BAL14665.1| elongation factor 1-alpha [Chrysanthemum seticuspe f. boreale]
Length=449

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKMLPTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  425  VIKSVDKKDPTG  436



>emb|CAA65453.1| elongation factor [Narcissus pseudonarcissus]
Length=242

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPP+GRFAVRDMRQTVAVG
Sbjct  160  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPMGRFAVRDMRQTVAVG  219

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  220  VIKSVEKKDPTG  231



>ref|XP_008224492.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>dbj|BAO57272.1| elongation factor 1-alpha [Ipomoea nil]
Length=447

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKMLPTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+VDKKDPTG
Sbjct  425  VIKNVDKKDPTG  436



>gb|KDP29084.1| hypothetical protein JCGZ_16473 [Jatropha curcas]
Length=399

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  317  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  376

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  377  VIKSVEKKDPSG  388



>gb|KHG24249.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=401

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  317  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  376

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  377  VIKSVEKKDPSG  388



>gb|KDP29086.1| hypothetical protein JCGZ_16475 [Jatropha curcas]
Length=447

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>gb|KDP29083.1| hypothetical protein JCGZ_16472 [Jatropha curcas]
Length=447

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>ref|XP_009392715.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392716.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF +YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFAQYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>emb|CAA06245.1| elongation factor 1-alpha (EF1-a) [Cicer arietinum]
Length=326

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  244  TKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  303

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  304  VIKSVEKKDPTG  315



>gb|AAQ90154.1| putative translation elongation factor protein [Solanum tuberosum]
Length=287

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  204  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  263

Query  197  VIKSVDKKDPTG  162
            V+K+VDKKDPTG
Sbjct  264  VVKNVDKKDPTG  275



>ref|XP_006600131.1| PREDICTED: elongation factor-1A isoform X1 [Glycine max]
 gb|KHN40184.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDPTG
Sbjct  425  VIKNVEKKDPTG  436



>sp|P25698.2|EF1A_SOYBN RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Glycine 
max]
 emb|CAA40182.1| eEF-1a [Glycine max]
Length=447

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDPTG
Sbjct  425  VIKNVEKKDPTG  436



>ref|XP_002518073.1| elongation factor 1-alpha, putative [Ricinus communis]
 ref|XP_002518074.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44206.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44207.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>ref|XP_002528028.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34346.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>ref|XP_004157309.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>gb|AFJ04514.1| elongation factor 1-alpha, partial [Vernicia fordii]
Length=438

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  364  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  423

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  424  VIKSVEKKDPSG  435



>gb|AAD27590.1|AF121261_1 elongation factor 1-alpha 1 [Lilium longiflorum]
Length=447

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|NP_001237425.1| elongation factor-1A [Glycine max]
 gb|ACI42861.1| elongation factor-1A [Glycine max]
Length=447

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDPTG
Sbjct  425  VIKNVEKKDPTG  436



>gb|KHN18669.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDPTG
Sbjct  425  VIKNVEKKDPTG  436



>ref|XP_002279598.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN66350.1| hypothetical protein VITISV_044270 [Vitis vinifera]
Length=447

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>gb|KJB76528.1| hypothetical protein B456_012G093800 [Gossypium raimondii]
Length=449

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>ref|XP_006858667.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
 gb|ERN20134.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
Length=447

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>ref|XP_009342345.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELE+EPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEREPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_008233357.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
Length=447

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>ref|XP_010043711.1| PREDICTED: elongation factor 1-alpha [Eucalyptus grandis]
 gb|KCW85696.1| hypothetical protein EUGRSUZ_B02473 [Eucalyptus grandis]
Length=449

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>ref|XP_008792062.1| PREDICTED: elongation factor 1-alpha [Phoenix dactylifera]
Length=447

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF +YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|ABF00115.1| elongation factor 1-alpha [Litchi chinensis]
Length=446

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G+VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  364  TKIDRRSGKELEKEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  423

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  424  VIKSVEKKDPTG  435



>ref|XP_008792073.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF +YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_007218005.1| hypothetical protein PRUPE_ppa005706mg [Prunus persica]
 gb|EMJ19204.1| hypothetical protein PRUPE_ppa005706mg [Prunus persica]
Length=447

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>ref|XP_009420035.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
 ref|XP_009420036.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
Length=447

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF +YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_004307410.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKMLPTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDP+G
Sbjct  425  VIKAVEKKDPSG  436



>ref|XP_010244958.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
 ref|XP_010244959.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
Length=449

