BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF025B13

Length=908
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACJ85643.1|  unknown                                                 388   1e-132   Medicago truncatula
gb|ABH08755.1|  ubiquitin                                               387   2e-132   Arabidopsis thaliana [mouse-ear cress]
gb|ABH08753.1|  ubiquitin                                               387   2e-132   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567286.1|  ubiquitin 11                                          387   2e-132   Arabidopsis thaliana [mouse-ear cress]
gb|AAM78180.1|  putative polyubiquitin                                  385   5e-132   Gossypium herbaceum [Arabian cotton]
gb|ACZ69386.1|  polyubiquitin UBQ14                                     385   6e-132   Cucumis sativus [cucumbers]
gb|ACJ85618.1|  unknown                                                 386   6e-132   Medicago truncatula
ref|XP_008358804.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    387   8e-132   
gb|AIZ74335.1|  polyubiquitin 3                                         386   9e-132   Pinus massoniana [Chinese red pine]
ref|XP_003626479.1|  Ubiquitin-like protein                             387   1e-131   
gb|AFK43392.1|  unknown                                                 385   1e-131   Medicago truncatula
ref|XP_010931017.1|  PREDICTED: polyubiquitin 11 isoform X1             385   1e-131   Elaeis guineensis
gb|AAM64530.1|  ubiquitin homolog                                       385   2e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010490793.1|  PREDICTED: polyubiquitin 11-like                   385   2e-131   Camelina sativa [gold-of-pleasure]
gb|EEC81189.1|  hypothetical protein OsI_24195                          385   2e-131   Oryza sativa Indica Group [Indian rice]
ref|XP_009114489.1|  PREDICTED: polyubiquitin-like                      388   2e-131   Brassica rapa
gb|AAF31707.1|AF221858_1  polyubiquitin                                 385   2e-131   Euphorbia esula [wolf's milk]
gb|ABH08754.1|  ubiquitin                                               385   2e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003570150.1|  PREDICTED: polyubiquitin 11 isoform X2             385   2e-131   Brachypodium distachyon [annual false brome]
gb|AAB36546.1|  polyubiquitin                                           385   2e-131   Phaseolus vulgaris [French bean]
dbj|BAC57955.1|  polyubiquitin                                          385   2e-131   Tripolium pannonicum [sea starwort]
ref|XP_002317213.1|  polyubiquitin family protein                       385   2e-131   Populus trichocarpa [western balsam poplar]
gb|AFY06654.1|  polyubiquitin                                           386   2e-131   Carica papaya [mamon]
gb|EYU33610.1|  hypothetical protein MIMGU_mgv1a004315mg                385   2e-131   Erythranthe guttata [common monkey flower]
gb|AET06143.1|  ubiquitin                                               385   2e-131   Papaver somniferum
emb|CAH59739.1|  polyubiquitin                                          385   2e-131   Plantago major [cart-track plant]
ref|XP_006370634.1|  hypothetical protein POPTR_0001s44440g             386   2e-131   
ref|XP_006288299.1|  hypothetical protein CARUB_v10001544mg             385   2e-131   
emb|CAA48140.1|  ubiquitin                                              387   2e-131   Antirrhinum majus [garden snapdragon]
gb|KJB62484.1|  hypothetical protein B456_009G418900                    385   2e-131   Gossypium raimondii
gb|ABK94002.1|  unknown                                                 388   2e-131   Populus trichocarpa [western balsam poplar]
ref|XP_004968120.1|  PREDICTED: polyubiquitin-like                      385   3e-131   Setaria italica
gb|KJB36627.1|  hypothetical protein B456_006G167800                    385   3e-131   Gossypium raimondii
ref|NP_849292.1|  polyubiquitin 14                                      387   3e-131   Arabidopsis thaliana [mouse-ear cress]
gb|AAP31578.1|  ubiquitin                                               385   3e-131   Hevea brasiliensis [jebe]
ref|XP_010453358.1|  PREDICTED: polyubiquitin-like                      387   3e-131   Camelina sativa [gold-of-pleasure]
gb|ABD96088.1|  polyubiquitin                                           386   3e-131   Malus domestica [apple tree]
gb|AFK41706.1|  unknown                                                 385   3e-131   Medicago truncatula
gb|KJB81823.1|  hypothetical protein B456_013G163500                    387   3e-131   Gossypium raimondii
ref|XP_006428779.1|  hypothetical protein CICLE_v10012654mg             384   3e-131   Citrus clementina [clementine]
gb|KDO51109.1|  hypothetical protein CISIN_1g026973mg                   384   3e-131   Citrus sinensis [apfelsine]
gb|KDO51955.1|  hypothetical protein CISIN_1g026932mg                   384   3e-131   Citrus sinensis [apfelsine]
ref|XP_002872746.1|  hypothetical protein ARALYDRAFT_911794             384   4e-131   
ref|XP_010235843.1|  PREDICTED: polyubiquitin 11 isoform X1             385   4e-131   Brachypodium distachyon [annual false brome]
gb|EPS72031.1|  polyubiquitin                                           386   4e-131   Genlisea aurea
gb|AEZ49160.1|  polyubiquitin                                           386   4e-131   Wolffia australiana
gb|AAO43307.1|  putative polyubiquitin                                  385   4e-131   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54749.1|  ubiquitin 11                                            385   5e-131   Phaseolus vulgaris [French bean]
emb|CBY46745.1|  polyubiquitin 10 protein                               387   5e-131   Lepidium appelianum [hairy whitetop]
gb|AAC35858.1|  polyubiquitin                                           385   5e-131   Capsicum chinense [bonnet pepper]
ref|XP_003627152.1|  Ubiquitin                                          385   6e-131   
ref|XP_002872805.1|  hypothetical protein ARALYDRAFT_490270             387   7e-131   
gb|AES89866.2|  polyubiquitin 3                                         386   8e-131   Medicago truncatula
ref|XP_002438839.1|  hypothetical protein SORBIDRAFT_10g027030          383   9e-131   Sorghum bicolor [broomcorn]
ref|XP_006377830.1|  hypothetical protein POPTR_0011s13770g             386   9e-131   
gb|ABY60454.1|  putative polyubiquitin                                  385   1e-130   Adonis aestivalis var. palaestina
emb|CBI22349.3|  unnamed protein product                                386   1e-130   Vitis vinifera
emb|CAA40323.1|  polyubiquitin protein                                  387   1e-130   Helianthus annuus
ref|XP_008784557.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    383   1e-130   
ref|XP_006428822.1|  hypothetical protein CICLE_v10012652mg             383   1e-130   Citrus clementina [clementine]
ref|XP_007154495.1|  hypothetical protein PHAVU_003G1236001g            384   1e-130   Phaseolus vulgaris [French bean]
ref|XP_007512209.1|  polyubiquitin                                      388   1e-130   Bathycoccus prasinos
ref|XP_007211606.1|  hypothetical protein PRUPE_ppa005503mg             386   2e-130   
ref|XP_010492041.1|  PREDICTED: polyubiquitin-like                      385   2e-130   Camelina sativa [gold-of-pleasure]
ref|XP_010452435.1|  PREDICTED: polyubiquitin-like                      385   2e-130   Camelina sativa [gold-of-pleasure]
gb|AES89865.2|  polyubiquitin 3                                         384   2e-130   Medicago truncatula
ref|XP_008796945.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    385   2e-130   Phoenix dactylifera
sp|P0CG84.1|UBI4P_NICSY  RecName: Full=Polyubiquitin; Contains: R...    388   2e-130   Nicotiana sylvestris
ref|XP_009112898.1|  PREDICTED: polyubiquitin                           385   2e-130   Brassica rapa
gb|EYU33609.1|  hypothetical protein MIMGU_mgv1a004315mg                385   2e-130   Erythranthe guttata [common monkey flower]
ref|XP_007014924.1|  Polyubiquitin 3                                    385   2e-130   Theobroma cacao [chocolate]
ref|XP_011468094.1|  PREDICTED: polyubiquitin                           385   2e-130   Fragaria vesca subsp. vesca
gb|AAQ84316.1|  fiber polyubiquitin                                     382   2e-130   Gossypium barbadense [Egyptian cotton]
emb|CAH59740.1|  polyubiquitin                                          385   2e-130   Plantago major [cart-track plant]
ref|XP_010258950.1|  PREDICTED: polyubiquitin                           385   2e-130   Nelumbo nucifera [Indian lotus]
ref|XP_006396611.1|  hypothetical protein EUTSA_v10028730mg             385   2e-130   
ref|XP_006685644.1|  ubiquitin                                          382   2e-130   Yamadazyma tenuis ATCC 10573
gb|KDP39203.1|  hypothetical protein JCGZ_00960                         385   2e-130   Jatropha curcas
emb|CAC94926.1|  putative ubiquitin                                     383   2e-130   Pleurotus sp. 'Florida' [Florida oyster mushroom]
ref|XP_006428821.1|  hypothetical protein CICLE_v10012292mg             385   2e-130   Citrus clementina [clementine]
ref|XP_002456845.1|  hypothetical protein SORBIDRAFT_03g043940          385   2e-130   Sorghum bicolor [broomcorn]
emb|CDP08569.1|  unnamed protein product                                385   2e-130   Coffea canephora [robusta coffee]
ref|XP_006654612.1|  PREDICTED: polyubiquitin-like                      385   2e-130   Oryza brachyantha
gb|AAO42469.1|  putative polyubiquitin                                  385   2e-130   Arabidopsis lyrata [lyrate rockcress]
sp|P69315.2|UBIQP_LINUS  RecName: Full=Polyubiquitin; Contains: R...    385   2e-130   Linum usitatissimum
gb|AAB36545.1|  ubiquitin-like protein                                  389   2e-130   Phaseolus vulgaris [French bean]
dbj|BAJ85978.1|  predicted protein                                      385   3e-130   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAL09741.1|  AT4g05320/C17L7_240                                     388   3e-130   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851029.1|  polyubiquitin 3                                       385   3e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302387.1|  hypothetical protein CARUB_v10020456mg             385   3e-130   
gb|KJB62487.1|  hypothetical protein B456_009G418900                    385   3e-130   Gossypium raimondii
emb|CDP05795.1|  unnamed protein product                                388   3e-130   Coffea canephora [robusta coffee]
ref|XP_006480631.1|  PREDICTED: polyubiquitin-like                      385   3e-130   Citrus sinensis [apfelsine]
gb|AAB68045.1|  polyubiquitin                                           388   3e-130   Fragaria x ananassa
ref|XP_006428820.1|  hypothetical protein CICLE_v10012290mg             385   3e-130   Citrus clementina [clementine]
ref|XP_007205620.1|  hypothetical protein PRUPE_ppa009116mg             385   3e-130   
ref|XP_010240921.1|  PREDICTED: polyubiquitin-like                      388   3e-130   Nelumbo nucifera [Indian lotus]
emb|CBY46746.1|  polyubiquitin 10 protein                               388   3e-130   Lepidium campestre [bastard cress]
prf||1604470A  poly-ubiquitin                                           384   3e-130
ref|XP_003537278.1|  PREDICTED: polyubiquitin-like                      385   3e-130   Glycine max [soybeans]
gb|AFW66439.1|  putative ubiquitin family protein                       385   3e-130   
ref|XP_006428925.1|  hypothetical protein CICLE_v10012291mg             385   3e-130   Citrus clementina [clementine]
ref|XP_009631616.1|  PREDICTED: polyubiquitin-like                      388   3e-130   Nicotiana tomentosiformis
ref|NP_849300.4|  polyubiquitin 10                                      388   3e-130   Arabidopsis thaliana [mouse-ear cress]
gb|KJB81825.1|  hypothetical protein B456_013G163500                    388   3e-130   Gossypium raimondii
ref|XP_009763135.1|  PREDICTED: polyubiquitin-like                      388   3e-130   Nicotiana sylvestris
gb|KJB13592.1|  hypothetical protein B456_002G083000                    388   3e-130   Gossypium raimondii
emb|CAA54603.1|  pentameric polyubiquitin                               386   3e-130   Nicotiana tabacum [American tobacco]
gb|ACD31680.1|  ubiquitin                                               385   3e-130   Gossypium hirsutum [American cotton]
ref|XP_002873083.1|  hypothetical protein ARALYDRAFT_487095             385   4e-130   
gb|KDP38838.1|  hypothetical protein JCGZ_04995                         385   4e-130   Jatropha curcas
ref|XP_009605659.1|  PREDICTED: polyubiquitin                           385   4e-130   Nicotiana tomentosiformis
ref|XP_011077812.1|  PREDICTED: polyubiquitin 3                         385   4e-130   
gb|KJB14874.1|  hypothetical protein B456_002G147600                    386   5e-130   Gossypium raimondii
gb|ABR25697.1|  polyubiquitin containing 7 ubiquitin monomers           380   5e-130   Oryza sativa Indica Group [Indian rice]
gb|AEW46688.1|  polyubiquitin                                           381   5e-130   Ulva linza
ref|XP_006593989.1|  PREDICTED: polyubiquitin 10-like isoform X1        387   5e-130   
ref|NP_001147027.1|  polyubiquitin containing 7 ubiquitin monomers      384   5e-130   
ref|XP_002992988.1|  hypothetical protein SELMODRAFT_187148             381   5e-130   Selaginella moellendorffii
ref|XP_009358096.1|  PREDICTED: polyubiquitin isoform X1                388   6e-130   Pyrus x bretschneideri [bai li]
gb|AAB95250.1|  ubiquitin                                               384   6e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007154496.1|  hypothetical protein PHAVU_003G1236001g            384   6e-130   Phaseolus vulgaris [French bean]
gb|KIR83632.1|  polyubiquitin                                           381   6e-130   Cryptococcus gattii VGIV IND107
gb|KIM78989.1|  hypothetical protein PILCRDRAFT_573034                  381   6e-130   Piloderma croceum F 1598
gb|KDB11907.1|  ubiquitin                                               384   6e-130   Ustilaginoidea virens
ref|XP_010938693.1|  PREDICTED: polyubiquitin                           384   6e-130   Elaeis guineensis
gb|AAK68824.1|  Unknown protein                                         381   7e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003574865.1|  PREDICTED: polyubiquitin-like                      385   7e-130   Brachypodium distachyon [annual false brome]
gb|EJU04700.1|  polyubiquitin UbiD/Ubi4                                 381   7e-130   Dacryopinax primogenitus
gb|KJA26171.1|  hypothetical protein HYPSUDRAFT_354705                  381   7e-130   Hypholoma sublateritium FD-334 SS-4
gb|KIM78981.1|  hypothetical protein PILCRDRAFT_10644                   381   7e-130   Piloderma croceum F 1598
ref|XP_011110054.1|  hypothetical protein H072_4094                     381   8e-130   
gb|KJB62485.1|  hypothetical protein B456_009G418900                    384   8e-130   Gossypium raimondii
ref|NP_001148453.1|  LOC100282068                                       387   9e-130   Zea mays [maize]
ref|XP_719867.1|  hypothetical protein CaO19.6771                       381   1e-129   Candida albicans SC5314
ref|XP_007339454.1|  ubiquitin                                          384   1e-129   
ref|XP_001783045.1|  predicted protein                                  380   1e-129   
gb|KIK28767.1|  hypothetical protein PISMIDRAFT_672939                  381   1e-129   Pisolithus microcarpus 441
gb|AIY27743.1|  polyubiquitin Ubi10                                     384   1e-129   Betula luminifera [liang ye hua]
dbj|BAL61087.1|  polyubiquitin                                          380   1e-129   Dianthus caryophyllus [carnation]
ref|XP_001830230.1|  ubiquitin                                          384   1e-129   Coprinopsis cinerea okayama7#130
gb|KEH31155.1|  polyubiquitin 3                                         386   1e-129   Medicago truncatula
ref|XP_006372519.1|  polyubiquitin family protein                       384   1e-129   Populus trichocarpa [western balsam poplar]
ref|XP_006288300.1|  hypothetical protein CARUB_v10001544mg             384   1e-129   Capsella rubella
ref|XP_002872109.1|  predicted protein                                  386   1e-129   
ref|XP_010227188.1|  PREDICTED: polyubiquitin isoform X1                385   1e-129   
ref|XP_006381473.1|  polyubiquitin family protein                       383   2e-129   
ref|XP_003082269.1|  polyubiquitin (ISS)                                382   2e-129   
emb|CEF99839.1|  Ubiquitin conserved site                               384   2e-129   Ostreococcus tauri
gb|KIL68862.1|  hypothetical protein M378DRAFT_157997                   383   2e-129   Amanita muscaria Koide BX008
ref|XP_010062974.1|  PREDICTED: polyubiquitin                           387   2e-129   Eucalyptus grandis [rose gum]
ref|XP_010911599.1|  PREDICTED: polyubiquitin 4                         386   2e-129   Elaeis guineensis
ref|XP_008020911.1|  hypothetical protein SETTUDRAFT_162442             383   2e-129   Exserohilum turcica Et28A
ref|XP_006396612.1|  hypothetical protein EUTSA_v10028730mg             385   2e-129   Eutrema salsugineum [saltwater cress]
ref|XP_007154493.1|  hypothetical protein PHAVU_003G123500g             387   2e-129   Phaseolus vulgaris [French bean]
gb|EYU33608.1|  hypothetical protein MIMGU_mgv1a004315mg                385   2e-129   Erythranthe guttata [common monkey flower]
ref|XP_010558157.1|  PREDICTED: polyubiquitin-like                      385   2e-129   Tarenaya hassleriana [spider flower]
gb|KFX48439.1|  Polyubiquitin                                           379   2e-129   Talaromyces marneffei PM1
gb|EWZ40370.1|  ubiquitin C                                             380   2e-129   Fusarium oxysporum Fo47
ref|NP_001105376.1|  polyubiquitin                                      385   2e-129   
gb|ACS68205.1|  ubiquitin 10.2                                          385   2e-129   Brassica napus [oilseed rape]
ref|XP_009108753.1|  PREDICTED: polyubiquitin 11-like                   380   2e-129   Brassica rapa
gb|EGO00904.1|  hypothetical protein SERLA73DRAFT_178893                383   2e-129   Serpula lacrymans var. lacrymans S7.3
gb|AGV54228.1|  polyubiquitin-like protein                              385   2e-129   Phaseolus vulgaris [French bean]
gb|ABU40645.1|  polyubiquitin                                           385   2e-129   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010240636.1|  PREDICTED: polyubiquitin isoform X1                385   2e-129   
ref|XP_002508175.1|  ubiquitin                                          385   2e-129   Micromonas commoda
ref|XP_010454368.1|  PREDICTED: polyubiquitin 4-like                    385   3e-129   Camelina sativa [gold-of-pleasure]
ref|XP_002874006.1|  hypothetical protein ARALYDRAFT_488966             385   3e-129   
gb|ADD52202.1|  ubiquitin                                               385   3e-129   Catharanthus roseus [chatas]
ref|XP_001420612.1|  predicted protein                                  385   3e-129   Ostreococcus lucimarinus CCE9901
emb|CDR41572.1|  RHTO0S06e03070g1_1                                     380   3e-129   Rhodotorula toruloides
gb|KIK92093.1|  hypothetical protein PAXRUDRAFT_830299                  380   3e-129   Paxillus rubicundulus Ve08.2h10
gb|AAQ07453.1|  ubiquitin                                               385   3e-129   Musa acuminata AAA Group [Cavendish banana]
ref|NP_568397.1|  ubiquitin 4                                           385   3e-129   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001174480.1|  Os05g0504766                                       385   3e-129   
ref|XP_002953480.1|  polyubiquitin                                      382   3e-129   Volvox carteri f. nagariensis
ref|XP_010270791.1|  PREDICTED: polyubiquitin-like                      385   3e-129   Nelumbo nucifera [Indian lotus]
ref|XP_006428816.1|  hypothetical protein CICLE_v10011684mg             385   3e-129   
ref|XP_010696408.1|  PREDICTED: polyubiquitin 4                         385   3e-129   Beta vulgaris subsp. vulgaris [field beet]
sp|Q58G87.2|UBQ3_ORYSJ  RecName: Full=Polyubiquitin 3; Contains: ...    385   3e-129   Oryza sativa Japonica Group [Japonica rice]
gb|EYU18102.1|  hypothetical protein MIMGU_mgv1a008166mg                385   3e-129   Erythranthe guttata [common monkey flower]
gb|AAY86773.1|  polyubiquitin                                           385   3e-129   Noccaea caerulescens
ref|XP_009596689.1|  PREDICTED: polyubiquitin-like                      385   3e-129   Nicotiana tomentosiformis
ref|XP_010431529.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    388   3e-129   Camelina sativa [gold-of-pleasure]
ref|XP_009591312.1|  PREDICTED: polyubiquitin 4                         385   3e-129   Nicotiana tomentosiformis
ref|XP_010421267.1|  PREDICTED: polyubiquitin 4-like                    385   3e-129   Camelina sativa [gold-of-pleasure]
gb|KJB62483.1|  hypothetical protein B456_009G418900                    385   3e-129   Gossypium raimondii
ref|XP_010324327.1|  PREDICTED: polyubiquitin isoform X2                385   3e-129   
emb|CCL99875.1|  predicted protein                                      382   3e-129   Fibroporia radiculosa
gb|KIM67150.1|  hypothetical protein SCLCIDRAFT_1210637                 382   3e-129   Scleroderma citrinum Foug A
gb|AAX40652.1|  polyubiquitin                                           385   4e-129   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002266370.1|  PREDICTED: polyubiquitin 4-like                    385   4e-129   Vitis vinifera
ref|XP_006302388.1|  hypothetical protein CARUB_v10020456mg             385   4e-129   Capsella rubella
ref|NP_849299.4|  polyubiquitin 10                                      388   4e-129   Arabidopsis thaliana [mouse-ear cress]
emb|CDP08567.1|  unnamed protein product                                384   4e-129   Coffea canephora [robusta coffee]
ref|XP_005644220.1|  polyubiquitin                                      382   4e-129   Coccomyxa subellipsoidea C-169
emb|CCT70325.1|  UBI4-Ubiquitin                                         381   4e-129   Fusarium fujikuroi IMI 58289
ref|XP_004956019.1|  PREDICTED: polyubiquitin 4-like                    385   4e-129   Setaria italica
ref|XP_008441422.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    388   4e-129   Cucumis melo [Oriental melon]
ref|XP_003542730.1|  PREDICTED: polyubiquitin 10-like                   388   4e-129   
gb|KJB81827.1|  hypothetical protein B456_013G163500                    388   4e-129   Gossypium raimondii
ref|XP_009784905.1|  PREDICTED: polyubiquitin-like isoform X1           388   4e-129   Nicotiana sylvestris
ref|XP_003670049.1|  hypothetical protein NDAI_0D04930                  379   4e-129   Naumovozyma dairenensis CBS 421
gb|KJB13590.1|  hypothetical protein B456_002G083000                    388   4e-129   Gossypium raimondii
gb|KJB81824.1|  hypothetical protein B456_013G163500                    385   4e-129   Gossypium raimondii
ref|XP_010275241.1|  PREDICTED: polyubiquitin-like                      385   4e-129   Nelumbo nucifera [Indian lotus]
ref|NP_001053957.1|  Os04g0628100                                       385   4e-129   
ref|XP_001764949.1|  predicted protein                                  382   4e-129   
gb|KJB62486.1|  hypothetical protein B456_009G418900                    385   5e-129   Gossypium raimondii
ref|XP_006287868.1|  hypothetical protein CARUB_v10001095mg             385   5e-129   
ref|XP_011038259.1|  PREDICTED: polyubiquitin-like                      382   5e-129   Populus euphratica
ref|XP_008244357.1|  PREDICTED: polyubiquitin isoform X1                388   5e-129   Prunus mume [ume]
gb|EMS65864.1|  Polyubiquitin                                           385   5e-129   Triticum urartu
ref|XP_007924320.1|  hypothetical protein MYCFIDRAFT_60610              379   5e-129   Pseudocercospora fijiensis CIRAD86
gb|AHC00631.1|  polyubiquitin                                           382   5e-129   Ganoderma lucidum
gb|KIY45417.1|  ubiquitin                                               382   5e-129   Fistulina hepatica ATCC 64428
gb|KIR29996.1|  polyubiquitin                                           382   5e-129   Cryptococcus gattii VGII LA55
gb|KIY53974.1|  polyubiquitin                                           382   6e-129   Fistulina hepatica ATCC 64428
ref|XP_011048569.1|  PREDICTED: polyubiquitin 3-like                    382   6e-129   Populus euphratica
ref|XP_003030030.1|  polyubiquitin                                      382   6e-129   Schizophyllum commune H4-8
gb|KIR63773.1|  polyubiquitin                                           382   6e-129   Cryptococcus gattii CA1873
ref|XP_001828882.1|  ubiquitin C                                        382   6e-129   Coprinopsis cinerea okayama7#130
ref|XP_001931824.1|  ubiquitin                                          379   6e-129   Pyrenophora tritici-repentis Pt-1C-BFP
sp|P0CG73.1|UBI1P_CANAX  RecName: Full=Polyubiquitin; Contains: R...    379   6e-129   Candida albicans
ref|XP_001555417.1|  polyubiquitin                                      382   6e-129   Botrytis cinerea B05.10
ref|XP_001755431.1|  predicted protein                                  379   7e-129   
gb|KIJ45725.1|  hypothetical protein M422DRAFT_106821                   382   7e-129   Sphaerobolus stellatus SS14
gb|KDQ20365.1|  hypothetical protein BOTBODRAFT_123907                  382   7e-129   Botryobasidium botryosum FD-172 SS1
emb|CEP60563.1|  LALA0S01e13784g1_1                                     379   7e-129   Lachancea lanzarotensis
ref|XP_007763327.1|  polyubiquitin                                      381   7e-129   Coniophora puteana RWD-64-598 SS2
ref|XP_001598085.1|  polyubiquitin                                      381   7e-129   Sclerotinia sclerotiorum 1980 UF-70
gb|EKV18932.1|  hypothetical protein PDIP_25190                         379   7e-129   Penicillium digitatum Pd1
ref|XP_010493589.1|  PREDICTED: polyubiquitin-like                      386   8e-129   Camelina sativa [gold-of-pleasure]
ref|XP_001755307.1|  predicted protein                                  381   9e-129   
gb|EFN76024.1|  Ubiquitin                                               378   9e-129   Harpegnathos saltator
ref|XP_002980153.1|  hypothetical protein SELMODRAFT_271419             381   9e-129   
ref|XP_002419618.1|  ubiquitin, putative                                381   9e-129   Candida dubliniensis CD36
ref|XP_007366816.1|  polyubiquitin                                      381   1e-128   Dichomitus squalens LYAD-421 SS1
dbj|BAK61744.1|  ubiquitin                                              378   1e-128   Collozoum amoeboides
ref|XP_007864655.1|  ubiquitin                                          384   1e-128   Gloeophyllum trabeum ATCC 11539
gb|EPX74297.1|  ubiquitin                                               378   1e-128   Schizosaccharomyces octosporus yFS286
ref|XP_001777816.1|  predicted protein                                  384   1e-128   
dbj|BAK61751.1|  ubiquitin                                              378   1e-128   Sphaerozoum punctatum
ref|XP_011037020.1|  PREDICTED: polyubiquitin-like                      384   1e-128   Populus euphratica
ref|XP_001797032.1|  hypothetical protein SNOG_06667                    378   1e-128   Parastagonospora nodorum SN15
ref|XP_007205619.1|  hypothetical protein PRUPE_ppa009116mg             378   1e-128   
ref|XP_007049060.1|  Polyubiquitin 10                                   386   1e-128   
gb|AAO43308.1|  putative polyubiquitin                                  379   1e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010436682.1|  PREDICTED: polyubiquitin 4-like                    386   1e-128   
ref|XP_010537590.1|  PREDICTED: polyubiquitin 11                        377   2e-128   Tarenaya hassleriana [spider flower]
ref|XP_003052575.1|  predicted protein                                  380   2e-128   [Nectria] haematococca mpVI 77-13-4
ref|XP_010324326.1|  PREDICTED: polyubiquitin isoform X1                386   2e-128   
ref|XP_009784908.1|  PREDICTED: polyubiquitin-like isoform X2           385   2e-128   Nicotiana sylvestris
dbj|BAK03691.1|  predicted protein                                      386   2e-128   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007154492.1|  hypothetical protein PHAVU_003G123400g             382   2e-128   Phaseolus vulgaris [French bean]
ref|XP_004953565.1|  PREDICTED: polyubiquitin-like                      386   2e-128   Setaria italica
gb|AGM32540.1|  polyubiquitin-B-like isoform                            379   2e-128   Coptotermes formosanus
emb|CCA70326.1|  related to UBI4-Ubiquitin                              377   2e-128   Serendipita indica DSM 11827
gb|AAB95252.1|  ubiquitin                                               383   2e-128   Arabidopsis thaliana [mouse-ear cress]
emb|CAB81074.1|  polyubiquitin (ubq10)                                  386   2e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008345409.1|  PREDICTED: polyubiquitin-like                      386   2e-128   
ref|XP_007211609.1|  hypothetical protein PRUPE_ppa005507mg             385   2e-128   Prunus persica
gb|KII93501.1|  hypothetical protein PLICRDRAFT_694663                  382   2e-128   Plicaturopsis crispa FD-325 SS-3
ref|XP_010262389.1|  PREDICTED: polyubiquitin                           386   2e-128   Nelumbo nucifera [Indian lotus]
ref|XP_003010029.1|  polyubiquitin UbiD/Ubi4, putative                  377   2e-128   Trichophyton benhamiae CBS 112371
gb|AAB95251.1|  ubiquitin                                               385   2e-128   Arabidopsis thaliana [mouse-ear cress]
gb|KDP42860.1|  hypothetical protein JCGZ_23802                         385   2e-128   Jatropha curcas
gb|AAD03343.1|  ubiquitin                                               385   2e-128   Pisum sativum [garden pea]
ref|XP_002891806.1|  predicted protein                                  383   3e-128   
gb|KIM22018.1|  hypothetical protein M408DRAFT_333137                   377   3e-128   Serendipita vermifera MAFF 305830
ref|XP_002452705.1|  hypothetical protein SORBIDRAFT_04g031060          385   3e-128   Sorghum bicolor [broomcorn]
gb|KIM30634.1|  hypothetical protein M408DRAFT_328170                   377   3e-128   Serendipita vermifera MAFF 305830
gb|EGA57707.1|  Ubi4p                                                   378   3e-128   Saccharomyces cerevisiae FostersB
gb|EYU33607.1|  hypothetical protein MIMGU_mgv1a004315mg                385   3e-128   Erythranthe guttata [common monkey flower]
ref|XP_004341200.1|  polyubiquitin, putative                            377   3e-128   Acanthamoeba castellanii str. Neff
emb|CAA40324.1|  hexaubiquitin protein                                  385   3e-128   Helianthus annuus
ref|XP_010423744.1|  PREDICTED: polyubiquitin                           385   3e-128   Camelina sativa [gold-of-pleasure]
ref|XP_002888365.1|  polyubiquitin                                      385   3e-128   Arabidopsis lyrata subsp. lyrata
ref|NP_001045980.1|  Os02g0161900                                       385   3e-128   
dbj|BAK02501.1|  predicted protein                                      385   3e-128   
dbj|BAJ91912.1|  predicted protein                                      385   3e-128   
gb|AGT38457.1|  polyubiquitin                                           386   3e-128   
ref|XP_006428817.1|  hypothetical protein CICLE_v10011684mg             385   3e-128   
emb|CAA52290.1|  polyubiquitin                                          383   3e-128   
ref|XP_003542728.1|  PREDICTED: polyubiquitin-A-like isoform 1          388   3e-128   
ref|XP_003627151.1|  Ubiquitin                                          388   3e-128   
gb|KIY97628.1|  ubiquitin C                                             380   3e-128   
dbj|GAA27344.2|  polyubiquitin-A                                        379   3e-128   
gb|AFW70219.1|  polyubiquitin-like protein                              387   3e-128   
ref|XP_011094250.1|  PREDICTED: polyubiquitin-like                      385   4e-128   
gb|ACN40936.1|  unknown                                                 385   4e-128   
ref|XP_011094650.1|  PREDICTED: polyubiquitin                           385   4e-128   
ref|XP_008350368.1|  PREDICTED: polyubiquitin                           385   4e-128   
gb|AAC16012.1|  polyubiquitin                                           385   4e-128   
gb|AAN31845.1|  putative polyubiquitin (UBQ10)                          385   4e-128   
gb|AAL91103.1|  ubiquitin                                               378   4e-128   
gb|AFK47245.1|  unknown                                                 377   4e-128   
dbj|GAK65396.1|  ubiquitin                                              380   4e-128   
ref|XP_009618235.1|  PREDICTED: polyubiquitin-like isoform X1           388   4e-128   
ref|XP_002888394.1|  hexaubiquitin protein                              386   4e-128   
ref|XP_002551324.1|  ubiquitin                                          379   4e-128   
ref|XP_001210780.1|  ubiquitin                                          379   4e-128   
gb|AAV65292.1|  polyubiquitin                                           379   5e-128   
gb|EJW80596.1|  polyubiquitin                                           375   5e-128   
gb|EGO00841.1|  hypothetical protein SERLA73DRAFT_121253                382   5e-128   
gb|AIS40894.1|  polyubiquitin                                           385   5e-128   
gb|KIW56414.1|  polyubiquitin                                           379   6e-128   