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDP+G
Sbjct  425  VIKSVDKKDPSG  436



>gb|KGN51228.1| Elongation factor 1-alpha [Cucumis sativus]
Length=402

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  318  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  377

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  378  VIKSVEKKDPSG  389



>ref|XP_011089340.1| PREDICTED: elongation factor 1-alpha isoform X2 [Sesamum indicum]
 ref|XP_011089341.1| PREDICTED: elongation factor 1-alpha isoform X3 [Sesamum indicum]
 ref|XP_011089342.1| PREDICTED: elongation factor 1-alpha isoform X4 [Sesamum indicum]
 ref|XP_011089875.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>gb|AFW76429.1| putative translation elongation factor Tu family protein [Zea 
mays]
Length=293

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  211  TKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  270

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  271  VIKSVEKKDPTG  282



>ref|XP_002284964.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_002284924.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010651131.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN64511.1| hypothetical protein VITISV_035691 [Vitis vinifera]
Length=447

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>ref|XP_008783723.1| PREDICTED: elongation factor 1-alpha isoform X2 [Phoenix dactylifera]
Length=293

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF  YPPLGRFAVRDMRQTVAVG
Sbjct  211  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVG  270

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  271  VIKSVEKKDPSG  282



>ref|XP_006304901.1| hypothetical protein CARUB_v100092941mg, partial [Capsella rubella]
 gb|EOA37799.1| hypothetical protein CARUB_v100092941mg, partial [Capsella rubella]
Length=325

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  241  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  300

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  301  VIKSVDKKDPTG  312



>gb|AID52924.1| elongation factor 1-alpha [Carthamus tinctorius]
Length=449

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  425  VIKSVDKKDPTG  436



>gb|AIZ68131.1| translation elongation factor 1-alpha [Ornithogalum saundersiae]
Length=447

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>gb|ABS10822.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=201

 Score =   131 bits (330),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G+VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  129  TKIDRRSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  188

Query  197  VIKSVDKKDP  168
            VIKSV+KKDP
Sbjct  189  VIKSVEKKDP  198



>gb|KJB53395.1| hypothetical protein B456_009G4199001 [Gossypium raimondii]
Length=300

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G +KM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  218  TKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  277

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  278  VIKSVEKKDPTG  289



>gb|AHA84124.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G+VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_009613861.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009626606.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009597916.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
Length=447

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+VDKKDPTG
Sbjct  425  VIKNVDKKDPTG  436



>emb|CDX70032.1| BnaA10g23810D [Brassica napus]
Length=344

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  260  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  319

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  320  VIKSVDKKDPTG  331



>ref|XP_006340223.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
Length=447

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDP+G
Sbjct  425  VIKSVDKKDPSG  436



>gb|KJB76560.1| hypothetical protein B456_012G094600 [Gossypium raimondii]
Length=425

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  341  TKIDRRSGKELEKEPKFLKNGDAGFVKMVPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  400

Query  197  VIKSVDKKDPTG  162
            VI+SV+KKDP+G
Sbjct  401  VIESVEKKDPSG  412



>ref|XP_009617039.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+VDKKDPTG
Sbjct  425  VIKNVDKKDPTG  436



>gb|AAP80665.1|AF479046_1 elongation factor-1 alpha, partial [Triticum aestivum]
Length=143

 Score =   129 bits (325),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+E  PKFLKNGD GFVKM+PTKPMVVETF +YPPLGRFAVRDMRQTVAVG
Sbjct  61   TKIDRRSGKEIEAAPKFLKNGDAGFVKMIPTKPMVVETFAQYPPLGRFAVRDMRQTVAVG  120

Query  197  VIKSVDKKDPTG  162
            VIK+V+ KDPTG
Sbjct  121  VIKAVEXKDPTG  132



>ref|XP_007151593.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
 gb|ESW23587.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
Length=447

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G+VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>sp|P34823.1|EF1A2_DAUCA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Daucus 
carota]
 dbj|BAA02205.1| elongation factor 1-alpha [Daucus carota]
Length=447

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF  YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFMSYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|KJB53396.1| hypothetical protein B456_009G4199001, partial [Gossypium raimondii]
Length=322

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G +KM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  240  TKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  299

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  300  VIKSVEKKDPTG  311



>ref|XP_006417745.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417746.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417749.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 ref|XP_006417750.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006417751.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006400853.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
 dbj|BAJ33644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36098.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36099.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36102.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 gb|ESQ36103.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ36104.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ42306.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
Length=449

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  425  VIKSVDKKDPTG  436



>ref|XP_003547695.1| PREDICTED: elongation factor 1-alpha isoform 2 [Glycine max]
 gb|KHN27573.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G+VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>emb|CAC27139.1| translation elongation factor-1 alpha [Picea abies]
Length=444

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TK+ RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  362  TKVDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  421

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDPTG
Sbjct  422  VIKAVEKKDPTG  433



>gb|ABK25072.1| unknown [Picea sitchensis]
 gb|ABR17295.1| unknown [Picea sitchensis]
 gb|ABR17358.1| unknown [Picea sitchensis]
 gb|ABR18377.1| unknown [Picea sitchensis]
 gb|ACN40111.1| unknown [Picea sitchensis]
 gb|ACN40613.1| unknown [Picea sitchensis]
 gb|ACN40633.1| unknown [Picea sitchensis]
 gb|ACN40825.1| unknown [Picea sitchensis]
Length=447

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TK+ RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKVDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDPTG
Sbjct  425  VIKAVEKKDPTG  436



>gb|ACN40081.1| unknown [Picea sitchensis]
Length=447

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TK+ RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKVDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDPTG
Sbjct  425  VIKAVEKKDPTG  436



>gb|ACN41180.1| unknown [Picea sitchensis]
Length=447

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TK+ RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKVDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDPTG
Sbjct  425  VIKAVEKKDPTG  436



>ref|XP_009762748.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+VDKKDPTG
Sbjct  425  VIKNVDKKDPTG  436



>ref|XP_010937512.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKD +G
Sbjct  425  VIKSVDKKDASG  436



>dbj|BAA34348.1| elongation factor-1 alpha [Nicotiana paniculata]
Length=447

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+VDKKDPTG
Sbjct  425  VIKNVDKKDPTG  436



>emb|CAD60652.1| elongation factor [Solanum tuberosum]
Length=447

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDP+G
Sbjct  425  VIKSVDKKDPSG  436



>gb|ABK24265.1| unknown [Picea sitchensis]
Length=447

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TK+ RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKVDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDPTG
Sbjct  425  VIKAVEKKDPTG  436



>ref|XP_003536362.1| PREDICTED: elongation factor 1-alpha-like isoformX2 [Glycine 
max]
 ref|XP_006589439.1| PREDICTED: elongation factor 1-alpha-like isoform X3 [Glycine 
max]
 ref|XP_006589440.1| PREDICTED: elongation factor 1-alpha-like isoform X4 [Glycine 
max]
 gb|KHN17117.1| Elongation factor 1-alpha [Glycine soja]
Length=448

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_004489551.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004489552.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=447

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|AGV54713.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPP GRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFFEYPPFGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|NP_001077483.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 gb|AEE28214.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=372

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  288  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  347

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  348  VIKSVDKKDPTG  359



>ref|XP_006856244.1| hypothetical protein AMTR_s00059p00216110 [Amborella trichopoda]
 gb|ERN17711.1| hypothetical protein AMTR_s00059p00216110 [Amborella trichopoda]
Length=447

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDP+G
Sbjct  425  VIKAVEKKDPSG  436



>ref|NP_001290506.1| elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010922532.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 gb|AAT45847.1| elongation factor 1-alpha 1 [Elaeis guineensis]
Length=447

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF +YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>ref|XP_009793830.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+VDKKDPTG
Sbjct  425  VIKNVDKKDPTG  436



>ref|XP_006846237.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
 gb|ERN07912.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
Length=447

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDP+G
Sbjct  425  VIKAVEKKDPSG  436



>gb|ADR70875.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF  YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSTYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_008789061.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789062.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789063.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF  YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_010920912.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF  YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|AIM48895.1| elongation factor 1-alpha, partial [Cinnamomum camphora]
Length=432

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF  YPPLGRFAVRDMRQTVAVG
Sbjct  356  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVG  415

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  416  VIKSVEKKDPTG  427



>ref|XP_010937804.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010937805.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF  YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|AGZ90153.1| elongation factor 1-alpha, partial [Litsea cubeba]
Length=239

 Score =   132 bits (331),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF  YPPLGRFAVRDMRQTVAVG
Sbjct  157  TKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVG  216

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  217  VIKSVEKKDPSG  228



>ref|XP_009421379.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+P+KPMVVETF +YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPSKPMVVETFSQYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|AGT16893.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|NP_001234035.1| elongation factor 1-alpha [Solanum lycopersicum]
 ref|XP_004240579.1| PREDICTED: elongation factor 1-alpha [Solanum lycopersicum]
 sp|P17786.1|EF1A_SOLLC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Solanum 
lycopersicum]
 emb|CAA32618.1| unnamed protein product [Solanum lycopersicum]
 emb|CAA37212.1| elongation factor 1-alpha [Solanum lycopersicum]
Length=448