ref|XP_005831810.1|  ubiquitin                                          376   6e-128   
ref|XP_659604.1|  hypothetical protein AN2000.2                         380   6e-128   
gb|KII92029.1|  hypothetical protein PLICRDRAFT_172184                  382   6e-128   
gb|KEZ40313.1|  Polyubiquitin                                           379   6e-128   
ref|XP_001227036.1|  polyubiquitin                                      379   6e-128   
ref|XP_002839703.1|  hypothetical protein                               379   6e-128   
dbj|BAP70433.1|  Ubiquitin                                              379   6e-128   
sp|P23324.2|UBIQP_EUPEU  RecName: Full=Polyubiquitin; Contains: R...    376   6e-128   
ref|XP_002494205.1|  Ubiquitin                                          379   6e-128   
ref|XP_003350608.1|  hypothetical protein SMAC_07925                    376   6e-128   
gb|KDR10312.1|  Ubiquitin                                               376   7e-128   
gb|AGM32487.1|  polyubiquitin-B-like isoform 1                          376   7e-128   
gb|EUC59758.1|  polyubiquitin                                           382   7e-128   
ref|XP_001266981.1|  polyubiquitin (UbiD), putative                     379   7e-128   
gb|KDR85168.1|  hypothetical protein GALMADRAFT_131895                  382   7e-128   
gb|KIM48035.1|  hypothetical protein M413DRAFT_16078                    382   7e-128   
ref|XP_003607669.1|  Multidrug resistance protein ABC transporter...    384   7e-128   
gb|EZF98642.1|  polyubiquitin                                           376   7e-128   
ref|XP_010756991.1|  polyubiquitin                                      379   7e-128   
ref|XP_001880135.1|  ubiquitin                                          382   7e-128   
emb|CCG34086.1|  Polyubiquitin                                          379   7e-128   
ref|XP_003196661.1|  ATP-dependent protein binding protein              382   7e-128   
gb|EEH07231.1|  ubiquitin                                               379   7e-128   
gb|ETN78467.1|  ubiquitin family protein                                376   7e-128   
ref|XP_007316637.1|  hypothetical protein SERLADRAFT_368035             382   8e-128   
ref|XP_003402310.1|  PREDICTED: polyubiquitin-B-like isoform 1          376   8e-128   
gb|KIK17147.1|  hypothetical protein PISMIDRAFT_685607                  382   8e-128   
gb|AFR98116.1|  polyubiquitin                                           382   8e-128   
gb|EJU00136.1|  ubiquitin                                               382   8e-128   
ref|XP_002976481.1|  hypothetical protein SELMODRAFT_271198             382   8e-128   
dbj|GAA55031.1|  ubiquitin C                                            376   8e-128   
gb|KIJ68260.1|  hypothetical protein HYDPIDRAFT_173033                  382   8e-128   
gb|KDQ30621.1|  hypothetical protein PLEOSDRAFT_1088454                 382   8e-128   
gb|EKV13151.1|  hypothetical protein PDIG_39650                         379   8e-128   
gb|AAO43309.1|  putative polyubiquitin                                  377   9e-128   
gb|EEQ88150.1|  ubiquitin                                               379   9e-128   
gb|EYC42800.1|  hypothetical protein Y032_0517g2809                     376   9e-128   
gb|AEZ66647.1|  putative beta-1,6-glucanase                             381   9e-128   
gb|EEH20847.2|  polyubiquitin                                           379   9e-128   
pir||PS0380  ubiquitin precursor - rice (fragment)                      374   9e-128
dbj|BAL61084.1|  polyubiqutin                                           381   9e-128   
ref|XP_003607670.1|  Ubiquitin                                          387   9e-128   
ref|XP_003608276.1|  Ubiquitin                                          387   9e-128   
ref|XP_006694532.1|  hypothetical protein CTHT_0041260                  379   1e-127   
ref|XP_008816966.1|  polyubiquitin                                      379   1e-127   
gb|KIM40192.1|  hypothetical protein M413DRAFT_73842                    381   1e-127   
gb|KHJ77263.1|  ubiquitin family protein                                374   1e-127   
gb|ACX46987.1|  ubiquitin                                               384   1e-127   
ref|XP_010046742.1|  PREDICTED: polyubiquitin-like                      384   1e-127   
ref|XP_002992907.1|  hypothetical protein SELMODRAFT_162680             381   1e-127   
gb|EYU38681.1|  hypothetical protein MIMGU_mgv1a004304mg                387   1e-127   
ref|XP_011302492.1|  PREDICTED: polyubiquitin-B                         378   1e-127   
sp|P0CH27.1|RL402_TRYCR  RecName: Full=Ubiquitin-60S ribosomal pr...    380   1e-127   
gb|EGE85556.1|  hypothetical protein BDDG_08501                         379   1e-127   
tpe|CBF85986.1|  TPA: Polyubiquitin Fragment [Source:UniProtKB/Tr...    378   1e-127   
tpd|FAA00317.1|  TPA: polyubiquitin                                     378   1e-127   
gb|ABD32351.2|  Ubiquitin                                               386   1e-127   
ref|XP_010451655.1|  PREDICTED: polyubiquitin 4-like                    386   1e-127   
ref|XP_002791169.1|  ubiquitin                                          378   2e-127   
gb|AAO43306.1|  putative polyubiquitin                                  379   2e-127   
emb|CCO30833.1|  Polyubiquitin                                          382   2e-127   
ref|XP_751791.1|  polyubiquitin UbiD/Ubi4                               378   2e-127   
emb|CDH08450.1|  ubiquitin and ubiquitin-like proteins                  378   2e-127   
gb|AAC67552.1|  polyubiquitin                                           380   2e-127   
gb|EWS74283.1|  polyubiquitin                                           375   2e-127   
ref|XP_001246797.1|  polyubiquitin                                      378   2e-127   
ref|XP_001538486.1|  polyubiquitin                                      377   2e-127   
emb|CCA16073.1|  polyubiquitin putative                                 386   2e-127   
gb|AAC49013.1|  polyubiquitin containing 7 ubiquitin monomers           386   2e-127   
ref|XP_007410937.1|  hypothetical protein MELLADRAFT_87680              386   2e-127   
ref|XP_004505453.1|  PREDICTED: polyubiquitin-A-like                    385   2e-127   
ref|XP_007808982.1|  ubiquitin                                          379   2e-127   
gb|AFW66445.1|  ubiquitin2                                              386   2e-127   
gb|KHN45015.1|  Polyubiquitin-A                                         388   2e-127   
gb|AAO43310.1|  putative polyubiquitin                                  375   2e-127   
emb|CAA51679.1|  ubiquitin                                              385   3e-127   
gb|EYU33611.1|  hypothetical protein MIMGU_mgv1a004315mg                385   3e-127   
ref|XP_004365491.1|  polyubiquitin 5                                    374   3e-127   
dbj|GAA87419.1|  polyubiquitin                                          377   3e-127   
ref|XP_009620669.1|  PREDICTED: polyubiquitin-like                      388   3e-127   
gb|AAA82978.1|  polyubiquitin                                           380   3e-127   
ref|XP_010553005.1|  PREDICTED: polyubiquitin-like                      385   3e-127   
gb|AAL91109.1|  ubiquitin                                               377   3e-127   
ref|XP_004249885.1|  PREDICTED: polyubiquitin-like                      385   3e-127   
ref|XP_008645269.1|  PREDICTED: polyubiquitin                           385   3e-127   
ref|XP_006350990.1|  PREDICTED: polyubiquitin-A-like                    385   3e-127   
ref|XP_002842034.1|  hypothetical protein                               377   3e-127   
ref|XP_002171731.1|  ubiquitin                                          380   3e-127   
ref|XP_005056764.1|  PREDICTED: polyubiquitin-C-like isoform X2         374   3e-127   
ref|XP_009150698.1|  PREDICTED: polyubiquitin                           385   3e-127   
ref|XP_006480550.1|  PREDICTED: polyubiquitin-A-like                    385   3e-127   
gb|ABF66639.1|  ubiquitin                                               377   3e-127   
gb|EYU18101.1|  hypothetical protein MIMGU_mgv1a004289mg                385   3e-127   
ref|XP_006352490.1|  PREDICTED: polyubiquitin-A-like isoform X1         388   3e-127   
gb|EMS60894.1|  Polyubiquitin                                           383   4e-127   
emb|CAA11269.1|  polyubiquitin                                          380   4e-127   
gb|ABV22331.1|  ubiquitin                                               377   4e-127   
gb|ADD24466.1|  Ubiquitin                                               374   4e-127   
gb|AAO43305.1|  putative polyubiquitin                                  378   4e-127   
gb|KJB62482.1|  hypothetical protein B456_009G418900                    380   4e-127   
gb|KIZ01427.1|  ubiquitin C                                             380   5e-127   
gb|AAY33920.2|  polyubiquitin                                           380   5e-127   
gb|EJD76734.1|  polyubiquitin, variant 2                                377   5e-127   
emb|CDI53149.1|  probable Polyubiquitin protein                         377   5e-127   
ref|XP_002267017.1|  PREDICTED: polyubiquitin-like                      385   6e-127   
ref|XP_003290908.1|  ubiquitin                                          374   6e-127   
ref|XP_008034069.1|  ubiquitin 10.1                                     382   6e-127   
ref|XP_011275993.1|  ubiquitin C                                        379   6e-127   
ref|XP_003675939.1|  hypothetical protein NCAS_0C05850                  380   6e-127   
ref|XP_958803.1|  ubiquitin                                             377   6e-127   
ref|XP_002723083.2|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    375   6e-127   
gb|EIE87024.1|  polyubiquitin                                           374   6e-127   
tpd|FAA00316.1|  TPA: polyubiquitin                                     379   6e-127   
emb|CCA40372.1|  Ubiquitin cross-reactive protein                       379   6e-127   
ref|NP_013061.1|  ubiquitin                                             379   7e-127   
ref|NP_983342.1|  ACL062Cp                                              379   7e-127   
ref|XP_004946726.1|  PREDICTED: polyubiquitin-C-like isoform X8         374   7e-127   
ref|XP_007545871.1|  PREDICTED: polyubiquitin-B isoform X2              375   7e-127   
ref|NP_595409.1|  ubiquitin                                             379   7e-127   
gb|ELR08709.1|  polyubiquitin                                           379   7e-127   
gb|AEH41483.1|  ubiquitin                                               376   8e-127   
prf||1101405A  ubiquitin precursor                                      372   8e-127
dbj|BAO38900.1|  ubiquitin                                              379   8e-127   
ref|XP_007307433.1|  polyubiquitin                                      382   8e-127   
ref|XP_007861169.1|  polyubiquitin                                      382   8e-127   
emb|CAN71997.1|  hypothetical protein VITISV_004025                     384   8e-127   
ref|XP_453980.1|  hypothetical protein                                  379   8e-127   
ref|XP_001774326.1|  predicted protein                                  382   9e-127   
tpd|FAA00319.1|  TPA: polyubiquitin                                     382   9e-127   
gb|AAP80689.1|  polyubiquitin                                           374   9e-127   
ref|XP_567862.1|  ATP-dependent protein binding protein                 382   9e-127   
ref|XP_004946727.1|  PREDICTED: polyubiquitin-C-like isoform X9         373   9e-127   
ref|XP_011388891.1|  putative ubiquitin                                 382   9e-127   
ref|XP_002627625.1|  ubiquitin                                          379   9e-127   
ref|XP_002674746.1|  polyubiquitin                                      373   1e-126   
ref|XP_002973843.1|  hypothetical protein SELMODRAFT_173723             382   1e-126   
ref|XP_011152175.1|  PREDICTED: polyubiquitin                           379   1e-126   
ref|XP_003607668.1|  Multidrug resistance protein ABC transporter...    383   1e-126   
gb|EMS24129.1|  ubiquitin C                                             373   1e-126   
gb|AAA31133.1|  poly-ubiquitin precursor                                374   1e-126   
emb|CAI83758.1|  Polyubiqutin 5                                         373   1e-126   
gb|KDQ63803.1|  hypothetical protein JAAARDRAFT_29850                   382   1e-126   
emb|CAA72799.1|  polyubiquitin precursor                                379   1e-126   
ref|XP_003590494.1|  Ubiquitin                                          376   1e-126   
gb|KFY77115.1|  hypothetical protein V499_03430                         379   1e-126   
ref|XP_001018501.1|  Ubiquitin family protein                           372   2e-126   
ref|XP_007057723.1|  PREDICTED: polyubiquitin-C isoform X1              372   2e-126   
emb|CAJ41447.1|  polyubiquitin                                          375   2e-126   
ref|XP_009901570.1|  PREDICTED: polyubiquitin-B isoform X1              372   2e-126   
emb|CAX72421.1|  ubiquitin C                                            372   2e-126   
ref|XP_667472.1|  ubiquitin B                                           372   2e-126   
gb|AAA28997.1|  ubiquitin                                               372   2e-126   
ref|XP_010876509.1|  PREDICTED: polyubiquitin-B                         372   2e-126   
ref|XP_002771956.1|  polyubiquitin, putative                            372   2e-126   
ref|XP_010602597.1|  PREDICTED: polyubiquitin-C                         372   2e-126   
ref|XP_003331105.1|  polyubiquitin-A                                    385   2e-126   
gb|EKC42613.1|  Ubiquitin                                               372   2e-126   
ref|XP_008426285.1|  PREDICTED: polyubiquitin-B isoform X1              373   2e-126   
ref|XP_002099886.1|  GE16472                                            372   2e-126   
ref|XP_626192.1|  polyubiquitin with 3 Ub domains                       372   2e-126   
ref|XP_008003373.1|  PREDICTED: polyubiquitin-C                         372   2e-126   
gb|ACL98140.1|  ubiquitin C variant                                     373   2e-126   
ref|NP_001133175.1|  polyubiquitin                                      372   3e-126   
dbj|BAH71115.1|  ACYPI006410                                            372   3e-126   
gb|KFP25549.1|  Polyubiquitin-B                                         372   3e-126   
ref|XP_010177726.1|  PREDICTED: polyubiquitin-B isoform X5              373   3e-126   
ref|XP_005023176.1|  PREDICTED: polyubiquitin-C isoform X2              372   3e-126   
gb|EJD76736.1|  polyubiquitin, variant 1                                378   3e-126   
ref|XP_001610925.1|  polyubiquitin                                      372   3e-126   
ref|XP_004395987.1|  PREDICTED: polyubiquitin-B-like isoform 1          372   3e-126   
ref|XP_001766873.1|  predicted protein                                  376   3e-126   
ref|XP_008300055.1|  PREDICTED: polyubiquitin-B                         372   3e-126   
gb|AAC84175.1|  ubiquitin                                               372   3e-126   
ref|XP_008924878.1|  PREDICTED: polyubiquitin isoform X5                373   3e-126   
emb|CAJ32646.1|  ubiquitin                                              372   3e-126   
gb|AAX43350.1|  ubiquitin B                                             372   3e-126   
ref|XP_010298600.1|  PREDICTED: polyubiquitin-B isoform X2              372   3e-126   
ref|XP_008243902.1|  PREDICTED: polyubiquitin-like isoform X1           383   3e-126   
ref|XP_002553736.1|  KLTH0E05852p                                       379   3e-126   
ref|XP_010298601.1|  PREDICTED: polyubiquitin-B isoform X3              371   3e-126   
gb|EDM13555.1|  rCG21222, isoform CRA_a                                 374   3e-126   
ref|XP_001616591.1|  polyubiquitin 5                                    377   3e-126   
ref|XP_001761027.1|  predicted protein                                  383   4e-126   
emb|CAA25706.1|  unnamed protein product                                370   4e-126   
gb|AFD53810.1|  ubiquitin                                               373   4e-126   
ref|XP_005650632.1|  hexaubiquitin protein                              380   4e-126   
ref|XP_005056763.1|  PREDICTED: polyubiquitin-C-like isoform X1         374   4e-126   
ref|XP_003843815.1|  hypothetical protein LEMA_P014660.1                378   4e-126   
ref|XP_005620146.1|  PREDICTED: polyubiquitin-B isoform X1              372   4e-126   
ref|XP_010293819.1|  PREDICTED: polyubiquitin-B isoform X15             373   4e-126   
ref|XP_004505084.1|  PREDICTED: polyubiquitin-A-like                    387   4e-126   
ref|XP_006593991.1|  PREDICTED: polyubiquitin 10-like isoform X3        387   4e-126   