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            V+K+VDKKDPTG
Sbjct  425  VVKNVDKKDPTG  436



>gb|ABB02622.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=400

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  317  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  376

Query  197  VIKSVDKKDPTG  162
            V+K+VDKKDPTG
Sbjct  377  VVKNVDKKDPTG  388



>ref|XP_010542598.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|NP_001274875.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABC01896.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  366  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  425

Query  197  VIKSVDKKDPTG  162
            V+K+VDKKDPTG
Sbjct  426  VVKNVDKKDPTG  437



>ref|XP_010067278.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=447

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|AAX54511.1| elongation factor 1 alpha [Actinidia deliciosa]
Length=447

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_010535587.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_004962277.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962278.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
 ref|XP_004962279.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>dbj|BAC23049.1| Elongation factor 1-alpha [Solanum tuberosum]
 gb|AHL27103.1| eukaryotic elongation factor 1A protein [Solanum chacoense]
Length=448

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            V+K+VDKKDPTG
Sbjct  425  VVKNVDKKDPTG  436



>gb|AEE98365.1| elongation factor 1-alpha [Deschampsia antarctica]
Length=106

 Score =   127 bits (320),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TK+ RRSGKE+E  PKFLKNGD GFVKM+PTKPMVVETF +YPPLGRFAVRDMRQTVAVG
Sbjct  24   TKVDRRSGKEIEAFPKFLKNGDAGFVKMIPTKPMVVETFAQYPPLGRFAVRDMRQTVAVG  83

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDPTG
Sbjct  84   VIKTVEKKDPTG  95



>emb|CDY22710.1| BnaC08g43440D [Brassica napus]
 emb|CDY22711.1| BnaC08g43450D [Brassica napus]
Length=427

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  343  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  402

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  403  VIKSVDKKDPTG  414



>emb|CDX88757.1| BnaA03g08920D [Brassica napus]
Length=401

 Score =   135 bits (339),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  317  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  376

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  377  VIKSVDKKDPTG  388



>ref|XP_004962249.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962250.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962268.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962269.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962270.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962271.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
Length=447

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|ABB86283.1| elongation factor-1 alpha-like [Solanum tuberosum]
Length=447

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            V+K+VDKKDPTG
Sbjct  425  VVKNVDKKDPTG  436



>dbj|BAM13877.1| elongation factor 1 alpha [Arum maculatum]
Length=447

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+P+KPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPSKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>gb|AGT16628.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=399

 Score =   135 bits (339),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  317  TKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  376

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  377  VIKSVEKKDPTG  388



>ref|NP_001275420.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABB16975.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=400

 Score =   135 bits (339),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  317  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  376

Query  197  VIKSVDKKDPTG  162
            V+K+VDKKDPTG
Sbjct  377  VVKNVDKKDPTG  388



>ref|XP_009381507.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381508.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381509.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF  YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMVPTKPMVVETFSTYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|ABA12218.1| translation elongation factor 1A-2 [Gossypium hirsutum]
 gb|KHG05237.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB14364.1| hypothetical protein B456_002G121500 [Gossypium raimondii]
Length=447

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G +KM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_006343452.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 ref|XP_006343454.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006343455.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB55388.1| elongation factor 1-alpha-like [Solanum tuberosum]
Length=448

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            V+K+VDKKDPTG
Sbjct  425  VVKNVDKKDPTG  436



>emb|CDY61938.1| BnaCnng38780D [Brassica napus]
 emb|CDY34479.1| BnaC04g13200D [Brassica napus]
 emb|CDY10804.1| BnaA05g11320D [Brassica napus]
 emb|CDY09211.1| BnaA02g06370D [Brassica napus]
Length=428

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  344  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  403

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  404  VIKSVDKKDPTG  415



>ref|XP_010542596.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|AFY06644.1| elongation factor 1-alpha, partial [Carica papaya]
Length=334

 Score =   134 bits (336),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF +YPPLGRFAVRDMRQTVAVG
Sbjct  252  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVG  311

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDP+G
Sbjct  312  VIKNVEKKDPSG  323



>gb|KCW65375.1| hypothetical protein EUGRSUZ_G02807 [Eucalyptus grandis]
Length=428

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  346  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  405

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  406  VIKSVEKKDPTG  417



>gb|AAL79775.1| elongation factor 1 alpha [Saccharum hybrid cultivar CP72-2086]
Length=441

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  359  TKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  418

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  419  VIKSVEKKDPTG  430



>dbj|BAC22125.1| eukaryotic elongation factor 1A [Bruguiera sexangula]
Length=449

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KK+P+G
Sbjct  425  VIKSVEKKEPSG  436



>ref|NP_001275481.1| elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB16996.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            V+K+VDKKDPTG
Sbjct  425  VVKNVDKKDPTG  436



>gb|AAK32834.1|AF361822_1 At1g07930/T6D22_3 [Arabidopsis thaliana]
 gb|AAL15385.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  425  VIKSVDKKDPTG  436



>sp|P43643.1|EF1A_TOBAC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha; AltName: 
Full=Vitronectin-like adhesion protein 1; Short=PVN1 
[Nicotiana tabacum]
 gb|AAA20836.1| vitronectin-like adhesion protein [Nicotiana tabacum]
Length=447

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+VDKKDPTG
Sbjct  425  VIKNVDKKDPTG  436



>ref|XP_003553292.1| PREDICTED: elongation factor 1-alpha isoform 1 [Glycine max]
Length=447

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|ADR70874.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF  YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSGYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_009148045.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009110915.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009118409.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Brassica rapa]
 ref|XP_009118410.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Brassica rapa]
 ref|XP_009118411.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Brassica rapa]
 ref|XP_009120571.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 gb|ACS68201.1| elongation factor 1 alpha [Brassica napus]
 gb|AGK07381.1| elongation factor 1-alpha protein [Brassica oleracea var. botrytis]
Length=449

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  425  VIKSVDKKDPTG  436



>ref|NP_200847.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|NP_563799.1| elongation factor 1-alpha 3 [Arabidopsis thaliana]
 ref|NP_563800.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 ref|NP_563801.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001030993.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001119464.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|XP_002864684.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002889674.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 sp|P0DH99.1|EF1A1_ARATH RecName: Full=Elongation factor 1-alpha 1; Short=EF-1-alpha 1; 
AltName: Full=eEF-1A1 [Arabidopsis thaliana]
 sp|Q8W4H7.2|EF1A2_ARATH RecName: Full=Elongation factor 1-alpha 2; Short=EF-1-alpha 2; 
AltName: Full=eEF-1A2 [Arabidopsis thaliana]
 sp|Q0WL56.2|EF1A3_ARATH RecName: Full=Elongation factor 1-alpha 3; Short=EF-1-alpha 3; 
AltName: Full=eEF-1A3 [Arabidopsis thaliana]
 sp|Q8GTY0.2|EF1A4_ARATH RecName: Full=Elongation factor 1-alpha 4; Short=EF-1-alpha 4; 
AltName: Full=eEF-1A4 [Arabidopsis thaliana]
 gb|AAF79847.1|AC026875_27 T6D22.3 [Arabidopsis thaliana]
 gb|AAL31918.1|AF419586_1 AT5g60390/muf9_40 [Arabidopsis thaliana]
 emb|CAA34453.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34454.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34455.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAB07882.1| EF-1alpha-A1 [Arabidopsis thaliana]
 gb|AAB07883.1| EF-1alpha-A2 [Arabidopsis thaliana]
 gb|AAB07884.1| EF-1alpha-A3 [Arabidopsis thaliana]
 dbj|BAB08224.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAK62638.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAL24386.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAL31193.1| AT5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAL86336.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM65897.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM67562.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91202.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91362.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAM98236.1| unknown protein [Arabidopsis thaliana]
 gb|AAM98240.1| unknown protein [Arabidopsis thaliana]
 gb|AAN18164.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAO00783.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00802.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00870.1| Unknown protein [Arabidopsis thaliana]
 gb|AAO29944.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP21177.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 dbj|BAE99963.1| elongation factor 1-alpha [Arabidopsis thaliana]
 dbj|BAE98497.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 dbj|BAE98750.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 gb|EFH40943.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65933.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|AED97318.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97320.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AEE28212.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28213.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28215.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28216.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  425  VIKSVDKKDPTG  436