>gb|ACJ85643.1| unknown [Medicago truncatula]
Length=229

 Score =   388 bits (997),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  207  TLADYNIQKESTLHLVLRLRGGF  229


 Score =   301 bits (770),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQ+KEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQNKEGIPP  38



>gb|ABH08755.1| ubiquitin [Arabidopsis thaliana]
Length=221

 Score =   387 bits (995),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  19   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  78

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  79   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  138

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  139  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  198

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  199  TLADYNIQKESTLHLVLRLRGGF  221


 Score =   287 bits (734),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = -3

Query  534  TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  355
            TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH
Sbjct  1    TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  60

Query  354  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  175
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  61   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  120

Query  174  GRTLADYNIQKESTLHLVLRLRGGF  100
            GRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  GRTLADYNIQKESTLHLVLRLRGGM  145


 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  53   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  106


 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  129  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  182


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  760  GKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  2    GKTITLEVESSDTIDNVKAKIQDKEGIPP  30



>gb|ABH08753.1| ubiquitin [Arabidopsis thaliana]
Length=219

 Score =   387 bits (994),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  17   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  76

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  77   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  136

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  137  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  196

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  197  TLADYNIQKESTLHLVLRLRGGF  219


 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  60

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  61   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  120

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  121  TLADYNIQKESTLHLVLRLRGGM  143


 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  51   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  104


 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  127  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  180


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  757  KALXXEVESSDTIDNVKAXIQDKEGIPP  674
            K +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    KTITLEVESSDTIDNVKAKIQDKEGIPP  28



>ref|NP_567286.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_849291.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001031585.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_567247.2| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118936.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|XP_002305607.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006370636.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_007157173.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 ref|XP_007211604.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211605.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211608.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008349294.1| PREDICTED: polyubiquitin 11 [Malus domestica]
 ref|XP_010437606.1| PREDICTED: polyubiquitin 11 isoform X1 [Camelina sativa]
 ref|XP_010437607.1| PREDICTED: polyubiquitin 11 isoform X2 [Camelina sativa]
 ref|XP_010491428.1| PREDICTED: polyubiquitin 11 [Camelina sativa]
 sp|P0CH33.1|UBQ11_ARATH RecName: Full=Polyubiquitin 11; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD48980.1|AF162444_12 contains similarity to Pfam family PF00240 - Ubiquitin family; 
score=526.5, E=1.9e-154, N=3 [Arabidopsis thaliana]
 emb|CAA10056.1| polyubiquitin [Vicia faba]
 emb|CAB81047.1| AT4g05050 [Arabidopsis thaliana]
 emb|CAC27335.1| putative polyubiquitin [Picea abies]
 gb|AAK96565.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL06940.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL09770.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAM19968.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAN65052.1| Unknown protein [Arabidopsis thaliana]
 gb|AAV92464.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92465.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92466.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92467.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92468.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92469.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92470.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92471.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92472.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92473.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92474.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92475.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92476.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92477.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92478.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92479.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92480.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92481.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92482.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92483.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92484.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92485.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92486.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92487.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92488.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92489.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92490.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 dbj|BAE98552.1| hypothetical protein [Arabidopsis thaliana]
 gb|EEE86118.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|AEE82244.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82245.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82468.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82469.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82470.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AFP43343.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12803.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12804.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12807.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|AGV54265.1| ubiquitin 11 [Phaseolus vulgaris]
 gb|ERP67205.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESW29167.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 gb|AES82698.2| polyubiquitin 3 [Medicago truncatula]
 gb|AJA29686.1| polyubiquitin Ubi4 [Betula luminifera]
 gb|KJB67136.1| hypothetical protein B456_010G177000 [Gossypium raimondii]
 gb|KJB69250.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69251.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69252.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=229

 Score =   387 bits (995),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  207  TLADYNIQKESTLHLVLRLRGGF  229


 Score =   302 bits (774),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|AAM78180.1| putative polyubiquitin [Gossypium herbaceum]
 gb|AAM78181.1| putative polyubiquitin [Gossypium raimondii]
 gb|AAM78182.1| putative polyubiquitin [Gossypium barbadense]
 gb|AAM78183.1| putative polyubiquitin, partial [Gossypium barbadense]
 gb|AAM78184.1| putative polyubiquitin [Gossypioides kirkii]
Length=204

 Score =   385 bits (990),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  2    KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  61

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  62   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  121

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  122  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  181

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  182  TLADYNIQKESTLHLVLRLRGGF  204


 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/128 (99%), Positives = 127/128 (99%), Gaps = 0/128 (0%)
 Frame = -3

Query  483  VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  304
            VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  1    VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  60

Query  303  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  124
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  123  VLRLRGGF  100
            VLRLRGG 
Sbjct  121  VLRLRGGM  128


 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  36   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  89


 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  112  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  165



>gb|ACZ69386.1| polyubiquitin UBQ14 [Cucumis sativus]
Length=197

 Score =   385 bits (989),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 193/194 (99%), Positives = 193/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  4    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  63