>ref|XP_006280459.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 ref|XP_006304491.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
 ref|XP_010456336.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010456344.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010456350.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Camelina sativa]
 ref|XP_010456355.1| PREDICTED: elongation factor 1-alpha 1 isoform X4 [Camelina sativa]
 ref|XP_010456361.1| PREDICTED: elongation factor 1-alpha 1 isoform X5 [Camelina sativa]
 ref|XP_010456369.1| PREDICTED: elongation factor 1-alpha 1 isoform X6 [Camelina sativa]
 ref|XP_010488164.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010488173.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010505603.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010505604.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010509026.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010517279.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443836.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443839.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458006.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458008.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010458009.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010475572.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475573.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475574.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483684.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483687.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 gb|EOA13357.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 gb|EOA37389.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
Length=449

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  425  VIKSVDKKDPTG  436



>emb|CAA34456.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  425  VIKSVDKKDPTG  436



>gb|KJB48746.1| hypothetical protein B456_008G084000 [Gossypium raimondii]
Length=400

 Score =   134 bits (338),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G +KM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  317  TKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  376

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  377  VIKSVEKKDPTG  388



>ref|XP_009144204.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  425  VIKSVDKKDPTG  436



>gb|AAL57653.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  425  VIKSVDKKDPTG  436



>gb|ABA12222.1| translation elongation factor 1A-6 [Gossypium hirsutum]
 gb|KHG08414.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB16823.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16824.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16825.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
Length=447

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_009126609.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  425  VIKSVDKKDPTG  436



>ref|XP_009593325.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+VDKKDPTG
Sbjct  425  VIKNVDKKDPTG  436



>dbj|BAF02151.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  425  VIKSVDKKDPTG  436



>gb|AAN31833.1| putative translation elongation factor eEF-1 alpha chain (gene 
A4) [Arabidopsis thaliana]
Length=449

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  425  VIKSVDKKDPTG  436



>gb|AAK82537.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  425  VIKSVDKKDPTG  436



>ref|XP_007143679.1| hypothetical protein PHAVU_007G092500g [Phaseolus vulgaris]
 gb|ESW15673.1| hypothetical protein PHAVU_007G092500g [Phaseolus vulgaris]
Length=448

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+P+KPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPSKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP G
Sbjct  425  VIKSVEKKDPAG  436



>ref|XP_004984833.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004984834.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|AFC88830.1| putative elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|NP_001152668.1| LOC100286309 [Zea mays]
 ref|XP_008647989.1| PREDICTED: LOC100286309 isoform X1 [Zea mays]
 gb|ACG48827.1| elongation factor 1-alpha [Zea mays]
 gb|AFW76430.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW76431.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW76432.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_002968419.1| hypothetical protein SELMODRAFT_270693 [Selaginella moellendorffii]
 gb|EFJ30673.1| hypothetical protein SELMODRAFT_270693 [Selaginella moellendorffii]
Length=447

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TK+ RRSGKELEKEPKFLKNGD GFVKMLPTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKVDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+V+KK+PTG
Sbjct  425  VIKAVEKKEPTG  436



>ref|XP_002970579.1| hypothetical protein SELMODRAFT_270852 [Selaginella moellendorffii]
 gb|EFJ28709.1| hypothetical protein SELMODRAFT_270852 [Selaginella moellendorffii]
Length=447

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TK+ RRSGKELEKEPKFLKNGD GFVKMLPTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKVDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+V+KK+PTG
Sbjct  425  VIKAVEKKEPTG  436



>gb|AAK25877.1|AF360167_1 putative translation elongation factor eEF-1 alpha chain A4 [Arabidopsis 
thaliana]
Length=449

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  425  VIKSVDKKDPTG  436



>gb|KJB48747.1| hypothetical protein B456_008G084000 [Gossypium raimondii]
Length=427

 Score =   135 bits (339),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G +KM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  344  TKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  403

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  404  VIKSVEKKDPTG  415



>gb|AIX10769.1| elongation factor 1 alpha [Panax notoginseng]
Length=449

 Score =   135 bits (340),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+VDKKDPTG
Sbjct  425  VIKAVDKKDPTG  436



>emb|CDX93604.1| BnaA06g04440D [Brassica napus]
Length=460

 Score =   135 bits (340),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  376  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  435

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  436  VIKSVDKKDPTG  447



>ref|XP_010541344.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|ACS68200.1| elongation factor 1 alpha [Brassica napus]
Length=449

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  425  VIKSVDKKDPTG  436



>gb|ABU63160.1| elongation factor [Saccharum officinarum]
 gb|AGT15989.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT15990.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT16629.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>dbj|BAC66180.1| elongation factor 1A [Avicennia marina]
Length=449

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KK+P+G
Sbjct  425  VIKSVEKKEPSG  436



>ref|XP_004251154.1| PREDICTED: elongation factor 1-alpha-like [Solanum lycopersicum]
Length=447

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+VDKKDP+G
Sbjct  425  VIKNVDKKDPSG  436



>emb|CDY58828.1| BnaAnng15460D [Brassica napus]
Length=568

 Score =   135 bits (341),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  343  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  402

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  403  VIKSVDKKDPTG  414



>gb|KHG26926.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=448

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G +KM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|KHG28979.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G +KM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|KHN42761.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   135 bits (339),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|ABA12217.1| translation elongation factor 1A-1 [Gossypium hirsutum]
Length=447

 Score =   135 bits (339),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G +KM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>emb|CAJ38380.1| translation elongation factor 1 alpha [Plantago major]
Length=249

 Score =   131 bits (330),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  165  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  224

Query  197  VIKSVDKKDPTG  162
            VIKSV+KK+P+G
Sbjct  225  VIKSVEKKEPSG  236



>ref|XP_007015467.1| GTP binding Elongation factor Tu family protein isoform 2 [Theobroma 
cacao]
 gb|EOY33086.1| GTP binding Elongation factor Tu family protein isoform 2 [Theobroma 
cacao]
Length=348

 Score =   134 bits (336),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  264  TKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  323

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDPTG
Sbjct  324  VIKNVEKKDPTG  335



>ref|XP_009783256.1| PREDICTED: elongation factor 1-alpha [Nicotiana sylvestris]
 dbj|BAA09709.1| elongation factor-1 alpha [Nicotiana tabacum]
Length=447

 Score =   135 bits (339),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+VDKKDPTG
Sbjct  425  VIKNVDKKDPTG  436



>gb|ABA12220.1| translation elongation factor 1A-4 [Gossypium hirsutum]
 gb|KJB62497.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62498.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62499.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
 gb|KJB62500.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
Length=447

 Score =   135 bits (339),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G +KM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|EYU36203.1| hypothetical protein MIMGU_mgv1a006301mg [Erythranthe guttata]
Length=449

 Score =   135 bits (339),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+E+EPKFLKNGD GFVKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEREPKFLKNGDAGFVKMFPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_008783722.1| PREDICTED: elongation factor 1-alpha isoform X1 [Phoenix dactylifera]
Length=447

 Score =   135 bits (339),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF  YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>gb|KHN14872.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   135 bits (339),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>emb|CDX95108.1| BnaC05g05630D [Brassica napus]
Length=487

 Score =   135 bits (340),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  386  TKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  445

Query  197  VIKSVDKKDPTG  162
            VIKSVDKKDPTG
Sbjct  446  VIKSVDKKDPTG  457



>gb|ABA12221.1| translation elongation factor 1A-5 [Gossypium hirsutum]
Length=448

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G +KM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|AAL79774.1|AF331849_1 elongation factor 1 alpha [Saccharum hybrid cultivar CP65-357]
Length=447

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_011004182.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011010862.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
Length=447

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF  YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>sp|O49169.1|EF1A_MANES RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Manihot 
esculenta]
 gb|AAC39447.1| elongation factor 1-alpha [Manihot esculenta]
Length=449

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF  YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>gb|ABA12223.1| translation elongation factor 1A-7 [Gossypium hirsutum]
Length=448

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G +KM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|ACR38047.1| unknown [Zea mays]
 gb|AFW77623.1| elongation factor alpha1 [Zea mays]
Length=447

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF +YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|AFQ37422.1| translation elongation factor-1 alpha 1 [Larix kaempferi]
Length=447

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
             K+ RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  AKVDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDPTG
Sbjct  425  VIKAVEKKDPTG  436



>ref|XP_009380678.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380679.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380680.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+P+KPMVVETF  YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPSKPMVVETFAAYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|AGJ50595.1| EF1alpha [Pericallis cruenta]
Length=449

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMMPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|ACG31866.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF +YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_008380544.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
Length=447

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKMLPTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>sp|Q41011.1|EF1A_PEA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Pisum 
sativum]
 emb|CAA65391.1| elongation factor 1-alpha [Pisum sativum]
Length=447

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|ACG34498.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF +YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_001763198.1| predicted protein [Physcomitrella patens]
 gb|EDQ72075.1| predicted protein [Physcomitrella patens]
Length=352

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TK+ RRSGKELEKEPKFLKNGD GFVKM+PTKPM VETF EYPPLGRFAVRDMRQTVAVG
Sbjct  270  TKVDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMTVETFAEYPPLGRFAVRDMRQTVAVG  329