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  64   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  123

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  124  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  183

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGGF
Sbjct  184  ESTLHLVLRLRGGF  197


 Score =   235 bits (599),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  71   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  130

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  131  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  190

Query  348  LRLRGGM  328
            LRLRGG 
Sbjct  191  LRLRGGF  197


 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  29   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  82


 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  105  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  158



>gb|ACJ85618.1| unknown [Medicago truncatula]
Length=229

 Score =   386 bits (992),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG+
Sbjct  207  TLADYNIQKESTLHLVLRLRGGY  229


 Score =   303 bits (775),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_008358804.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like, partial 
[Malus domestica]
Length=260

 Score =   387 bits (994),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 192/194 (99%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  216  ESTLHLVLRLRGGM  229


 Score =   304 bits (779),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   286 bits (733),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/146 (98%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  171

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  172  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  231

Query  321  FVKTLTGKTITLEVESSDTIDNVKAK  244
            FVKT TGKTITLE ESSDTIDNVKAK
Sbjct  232  FVKTXTGKTITLEXESSDTIDNVKAK  257


 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKA  704
            +QKES L L +R RGGMQ  VKTX GK +  E ESSDTIDNVKA
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTXTGKTITLEXESSDTIDNVKA  256



>gb|AIZ74335.1| polyubiquitin 3, partial [Pinus massoniana]
Length=244

 Score =   386 bits (992),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  16   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  75

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  76   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  135

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  136  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  195

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  196  TLADYNIQKESTLHLVLRLRGGM  218


 Score =   285 bits (730),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 142/153 (93%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  92   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  151

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  152  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  211

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  250
            LRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  212  LRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  244


 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/142 (99%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = -3

Query  525  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  346
            TITLE+ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
Sbjct  1    TITLELESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  60

Query  345  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  166
            RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  61   RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  120

Query  165  LADYNIQKESTLHLVLRLRGGF  100
            LADYNIQKESTLHLVLRLRGG 
Sbjct  121  LADYNIQKESTLHLVLRLRGGM  142


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  50   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  103


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  126  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  179


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVK  707
            +QKES L L +R RGGMQ  VKT  GK +  EVE+SDTIDNVK
Sbjct  202  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  244



>ref|XP_003626479.1| Ubiquitin-like protein [Medicago truncatula]
 gb|AES82697.1| polyubiquitin 3 [Medicago truncatula]
Length=277

 Score =   387 bits (995),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 193/194 (99%), Positives = 193/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  84   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  143

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  144  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  203

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  204  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  263

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGGF
Sbjct  264  ESTLHLVLRLRGGF  277


 Score =   303 bits (775),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/158 (97%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  567  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  388
            R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  46   RIKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  105

Query  387  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  208
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  106  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  165

Query  207  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*I  94
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  I
Sbjct  166  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  203


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  109  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  162


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  185  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  238


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  796  RGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            R  MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  46   RIKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  86



>gb|AFK43392.1| unknown [Medicago truncatula]
Length=233

 Score =   385 bits (990),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  711  SRPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  532
            ++ + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  26   AKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  531  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  352
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  351  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  172
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  171  RTLADYNIQKESTLHLVLRLRGG  103
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  206  RTLADYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (771),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDN KA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNAKAKIQDKEGIPP  38



>ref|XP_010931017.1| PREDICTED: polyubiquitin 11 isoform X1 [Elaeis guineensis]
 ref|XP_010931026.1| PREDICTED: polyubiquitin 11 isoform X2 [Elaeis guineensis]
 ref|XP_010923942.1| PREDICTED: polyubiquitin 11 [Elaeis guineensis]
Length=229

 Score =   385 bits (990),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (776),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|AAM64530.1| ubiquitin homolog [Arabidopsis thaliana]
Length=229

 Score =   385 bits (989),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL LRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLXLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  207  TLADYNIQKESTLHLVLRLRGGF  229


 Score =   300 bits (768),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLXLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +  RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLXLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_010490793.1| PREDICTED: polyubiquitin 11-like [Camelina sativa]
Length=230

 Score =   385 bits (989),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  207  TLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|EEC81189.1| hypothetical protein OsI_24195 [Oryza sativa Indica Group]
Length=223

 Score =   385 bits (989),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  21   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  80

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  81   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  140

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  141  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  200

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  201  TLADYNIQKESTLHLVLRLRGG  222


 Score =   276 bits (707),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  519  TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  340
            T EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL
Sbjct  8    TCEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  67

Query  339  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  160
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  68   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  127

Query  159  DYNIQKESTLHLVLRLRGGF  100
            DYNIQKESTLHLVLRLRGG 
Sbjct  128  DYNIQKESTLHLVLRLRGGM  147


 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  55   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  108


 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  131  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  184



>ref|XP_009114489.1| PREDICTED: polyubiquitin-like [Brassica rapa]
Length=305

 Score =   388 bits (997),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  283  TLADYNIQKESTLHLVLRLRGGF  305


 Score =   382 bits (981),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  P DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIP  677
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  37



>gb|AAF31707.1|AF221858_1 polyubiquitin [Euphorbia esula]
Length=215

 Score =   385 bits (988),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  13   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  72

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  73   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  132

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  133  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  192

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  193  TLADYNIQKESTLHLVLRLRGG  214


 Score =   276 bits (707),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -3

Query  516  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  337
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  1    LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  60

Query  336  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  157
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  61   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  120

Query  156  YNIQKESTLHLVLRLRGGF*I  94
            YNIQKESTLHLVLRLRGG  I
Sbjct  121  YNIQKESTLHLVLRLRGGMQI  141


 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  47   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  100


 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  123  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  176



>gb|ABH08754.1| ubiquitin [Arabidopsis thaliana]
Length=220

 Score =   385 bits (988),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  17   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  76

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  77   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  136

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  137  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  196

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  197  TLADYNIQKESTLHLVLRLRGG  218


 Score =   283 bits (725),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  60

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  61   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  120

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  121  TLADYNIQKESTLHLVLRLRGGM  143


 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  51   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  104


 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  127  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  180


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  757  KALXXEVESSDTIDNVKAXIQDKEGIPP  674
            K +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    KTITLEVESSDTIDNVKAKIQDKEGIPP  28



>ref|XP_003570150.1| PREDICTED: polyubiquitin 11 isoform X2 [Brachypodium distachyon]
Length=241

 Score =   385 bits (990),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 194/210 (92%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF*IP*CPN  79
            TLADYNIQKESTLHLVLRLRGG  +  C N
Sbjct  207  TLADYNIQKESTLHLVLRLRGGALMQWCLN  236


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|AAB36546.1| polyubiquitin [Phaseolus vulgaris]
Length=215

 Score =   385 bits (988),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  13   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  72

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  73   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  132

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  133  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  192

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  193  TLADYNIQKESTLHLVLRLRGGL  215


 Score =   276 bits (706),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 138/139 (99%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -3

Query  516  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  337
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  1    LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  60

Query  336  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  157
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  61   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  120

Query  156  YNIQKESTLHLVLRLRGGF  100
            YNIQKESTLHLVLRLRGG 
Sbjct  121  YNIQKESTLHLVLRLRGGM  139


 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  47   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  100


 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  123  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  176



>dbj|BAC57955.1| polyubiquitin [Aster tripolium]
Length=229

 Score =   385 bits (989),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGL  229


 Score =   303 bits (775),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_002317213.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ABK95814.1| unknown [Populus trichocarpa]
 gb|EEE97825.1| polyubiquitin family protein [Populus trichocarpa]
Length=229

 Score =   385 bits (989),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGI  229


 Score =   303 bits (775),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|AFY06654.1| polyubiquitin, partial [Carica papaya]
Length=264

 Score =   386 bits (992),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  62   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  121

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  122  KTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  181

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  182  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  241

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  242  TLADYNIQKESTLHLVLRLRGGF  264


 Score =   321 bits (823),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 173/177 (98%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  630  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  451
            G TLADYNIQKESTL LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  12   GGTLADYNIQKESTLLLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  71

Query  450  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  271
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS
Sbjct  72   PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  131

Query  270  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  132  DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  188


 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  172  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  225


 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK  IQDKEGIPP
Sbjct  96   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  149


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -2

Query  868  VXGXGXPXXLXLQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDK  689
            +   G      +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDK
Sbjct  9    ITAGGTLADYNIQKESTLLLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  68

Query  688  EGIPP  674
            EGIPP
Sbjct  69   EGIPP  73



>gb|EYU33610.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=229

 Score =   385 bits (989),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  207  TLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   236 bits (602),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGM  328
            LRLRGG+
Sbjct  223  LRLRGGV  229


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|AET06143.1| ubiquitin [Papaver somniferum]
Length=229

 Score =   385 bits (988),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  207  TLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>emb|CAH59739.1| polyubiquitin [Plantago major]
Length=232

 Score =   385 bits (989),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGL  229


 Score =   303 bits (775),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIF  319
            LRLRGG+  F
Sbjct  223  LRLRGGLTGF  232


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_006370634.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67203.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
Length=261

 Score =   386 bits (992),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (777),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   283 bits (724),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDN  256
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDN
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDN  253


 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDN  713
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDN
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  253



>ref|XP_006288299.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21197.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=230

 Score =   385 bits (988),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  207  TLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>emb|CAA48140.1| ubiquitin [Antirrhinum majus]
Length=296

 Score =   387 bits (995),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  94   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  153

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  154  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  213

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  214  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  273

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  274  TLADYNIQKESTLHLVLRLRGGF  296


 Score =   385 bits (988),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  18   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  77

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  78   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  137

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  138  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  197

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  198  TLADYNIQKESTLHLVLRLRGGM  220


 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = -3

Query  531  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  352
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  351  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  172
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  171  RTLADYNIQKESTLHLVLRLRGGF  100
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGM  144


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  52   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  105


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  128  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  181


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  204  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  257


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  760  GKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPP  29



>gb|KJB62484.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=229

 Score =   385 bits (988),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/193 (99%), Positives = 192/193 (99%), Gaps = 0/193 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGG  103
            ESTLHLVLRLRGG
Sbjct  216  ESTLHLVLRLRGG  228


 Score =   301 bits (772),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38



>gb|ABK94002.1| unknown [Populus trichocarpa]
Length=305

 Score =   388 bits (996),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  283  TLADYNIQKESTLHLVLRLRGGF  305


 Score =   381 bits (979),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLAD NIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   299 bits (765),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_004968120.1| PREDICTED: polyubiquitin-like [Setaria italica]
 ref|XP_009404996.1| PREDICTED: polyubiquitin 11 [Musa acuminata subsp. malaccensis]
 gb|ABS18744.1| ubiqutin ligase-like protein [Oryza sativa Japonica Group]
 dbj|BAJ88219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score =   385 bits (988),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  207  TLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|KJB36627.1| hypothetical protein B456_006G167800 [Gossypium raimondii]
Length=229

 Score =   385 bits (988),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  207  TLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|NP_849292.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118922.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_974516.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002316978.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_002874829.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_004146845.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004165599.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004293260.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_006383941.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006377831.1| polyubiquitin family protein [Populus trichocarpa]
 ref|XP_006377832.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377833.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372945.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 ref|XP_006396614.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396615.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006589609.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_006593990.1| PREDICTED: polyubiquitin 10-like isoform X2 [Glycine max]
 ref|XP_006606032.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_007211603.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008454542.1| PREDICTED: polyubiquitin [Cucumis melo]
 ref|XP_009134330.1| PREDICTED: polyubiquitin [Brassica rapa]
 ref|XP_010422419.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_011007895.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011010177.1| PREDICTED: polyubiquitin [Populus euphratica]
 sp|P69325.2|UBIQP_SOYBN RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Glycine max]
 sp|Q3E7T8.2|UBQ14_ARATH RecName: Full=Polyubiquitin 14; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 pir||S49332 polyubiquitin 4 - common sunflower
 pir||G85036 polyubiquitin [imported] - Arabidopsis thaliana
 dbj|BAA03764.1| ubiquitin [Glycine max]
 dbj|BAA05670.1| ubiquitin [Glycine max]
 emb|CAA84440.1| seed tetraubiquitin [Helianthus annuus]
 dbj|BAA05085.1| Ubiquitin [Glycine max]
 gb|AAD15340.1| putative polyubiquitin [Arabidopsis thaliana]
 emb|CAB77774.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAM65295.1| polyubiquitin (UBQ14) [Arabidopsis thaliana]
 emb|CAH59738.1| polyubiquitin [Plantago major]
 dbj|BAH19554.1| AT4G02890 [Arabidopsis thaliana]
 gb|EEE97590.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|EFH51088.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE82246.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82247.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82503.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AFP43341.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12802.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|ERP50742.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 gb|ERP55628.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP55629.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55630.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP61738.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|ESQ38067.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38068.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 dbj|BAO57270.1| ubiquitin 10 [Ipomoea nil]
 gb|KHN02680.1| Polyubiquitin [Glycine soja]
 gb|KHN15806.1| Polyubiquitin [Glycine soja]
 gb|KJB13594.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB69249.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 prf||2111434A tetraubiquitin
Length=305

 Score =   387 bits (995),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  283  TLADYNIQKESTLHLVLRLRGGF  305


 Score =   385 bits (989),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (775),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|AAP31578.1| ubiquitin [Hevea brasiliensis]
Length=230

 Score =   385 bits (988),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  207  TLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_010453358.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   387 bits (995),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  283  TLADYNIQKESTLHLVLRLRGGF  305


 Score =   384 bits (986),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVES+DTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPP  114


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|ABD96088.1| polyubiquitin [Malus domestica]
Length=270

 Score =   386 bits (992),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  68   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  127

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  128  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  187

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  188  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  247

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  248  TLADYNIQKESTLHLVLRLRGGF  270


 Score =   384 bits (985),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/194 (99%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  60

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  181  ESTLHLVLRLRGGM  194


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  26   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  79


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  102  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  155


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  178  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  231



>gb|AFK41706.1| unknown [Medicago truncatula]
 gb|AES60745.2| pentameric polyubiquitin [Medicago truncatula]
Length=233

 Score =   385 bits (988),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  207  TLADYNIQKESTLHLVLRLRGG  228


 Score =   302 bits (774),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|KJB81823.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=305

 Score =   387 bits (995),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  283  TLADYNIQKESTLHLVLRLRGGF  305


 Score =   385 bits (988),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 192/194 (99%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  216  ESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVK  IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  38



>ref|XP_006428779.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 ref|XP_006594132.1| PREDICTED: polyubiquitin-like [Glycine max]
 gb|ESR42019.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 gb|KDO45140.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KDO45141.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KHN48309.1| Polyubiquitin [Glycine soja]
Length=230

 Score =   384 bits (987),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  207  TLADYNIQKESTLHLVLRLRGG  228


 Score =   302 bits (774),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|KDO51109.1| hypothetical protein CISIN_1g026973mg [Citrus sinensis]
Length=230

 Score =   384 bits (987),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  207  TLADYNIQKESTLHLVLRLRGG  228


 Score =   302 bits (774),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|KDO51955.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
 gb|KDO51956.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
Length=230

 Score =   384 bits (987),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  207  TLADYNIQKESTLHLVLRLRGG  228


 Score =   302 bits (774),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_002872746.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002872769.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49005.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49028.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   384 bits (987),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  207  TLADYNIQKESTLHLVLRLRGGF  229


 Score =   303 bits (776),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIP  677
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_010235843.1| PREDICTED: polyubiquitin 11 isoform X1 [Brachypodium distachyon]
Length=265

 Score =   385 bits (990),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 194/210 (92%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  51   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  110

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  111  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  170

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  171  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  230

Query  168  TLADYNIQKESTLHLVLRLRGGF*IP*CPN  79
            TLADYNIQKESTLHLVLRLRGG  +  C N
Sbjct  231  TLADYNIQKESTLHLVLRLRGGALMQWCLN  260


 Score =   304 bits (778),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 154/159 (97%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -3

Query  576  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  397
            L  R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  19   LECRKMMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  78

Query  396  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  217
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  79   TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  138

Query  216  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  139  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  177


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  85   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  138


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  161  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  214


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -2

Query  805  VRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +  R  MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  19   LECRKMMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  62



>gb|EPS72031.1| polyubiquitin, partial [Genlisea aurea]
Length=274

 Score =   386 bits (991),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  72   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  131

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  132  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  191

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  192  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  251

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  252  TLADYNIQKESTLHLVLRLRGGF  274


 Score =   383 bits (984),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 192/194 (99%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  5    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  64

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  65   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  124

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  125  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  184

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  185  ESTLHLVLRLRGGM  198


 Score =   244 bits (623),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/122 (99%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -3

Query  465  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  286
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  1    DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  60

Query  285  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  106
            EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  61   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  120

Query  105  GF  100
            G 
Sbjct  121  GM  122


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  30   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  83


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  106  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  159


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  182  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  235



>gb|AEZ49160.1| polyubiquitin, partial [Wolffia australiana]
Length=281

 Score =   386 bits (992),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 192/194 (99%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  56   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  115

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  116  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  175

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  176  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  235

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  236  ESTLHLVLRLRGGM  249


 Score =   307 bits (786),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 154/158 (97%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = -3

Query  573  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  394
            RL+  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  16   RLQSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  75

Query  393  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  214
            LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD
Sbjct  76   LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  135

Query  213  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  136  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173


 Score =   295 bits (756),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  132  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  191

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  192  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  251

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDK  232
            FVKTLTGKTITLEV SSDTIDNVKAKIQDK
Sbjct  252  FVKTLTGKTITLEVASSDTIDNVKAKIQDK  281


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  134


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  210


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDK  689
            +QKES L L +R RGGMQ  VKT  GK +  EV SSDTIDNVKA IQDK
Sbjct  233  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVASSDTIDNVKAKIQDK  281


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -2

Query  802  RXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            R +  MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  16   RLQSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  58



>gb|AAO43307.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   385 bits (988),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  47   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  106

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  107  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  166

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  167  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  226

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  227  TLADYNIQKESTLHLVLRLRGG  248


 Score =   343 bits (881),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = -3

Query  618  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  439
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  438  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  259
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  258  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  5    IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  58


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  134


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  210



>gb|AGV54749.1| ubiquitin 11 [Phaseolus vulgaris]
Length=269

 Score =   385 bits (990),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  67   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  126

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  127  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  186

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  187  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  246

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  247  TLADYNIQKESTLHLVLRLRGGF  269


 Score =   301 bits (772),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  41   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  100

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  101  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  160

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*I  94
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  I
Sbjct  161  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  195


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  101  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  154


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  177  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  230


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  41   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  78



>emb|CBY46745.1| polyubiquitin 10 protein, partial [Lepidium appelianum]
Length=308

 Score =   387 bits (994),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  106  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  165

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  166  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  225

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  226  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  285

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  286  TLADYNIQKESTLHLVLRLRGGF  308


 Score =   384 bits (987),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  30   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  89

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  90   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  149

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  150  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  209

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  210  TLADYNIQKESTLHLVLRLRGGM  232


 Score =   309 bits (791),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = -3

Query  567  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  388
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  387  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  208
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  61   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  120

Query  207  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  156


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  64   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  117


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  140  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  193


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  216  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  269


 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  796  RGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  41



>gb|AAC35858.1| polyubiquitin [Capsicum chinense]
Length=265

 Score =   385 bits (990),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  63   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  122

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  123  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  182

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  183  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGR  242

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  243  TLADYNIQKESTLHLVLRLRGGF  265


 Score =   374 bits (960),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 188/189 (99%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  666  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  487
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  60

Query  486  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  307
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL
Sbjct  61   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  120

Query  306  TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  127
            TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH
Sbjct  121  TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  180

Query  126  LVLRLRGGF  100
            LVLRLRGG 
Sbjct  181  LVLRLRGGM  189


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  21   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  74


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  97   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  150


 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK  IQDKEGIPP
Sbjct  173  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  226



>ref|XP_003627152.1| Ubiquitin [Medicago truncatula]
 gb|KEH18411.1| polyubiquitin 3 [Medicago truncatula]
Length=270

 Score =   385 bits (990),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (776),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   301 bits (771),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 163/203 (80%), Gaps = 35/203 (17%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTIT                                   LEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTIT-----------------------------------LEDGR  247

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  248  TLADYNIQKESTLHLVLRLRGGF  270


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_002872805.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49064.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   387 bits (993),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 192/194 (99%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  216  ESTLHLVLRLRGGM  229


 Score =   304 bits (778),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   298 bits (762),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 149/151 (99%), Positives = 150/151 (99%), Gaps = 0/151 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  171

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  172  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  231

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKE  229
            FVKTLTGKTITLEVESSDTIDNVKAKIQDK+
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKK  262


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKE  686
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDK+
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKK  262


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|AES89866.2| polyubiquitin 3 [Medicago truncatula]
Length=305

 Score =   386 bits (992),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG+
Sbjct  283  TLADYNIQKESTLHLVLRLRGGY  305


 Score =   385 bits (989),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (775),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_002438839.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
 gb|EER90206.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
Length=229

 Score =   383 bits (984),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQK+STLHLVLRLRGG
Sbjct  207  TLADYNIQKDSTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_006377830.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55627.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
Length=297

 Score =   386 bits (991),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   362 bits (929),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKES  136
            TLADYNIQKE+
Sbjct  283  TLADYNIQKEN  293


 Score =   303 bits (776),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|ABY60454.1| putative polyubiquitin [Adonis aestivalis var. palaestina]
Length=281

 Score =   385 bits (989),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  38   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  97

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  98   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  157

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  158  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  217

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  218  TLADYNIQKESTLHLVLRLRGGM  240


 Score =   325 bits (832),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 163/164 (99%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  591  TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  412
            TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ
Sbjct  1    TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  60

Query  411  LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  232
            LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK
Sbjct  61   LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  120

Query  231  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  164


 Score =   317 bits (812),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 158/168 (94%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  114  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  173

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  174  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  233

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  205
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  234  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  281


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  72   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  125


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  148  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  201


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  224  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  277


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  817  LXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  2    LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  49



>emb|CBI22349.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   386 bits (991),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  54   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  113

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  114  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  173

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  174  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  233

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  234  TLADYNIQKESTLHLVLRLRGGM  256


 Score =   303 bits (776),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  28   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  87

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  88   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  147

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  148  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  180


 Score =   302 bits (773),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  130  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  189

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  190  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  249

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  223
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG+
Sbjct  250  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGM  291


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  88   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  141


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  164  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  217


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGI  680
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEG+
Sbjct  240  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGM  291


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  28   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  65



>emb|CAA40323.1| polyubiquitin protein [Helianthus annuus]
Length=334

 Score =   387 bits (994),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   387 bits (994),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   304 bits (779),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   292 bits (748),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/156 (94%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  241
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  334


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXI  698
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA I
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  334


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_008784557.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like [Phoenix 
dactylifera]
Length=229

 Score =   383 bits (984),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV RLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVXRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  207  TLADYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVXRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L  R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVXRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_006428822.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
 ref|XP_006480632.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 ref|XP_006480634.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 gb|ESR42062.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
Length=230

 Score =   383 bits (983),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGG  103
             LADYNIQKESTLHLVLRLRGG
Sbjct  207  NLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_007154495.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26489.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=269

 Score =   384 bits (987),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   314 bits (804),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 156/167 (93%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  208
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  269


 Score =   303 bits (776),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVE+SDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPP  190


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_007512209.1| polyubiquitin [Bathycoccus prasinos]
 emb|CCO66297.1| polyubiquitin [Bathycoccus prasinos]
Length=359

 Score =   388 bits (996),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 193/196 (98%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  87   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  146

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  147  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  206

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  207  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  266

Query  141  ESTLHLVLRLRGGF*I  94
            ESTLHLVLRLRGG  I
Sbjct  267  ESTLHLVLRLRGGMQI  282


 Score =   387 bits (995),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/193 (99%), Positives = 192/193 (99%), Gaps = 0/193 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  163  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  222

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  223  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  282

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  283  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  342

Query  141  ESTLHLVLRLRGG  103
            ESTLHLVLRLRGG
Sbjct  343  ESTLHLVLRLRGG  355


 Score =   281 bits (719),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 153/206 (74%), Gaps = 51/206 (25%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG-------------------------  454
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG                         
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTFRVKSRRLKFCLLALLDSATTIES  60

Query  453  --------------------------IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  352
                                      IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   SLALRSKKSSERREREKESALSRARGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  351  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  172
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  121  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  180

Query  171  RTLADYNIQKESTLHLVLRLRGGF*I  94
            RTLADYNIQKESTLHLVLRLRGG  I
Sbjct  181  RTLADYNIQKESTLHLVLRLRGGMQI  206


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  112  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  165


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  188  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  241


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  264  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  317


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEG  683
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEG
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  35



>ref|XP_007211606.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12805.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
Length=309

 Score =   386 bits (991),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   383 bits (984),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/201 (95%), Positives = 196/201 (98%), Gaps = 0/201 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRG  106
            TLADYNIQKESTLHLVLRLRG
Sbjct  283  TLADYNIQKESTLHLVLRLRG  303


 Score =   303 bits (776),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_010492041.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   385 bits (990),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAG QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGTQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  283  TLADYNIQKESTLHLVLRLRGGF  305


 Score =   383 bits (984),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG QLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGTQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAG QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGTQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_010452435.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   385 bits (990),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/194 (99%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQR IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  112  IPPDQQRFIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  171

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  172  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  231

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGGF
Sbjct  292  ESTLHLVLRLRGGF  305


 Score =   382 bits (980),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 190/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQD+EGIPPDQQR IFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (767),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR I
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQD+EGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPP  114


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|AES89865.2| polyubiquitin 3 [Medicago truncatula]
Length=278

 Score =   384 bits (987),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   302 bits (773),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLE  283
            LRLRGGMQIFVKTLTGKTITLE
Sbjct  223  LRLRGGMQIFVKTLTGKTITLE  244


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_008796945.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Phoenix dactylifera]
Length=309

 Score =   385 bits (990),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   384 bits (986),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVES DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVES DTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPP  114


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>sp|P0CG84.1|UBI4P_NICSY RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor, partial [Nicotiana sylvestris]
 gb|AAA34124.1| pentameric polyubiquitin, partial [Nicotiana sylvestris]
Length=377

 Score =   388 bits (997),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  175  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  234

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  235  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  294

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  295  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  354

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  355  TLADYNIQKESTLHLVLRLRGGF  377


 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  23   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  82

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  83   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  142

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  143  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  202

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  203  TLADYNIQKESTLHLVLRLRGGM  225


 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  99   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  158

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  159  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  218

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  219  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  278

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  279  TLADYNIQKESTLHLVLRLRGGM  301


 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = -3

Query  546  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  367
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  1    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  60

Query  366  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  187
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  61   STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  120

Query  186  QLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  QLEDGRTLADYNIQKESTLHLVLRLRGGM  149


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  57   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  110


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  133  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  186


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  209  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  262


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  285  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  338


 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -2

Query  775  VKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  34



>ref|XP_009112898.1| PREDICTED: polyubiquitin [Brassica rapa]
Length=305

 Score =   385 bits (990),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGI  305


 Score =   303 bits (776),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|EYU33609.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
 gb|EYU33612.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=305

 Score =   385 bits (990),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGM  328
            LRLRGG+
Sbjct  299  LRLRGGV  305


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_007014924.1| Polyubiquitin 3 [Theobroma cacao]
 gb|EOY32543.1| Polyubiquitin 3 [Theobroma cacao]
Length=305