Query  197  VIKSVDKKDPTG  162
            VIK+V+KK+PTG
Sbjct  330  VIKAVEKKEPTG  341



>ref|XP_008656153.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 ref|XP_008656154.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 gb|AFW81463.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81464.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81465.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF +YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_006381487.1| hypothetical protein POPTR_0006s13310g [Populus trichocarpa]
 gb|ABK95720.1| unknown [Populus trichocarpa]
 gb|ERP59284.1| hypothetical protein POPTR_0006s13310g [Populus trichocarpa]
Length=447

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF  YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>ref|NP_001183947.1| uncharacterized protein LOC100502553 [Zea mays]
 gb|ACF84684.1| unknown [Zea mays]
Length=399

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELE  PKFLKNGD GFVKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  317  TKIDRRSGKELESAPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  376

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  377  VIKSVEKKDPTG  388



>ref|WP_033581549.1| elongation factor 1-alpha, partial [Dickeya zeae]
Length=147

 Score =   128 bits (321),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  79   TKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  138

Query  197  VIKSVDKKD  171
            VIKSV+KKD
Sbjct  139  VIKSVEKKD  147



>ref|XP_008380545.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008365661.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_009374568.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009374577.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKMLPTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>gb|AHB86963.1| elongation factor 1-alpha [Sedum alfredii]
Length=447

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G +KM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_008656156.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Zea mays]
 gb|AFW81467.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81468.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81469.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF +YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|AEQ75495.1| elongation factor 1-alpha [Rosa multiflora]
Length=447

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKMLPTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>ref|NP_001288407.1| elongation factor 1-alpha-like [Zea mays]
 gb|ACF87009.1| unknown [Zea mays]
Length=447

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF +YPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_007222129.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
 ref|XP_008224523.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
 gb|EMJ23328.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
Length=447

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKMLPTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>ref|XP_010939624.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010939625.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            +KI RRSGKELEKEPKFLKNGD GFVKM+PTKPMVVETF EY PLGRFAVRDMRQTVAVG
Sbjct  365  SKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYSPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>sp|O24534.1|EF1A_VICFA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Vicia 
faba]
 emb|CAA10847.1| elongation factor 1-alpha (EF1-a) [Vicia faba]
Length=447

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_008224543.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>ref|XP_007205199.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
 gb|EMJ06398.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
Length=447

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKE+EKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDPTG
Sbjct  425  VIKSVEKKDPTG  436



>gb|AAC15413.1| translation elongation factor-1 alpha [Oryza sativa Japonica 
Group]
Length=447

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDPTG
Sbjct  425  VIKNVEKKDPTG  436



>gb|AAD56020.1|AF181492_1 elongation factor-1 alpha 3 [Lilium longiflorum]
Length=447

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDPTG
Sbjct  425  VIKNVEKKDPTG  436



>ref|XP_002968422.1| hypothetical protein SELMODRAFT_169717 [Selaginella moellendorffii]
 gb|EFJ30676.1| hypothetical protein SELMODRAFT_169717 [Selaginella moellendorffii]
Length=447

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TK+ RRSGKELE+EPKFLKNGD GFVKMLPTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKVDRRSGKELEQEPKFLKNGDAGFVKMLPTKPMVVETFAEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+V+KK+PTG
Sbjct  425  VIKAVEKKEPTG  436



>gb|EEE58429.1| hypothetical protein OsJ_09630 [Oryza sativa Japonica Group]
Length=427

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  345  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  404

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDPTG
Sbjct  405  VIKNVEKKDPTG  416



>ref|XP_004309880.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKMLPTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDP+G
Sbjct  425  VIKNVEKKDPSG  436



>dbj|BAM13874.1| elongation factor 1 alpha [Symplocarpus renifolius]
Length=447

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIKSV+KKDP+G
Sbjct  425  VIKSVEKKDPSG  436



>dbj|BAA23658.1| EF-1 alpha [Oryza sativa]
Length=447

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  TKIXRRSGKELEKEPKFLKNGDXGFVKMLPTKPMVVETFXEYPPLGRFAVRDMRQTVAVG  198
            TKI RRSGKELEKEPKFLKNGD G VKM+PTKPMVVETF EYPPLGRFAVRDMRQTVAVG
Sbjct  365  TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVG  424

Query  197  VIKSVDKKDPTG  162
            VIK+V+KKDPTG
Sbjct  425  VIKNVEKKDPTG  436



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551036074875