 Score =   385 bits (990),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_011468094.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
Length=306

 Score =   385 bits (990),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (774),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDT+DNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPP  38



>gb|AAQ84316.1| fiber polyubiquitin [Gossypium barbadense]
Length=229

 Score =   382 bits (982),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/194 (99%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGGF  100
            ESTL LVLRLRGGF
Sbjct  216  ESTLPLVLRLRGGF  229


 Score =   300 bits (769),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVK  IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  38



>emb|CAH59740.1| polyubiquitin [Plantago major]
Length=305

 Score =   385 bits (989),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_010258950.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
Length=306

 Score =   385 bits (990),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGI  305


 Score =   303 bits (775),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_006396611.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 gb|AAL27563.1|AF429429_1 polyubiquitin OUB1 [Olea europaea]
 gb|ESQ38064.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=305

 Score =   385 bits (989),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGL  305


 Score =   385 bits (989),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (775),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_006685644.1| ubiquitin [Candida tenuis ATCC 10573]
 gb|EGV64838.1| ubiquitin [Candida tenuis ATCC 10573]
Length=229

 Score =   382 bits (982),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 190/193 (98%), Positives = 192/193 (99%), Gaps = 0/193 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGG  103
            ESTLHLVLRLRGG
Sbjct  216  ESTLHLVLRLRGG  228


 Score =   300 bits (769),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  114


 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  190


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38



>gb|KDP39203.1| hypothetical protein JCGZ_00960 [Jatropha curcas]
Length=317

 Score =   385 bits (990),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (990),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (776),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIF  319
            LRLRGGMQI 
Sbjct  299  LRLRGGMQIL  308


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>emb|CAC94926.1| putative ubiquitin [Pleurotus sp. 'Florida']
Length=243

 Score =   383 bits (983),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  17   IPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  76

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQI
Sbjct  77   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQI  136

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  137  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  196

Query  141  ESTLHLVLRLRGGF*I  94
            ESTLHLVLRLRGG  I
Sbjct  197  ESTLHLVLRLRGGMQI  212


 Score =   287 bits (734),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/146 (97%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  93   IPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  152

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQI
Sbjct  153  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQI  212

Query  321  FVKTLTGKTITLEVESSDTIDNVKAK  244
            FVKTLTGKTITLEVESSDTIDNVKA+
Sbjct  213  FVKTLTGKTITLEVESSDTIDNVKAR  238


 Score =   266 bits (681),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = -3

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQI
Sbjct  1    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQI  60

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  61   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  120

Query  141  ESTLHLVLRLRGGF*I  94
            ESTLHLVLRLRGG  I
Sbjct  121  ESTLHLVLRLRGGMQI  136


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  42   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  95


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  118  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  171


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKA  704
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA
Sbjct  194  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  237



>ref|XP_006428821.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
 ref|XP_006480633.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
 gb|ESR42061.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
Length=306

 Score =   385 bits (989),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (988),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_002456845.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 ref|XP_002453347.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 ref|XP_003574869.1| PREDICTED: polyubiquitin [Brachypodium distachyon]
 ref|XP_007695807.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_009412665.1| PREDICTED: polyubiquitin isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412666.1| PREDICTED: polyubiquitin isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_010227192.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 sp|P69309.2|UBIQP_AVEFA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Avena fatua]
 pir||S28426 polyubiquitin 4 - wild oat
 emb|CAA49200.1| tetraubiquitin [Avena fatua]
 gb|AAC37466.1| polyubiquitin [Saccharum hybrid cultivar H65-7052]
 gb|AAM28291.1| tetrameric ubiquitin [Ananas comosus]
 gb|EES01965.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 gb|EES06323.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 gb|AEE65379.1| ubiquitin 1 [Panicum virgatum]
 gb|EMD68114.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD93446.1| hypothetical protein COCHEDRAFT_1202381 [Bipolaris maydis C5]
 gb|EMS58836.1| Polyubiquitin [Triticum urartu]
 gb|ENI07106.1| hypothetical protein COCC4DRAFT_70576 [Bipolaris maydis ATCC 
48331]
 gb|AGT16802.1| polyubiquitin-like protein [Saccharum hybrid cultivar R570]
 gb|EUN28034.1| hypothetical protein COCVIDRAFT_96666 [Bipolaris victoriae FI3]
Length=305

 Score =   385 bits (989),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (988),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>emb|CDP08569.1| unnamed protein product [Coffea canephora]
Length=306

 Score =   385 bits (989),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/194 (99%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  216  ESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGI  305


 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38



>ref|XP_006654612.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
Length=305

 Score =   385 bits (989),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   384 bits (985),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL+DGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLDDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|AAO42469.1| putative polyubiquitin [Arabidopsis lyrata]
Length=289

 Score =   385 bits (988),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  18   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  77

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  78   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  137

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  138  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  197

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  198  TLADYNIQKESTLHLVLRLRGGM  220


 Score =   360 bits (924),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 189/202 (94%), Gaps = 8/202 (4%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  94   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  153

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  154  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  213

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESS+        IQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  214  LRLRGGMQIFVKTLTGKTITLEVESSE--------IQDKEGIPPDQQRLIFAGKQLEDGR  265

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  266  TLADYNIQKESTLHLVLRLRGG  287


 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = -3

Query  531  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  352
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  351  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  172
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  171  RTLADYNIQKESTLHLVLRLRGGF  100
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGM  144


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  52   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  105


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  128  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  181


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 35/54 (65%), Gaps = 8/54 (15%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESS+        IQDKEGIPP
Sbjct  204  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSE--------IQDKEGIPP  249


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  760  GKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPP  29



>sp|P69315.2|UBIQP_LINUS RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Contains: RecName: Full=Ubiquitin-related; Flags: Precursor, 
partial [Linum usitatissimum]
 gb|AAA33401.1| ubiquitin, partial [Linum usitatissimum]
Length=305

 Score =   385 bits (989),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  68   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  127

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  128  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  187

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  188  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  247

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  248  TLADYNIQKESTLHLVLRLRGGM  270


 Score =   384 bits (985),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 191/194 (98%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFLKTLTGKTITLEVES  60

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  181  ESTLHLVLRLRGGM  194


 Score =   303 bits (775),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/162 (94%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  144  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  203

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  204  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  263

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  223
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  264  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  305


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  102  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  155


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  178  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  231


 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  +KT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  26   IQKESTLHLVLRLRGGMQIFLKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  79


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGI  680
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGI
Sbjct  254  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  305



>gb|AAB36545.1| ubiquitin-like protein [Phaseolus vulgaris]
Length=407

 Score =   389 bits (999),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  205  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  264

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  265  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  324

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  325  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  384

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  385  TLADYNIQKESTLHLVLRLRGGF  407


 Score =   386 bits (992),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  129  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  188

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  189  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  248

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  249  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  308

Query  168  TLADYNIQKESTLHLVLRLRGGF*I  94
            TLADYNIQKESTLHLVLRLRGG  I
Sbjct  309  TLADYNIQKESTLHLVLRLRGGMQI  333


 Score =   362 bits (928),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 182/185 (98%), Positives = 182/185 (98%), Gaps = 0/185 (0%)
 Frame = -3

Query  648  GKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  469
             KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
Sbjct  73   AKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  132

Query  468  QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  289
            QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT
Sbjct  133  QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  192

Query  288  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  109
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  193  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  252

Query  108  GGF*I  94
            GG  I
Sbjct  253  GGMQI  257


 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  87   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  140


 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  163  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  216


 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  239  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  292


 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  315  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  368



>dbj|BAJ85978.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   385 bits (989),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/194 (99%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  216  ESTLHLVLRLRGGM  229


 Score =   385 bits (988),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38



>gb|AAL09741.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
Length=381

 Score =   388 bits (996),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  359  TLADYNIQKESTLHLVLRLRGGF  381


 Score =   383 bits (983),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            L LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LSLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   383 bits (983),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL LRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLSLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   300 bits (769),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVL LRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLSLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +  RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|NP_851029.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_568112.2| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_001031824.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|XP_006288303.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
 ref|XP_009122723.1| PREDICTED: polyubiquitin 3 [Brassica rapa]
 sp|Q1EC66.1|UBQ3_ARATH RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB86091.1| polyubiquitin (ubq3) [Arabidopsis thaliana]
 dbj|BAB08384.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAO00780.1| polyubiquitin (UBQ3) [Arabidopsis thaliana]
 gb|ABF85770.1| At5g03240 [Arabidopsis thaliana]
 dbj|BAH19791.1| AT5G03240 [Arabidopsis thaliana]
 gb|AED90574.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90575.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90576.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|EOA21201.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
Length=306

 Score =   385 bits (989),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (988),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_006302387.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35285.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=307

 Score =   385 bits (989),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (988),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|KJB62487.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   385 bits (989),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/193 (99%), Positives = 192/193 (99%), Gaps = 0/193 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  171

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  172  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  231

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  141  ESTLHLVLRLRGG  103
            ESTLHLVLRLRGG
Sbjct  292  ESTLHLVLRLRGG  304


 Score =   384 bits (986),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 191/194 (98%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  216  ESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  114


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38



>emb|CDP05795.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   388 bits (996),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  359  TLADYNIQKESTLHLVLRLRGGF  381


 Score =   385 bits (990),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   384 bits (985),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQ+KEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPP  114


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_006480631.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
Length=306

 Score =   385 bits (989),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (988),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|AAB68045.1| polyubiquitin [Fragaria x ananassa]
Length=381

 Score =   388 bits (996),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  359  TLADYNIQKESTLHLVLRLRGGF  381


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/194 (99%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  171

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  172  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  231

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  292  ESTLHLVLRLRGGM  305


 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA I DKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPP  114


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_006428820.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
 gb|ESR42060.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
Length=306

 Score =   385 bits (989),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (988),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   300 bits (768),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQ KEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQHKEGIPP  38



>ref|XP_007205620.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 ref|XP_007205621.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06819.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06820.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=306

 Score =   385 bits (989),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (988),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_010240921.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=381

 Score =   388 bits (996),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  359  TLADYNIQKESTLHLVLRLRGGF  381


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   385 bits (988),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYN+QKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNVQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   302 bits (774),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            +QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   VQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   VQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>emb|CBY46746.1| polyubiquitin 10 protein, partial [Lepidium campestre]
Length=381

 Score =   388 bits (996),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  359  TLADYNIQKESTLHLVLRLRGGF  381


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   302 bits (774),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDT+DNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPP  38



>prf||1604470A poly-ubiquitin
Length=272

 Score =   384 bits (985),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/194 (99%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  3    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  62

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  63   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  122

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  123  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  182

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  183  ESTLHLVLRLRGGM  196


 Score =   383 bits (984),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  70   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  129

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  130  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  189

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  190  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  249

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  250  TLADYNIQKESTLHLVLRLRGG  271


 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = -3

Query  456  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  277
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE
Sbjct  2    GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  61

Query  276  SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  62   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  120


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  28   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  81


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  104  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  157


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  180  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  233



>ref|XP_003537278.1| PREDICTED: polyubiquitin-like [Glycine max]
 ref|XP_010454744.1| PREDICTED: polyubiquitin 3 [Camelina sativa]
 gb|KHN39094.1| Polyubiquitin [Glycine soja]
Length=306

 Score =   385 bits (988),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (988),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|AFW66439.1| putative ubiquitin family protein [Zea mays]
Length=297

 Score =   385 bits (988),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   363 bits (933),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 184/203 (91%), Positives = 190/203 (94%), Gaps = 8/203 (4%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSD        IQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSD--------IQDKEGIPPDQQRLIFAGKQLEDGR  274

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG+
Sbjct  275  TLADYNIQKESTLHLVLRLRGGY  297


 Score =   302 bits (774),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 35/54 (65%), Gaps = 8/54 (15%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSD        IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD--------IQDKEGIPP  258



>ref|XP_006428925.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
 gb|ESR42165.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
Length=306

 Score =   385 bits (988),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (988),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_009631616.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=381

 Score =   388 bits (996),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  359  TLADYNIQKESTLHLVLRLRGGF  381


 Score =   382 bits (980),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 190/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGCTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDN+KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNIKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (976),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 189/203 (93%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG TLADYNIQKESTLHLV
Sbjct  87   KTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGCTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDN+KAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNIKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDG TLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGCTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDN+KA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNIKAKIQDKEGIPP  190


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVE+SDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPP  114


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|NP_849300.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_567291.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_001078353.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_004134747.1| PREDICTED: polyubiquitin-like isoform 1 [Cucumis sativus]
 ref|XP_004134748.1| PREDICTED: polyubiquitin-like isoform 2 [Cucumis sativus]
 ref|XP_004496773.1| PREDICTED: polyubiquitin-like [Cicer arietinum]
 ref|XP_006360087.1| PREDICTED: polyubiquitin-like isoform X2 [Solanum tuberosum]
 ref|XP_006287939.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 ref|XP_006370633.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370635.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370637.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006380307.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 ref|XP_006377834.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377835.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372946.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_006396616.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396617.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006452184.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 ref|XP_007021032.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021033.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021035.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007025987.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007143204.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 ref|XP_007211430.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 ref|XP_007211607.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008244360.1| PREDICTED: polyubiquitin isoform X2 [Prunus mume]
 ref|XP_009365167.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009358097.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009358098.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343085.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343086.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009611794.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
 ref|XP_009792849.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_009793738.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_010267760.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
 ref|XP_010423137.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010447068.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010455857.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010644407.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_011026350.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011030849.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011048300.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011460984.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_011460993.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 sp|P69322.2|UBIQP_PEA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Pisum sativum]
 emb|CAA34886.1| unnamed protein product [Pisum sativum]
 gb|AAD03344.1| ubiquitin [Pisum sativum]
 gb|AAK96602.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
 dbj|BAD26592.1| polyubiquitin [Populus nigra]
 gb|ABB73307.1| ubiquitin [Lotus japonicus]
 gb|ABK92512.1| unknown [Populus trichocarpa]
 gb|ABK93264.1| unknown [Populus trichocarpa]
 gb|ABK95903.1| unknown [Populus trichocarpa]
 gb|ABK96012.1| unknown [Populus trichocarpa]
 gb|ABK96127.1| unknown [Populus trichocarpa]
 gb|ACK56276.1| ubiquitin [Populus trichocarpa]
 gb|AEE82501.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82504.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82505.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|EMJ12629.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 gb|EMJ12806.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EOA20837.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 gb|EOY12557.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12558.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12560.1| Polyubiquitin 10 [Theobroma cacao]
 gb|EOY28609.1| Polyubiquitin 10 [Theobroma cacao]
 gb|ERP50743.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ERP55631.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55632.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP58104.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 gb|ERP67202.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67204.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67206.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESQ38069.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38070.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESR65424.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 gb|ESW15198.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 gb|KDO52961.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDP20793.1| hypothetical protein JCGZ_21264 [Jatropha curcas]
 gb|AET01628.2| polyubiquitin 3 [Medicago truncatula]
 gb|KEH30745.1| polyubiquitin 3 [Medicago truncatula]
 gb|KJB13593.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB62633.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
 prf||1603402A poly-ubiquitin
Length=381

 Score =   388 bits (996),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  359  TLADYNIQKESTLHLVLRLRGGF  381


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|KJB81825.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
 gb|KJB81826.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=381

 Score =   388 bits (996),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  359  TLADYNIQKESTLHLVLRLRGGF  381


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   385 bits (989),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 192/194 (99%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  216  ESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVK  IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  38



>ref|XP_009763135.1| PREDICTED: polyubiquitin-like [Nicotiana sylvestris]
Length=381

 Score =   388 bits (996),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  359  TLADYNIQKESTLHLVLRLRGGF  381


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   384 bits (986),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/194 (98%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            +DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   TDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  216  ESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVES+DTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPP  114


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38



>gb|KJB13592.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
Length=385

 Score =   388 bits (996),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  359  TLADYNIQKESTLHLVLRLRGGF  381


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  255  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  314

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  315  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  374

Query  348  LRLRGGMQI  322
            LRLRGG ++
Sbjct  375  LRLRGGFRM  383


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>emb|CAA54603.1| pentameric polyubiquitin [Nicotiana tabacum]
Length=346

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/194 (99%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  216  ESTLHLVLRLRGGM  229


 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/194 (99%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  171

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  172  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  231

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  292  ESTLHLVLRLRGGM  305


 Score =   306 bits (785),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 153/154 (99%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  247

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  248  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  307

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  220
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIP  677
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|ACD31680.1| ubiquitin [Gossypium hirsutum]
Length=305

 Score =   385 bits (988),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TL DYNIQKESTLHLVLRLRGGF
Sbjct  283  TLPDYNIQKESTLHLVLRLRGGF  305


 Score =   384 bits (987),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 192/194 (99%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  216  ESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVK  IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  38



>ref|XP_002873083.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49342.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score =   385 bits (988),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   383 bits (984),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|KDP38838.1| hypothetical protein JCGZ_04995 [Jatropha curcas]
Length=308

 Score =   385 bits (988),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   384 bits (987),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (774),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_009605659.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
Length=305

 Score =   385 bits (988),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLED RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDERTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  283  TLADYNIQKESTLHLVLRLRGGF  305


 Score =   382 bits (981),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED RTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDERTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (767),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLED RTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDERTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_011077812.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
 ref|XP_011077813.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
Length=334

 Score =   385 bits (990),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 193/196 (98%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  64   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  123

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  124  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  183

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  184  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  243

Query  141  ESTLHLVLRLRGGF*I  94
            ESTLHLVLRLRGG  I
Sbjct  244  ESTLHLVLRLRGGMQI  259


 Score =   385 bits (990),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 192/193 (99%), Positives = 192/193 (99%), Gaps = 0/193 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  140  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  199

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  200  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  259

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  260  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  319

Query  141  ESTLHLVLRLRGG  103
            ESTLHLVLRLRGG
Sbjct  320  ESTLHLVLRLRGG  332


 Score =   332 bits (852),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 168/170 (99%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  603  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  424
            QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
Sbjct  14   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  73

Query  423  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  244
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK
Sbjct  74   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  133

Query  243  IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*I  94
            IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  I
Sbjct  134  IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  183


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  89   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  142


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  165  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  218


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  241  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  294


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -2

Query  832  QKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  14   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  66



>gb|KJB14874.1| hypothetical protein B456_002G147600, partial [Gossypium raimondii]
Length=344

 Score =   386 bits (991),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  68   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  127

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  128  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  187

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  188  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  247

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  248  TLADYNIQKESTLHLVLRLRGGM  270


 Score =   383 bits (984),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 191/201 (95%), Positives = 196/201 (98%), Gaps = 0/201 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  144  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  203

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  204  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  263

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  264  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  323

Query  168  TLADYNIQKESTLHLVLRLRG  106
            TLADYNIQKESTLHLVLRLRG
Sbjct  324  TLADYNIQKESTLHLVLRLRG  344


 Score =   357 bits (917),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 179/180 (99%), Positives = 179/180 (99%), Gaps = 0/180 (0%)
 Frame = -3

Query  639  LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  460
            LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK
Sbjct  15   LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  74

Query  459  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  280
            EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV
Sbjct  75   EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  134

Query  279  ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  135  ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  194


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  26   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  79


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  102  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  155


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  178  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  231


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  254  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  307



>gb|ABR25697.1| polyubiquitin containing 7 ubiquitin monomers [Oryza sativa Indica 
Group]
Length=201

 Score =   380 bits (977),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 191/193 (99%), Positives = 191/193 (99%), Gaps = 0/193 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  8    IPPDQQRLIFAGKQLEDGRTLXDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  67

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  68   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  127

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  128  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  187

Query  141  ESTLHLVLRLRGG  103
            ESTLHLVLRLRGG
Sbjct  188  ESTLHLVLRLRGG  200


 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/125 (98%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = -3

Query  474  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  295
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  1    KIQDKEGIPPDQQRLIFAGKQLEDGRTLXDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  60

Query  294  ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  115
            ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR
Sbjct  61   ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  120

Query  114  LRGGF  100
            LRGG 
Sbjct  121  LRGGM  125


 Score =   234 bits (598),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  75   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  134

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  135  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  194

Query  348  LRLRGG  331
            LRLRGG
Sbjct  195  LRLRGG  200


 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  33   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  86


 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  109  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  162



>gb|AEW46688.1| polyubiquitin, partial [Ulva linza]
Length=226

 Score =   381 bits (979),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 190/200 (95%), Positives = 195/200 (98%), Gaps = 0/200 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLR  109
            TLADYNIQKESTLHLVLRLR
Sbjct  207  TLADYNIQKESTLHLVLRLR  226


 Score =   303 bits (777),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_006593989.1| PREDICTED: polyubiquitin 10-like isoform X1 [Glycine max]
Length=381

 Score =   387 bits (994),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  359  TLADYNIQKESTLHLVLRLRGGF  381


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|NP_001147027.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|ACG25128.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
Length=311

 Score =   384 bits (987),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 192/193 (99%), Positives = 192/193 (99%), Gaps = 0/193 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  118  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  177

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  178  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  237

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  238  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  297

Query  141  ESTLHLVLRLRGG  103
            ESTLHLVLRLRGG
Sbjct  298  ESTLHLVLRLRGG  310


 Score =   330 bits (845),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 175/202 (87%), Gaps = 10/202 (5%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR--------LRGGMQIFVKTLTGK  526
             PPDQQRLIFAGKQLEDGR L      + +  H             R  MQIFVKTLTGK
Sbjct  36   IPPDQQRLIFAGKQLEDGRNLIFSPFARNA--HTARSPISDPRSPRRSKMQIFVKTLTGK  93

Query  525  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  346
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
Sbjct  94   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  153

Query  345  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  166
            RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  154  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  213

Query  165  LADYNIQKESTLHLVLRLRGGF  100
            LADYNIQKESTLHLVLRLRGG 
Sbjct  214  LADYNIQKESTLHLVLRLRGGM  235


 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 135/161 (84%), Gaps = 10/161 (6%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L    
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNLIFSP  60

Query  378  IQKESTLHLVLR--------LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  223
              + +  H             R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  61   FARNA--HTARSPISDPRSPRRSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  118

Query  222  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  119  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  159


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  143  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  196


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  219  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  272


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  796  RGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            R  MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  80   RSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  120


 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_002992988.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
 ref|XP_002994514.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ04422.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ05934.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
Length=229

 Score =   381 bits (979),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 190/194 (98%), Positives = 190/194 (98%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  216  ESTLHLVLRLRGGM  229


 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK  IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  114


 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK  IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  190


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVK  IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  38



>ref|XP_009358096.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
 ref|XP_009343084.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
Length=401

 Score =   388 bits (996),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  199  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  258

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  259  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  318

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  319  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  378

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  379  TLADYNIQKESTLHLVLRLRGGF  401


 Score =   385 bits (989),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  47   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  106

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  107  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  166

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  167  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  226

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  227  TLADYNIQKESTLHLVLRLRGGM  249


 Score =   385 bits (989),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  123  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  182

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  183  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  242

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  243  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  302

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  303  TLADYNIQKESTLHLVLRLRGGM  325


 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  140

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  134


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  210


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  233  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  286


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  309  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  362


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  790  GMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
             MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  20   SMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  58



>gb|AAB95250.1| ubiquitin [Arabidopsis thaliana]
Length=304

 Score =   384 bits (986),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ+ESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQRESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   384 bits (985),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQRESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (772),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQRESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +Q+ES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_007154496.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
 gb|ESW26490.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
Length=305

 Score =   384 bits (986),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGL  305


 Score =   384 bits (986),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (776),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVE+SDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|KIR83632.1| polyubiquitin, partial [Cryptococcus gattii IND107]
Length=218

 Score =   381 bits (978),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 189/202 (94%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  16   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  75

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct  76   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV  135

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  136  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  195

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TL+DYNIQKESTLHLVLRLRGG
Sbjct  196  TLSDYNIQKESTLHLVLRLRGG  217


 Score =   279 bits (713),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = -3

Query  525  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  346
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVL
Sbjct  1    TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  60

Query  345  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  166
            RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  61   RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  120

Query  165  LADYNIQKESTLHLVLRLRGGF  100
            L+DYNIQKESTLHLVLRLRGG 
Sbjct  121  LSDYNIQKESTLHLVLRLRGGM  142


 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  50   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  103


 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  126  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  179



>gb|KIM78989.1| hypothetical protein PILCRDRAFT_573034 [Piloderma croceum F 1598]
Length=229

 Score =   381 bits (979),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 189/202 (94%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TL+DYNIQKESTLHLVLRLRGG
Sbjct  207  TLSDYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (769),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|KDB11907.1| ubiquitin [Ustilaginoidea virens]
Length=305

 Score =   384 bits (986),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 191/194 (98%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  216  ESTLHLVLRLRGGM  229


 Score =   382 bits (982),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 190/202 (94%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (772),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  190


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  266


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38



>ref|XP_010938693.1| PREDICTED: polyubiquitin [Elaeis guineensis]
Length=307

 Score =   384 bits (987),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF+KTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFIKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   382 bits (982),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  +KT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK  IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|AAK68824.1| Unknown protein [Arabidopsis thaliana]
Length=229

 Score =   381 bits (979),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVK L GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKPLPGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  207  TLADYNIQKESTLHLVLRLRGGF  229


 Score =   301 bits (772),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VK   GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_003574865.1| PREDICTED: polyubiquitin-like [Brachypodium distachyon]
Length=341

 Score =   385 bits (990),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 193/196 (98%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  72   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  131

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  132  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  191

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  192  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  251

Query  141  ESTLHLVLRLRGGF*I  94
            ESTLHLVLRLRGG  I
Sbjct  252  ESTLHLVLRLRGGMQI  267


 Score =   385 bits (989),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 192/193 (99%), Positives = 192/193 (99%), Gaps = 0/193 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  148  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  207

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  208  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  267

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  268  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  327

Query  141  ESTLHLVLRLRGG  103
            ESTLHLVLRLRGG
Sbjct  328  ESTLHLVLRLRGG  340


 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  37   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  96

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  97   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  156

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*I  94
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  I
Sbjct  157  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  191


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  97   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  150


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  173  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  226


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  249  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  302


 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  37   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  74



>gb|EJU04700.1| polyubiquitin UbiD/Ubi4 [Dacryopinax sp. DJM-731 SS1]
Length=229

 Score =   381 bits (979),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 189/202 (94%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TL+DYNIQKESTLHLVLRLRGG
Sbjct  207  TLSDYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (769),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|KJA26171.1| hypothetical protein HYPSUDRAFT_354705 [Hypholoma sublateritium 
FD-334 SS-4]
Length=229

 Score =   381 bits (978),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 189/202 (94%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TL+DYNIQKESTLHLVLRLRGG
Sbjct  207  TLSDYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (769),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|KIM78981.1| hypothetical protein PILCRDRAFT_10644 [Piloderma croceum F 1598]
Length=229

 Score =   381 bits (978),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 189/202 (94%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TL+DYNIQKESTLHLVLRLRGG
Sbjct  207  TLSDYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (769),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   234 bits (596),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV  222

Query  348  LRLRGGM  328
            LRLRGG+
Sbjct  223  LRLRGGV  229


 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_011110054.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
 gb|EPS41950.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
Length=229

 Score =   381 bits (978),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 189/202 (94%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TL+DYNIQKESTLHLVLRLRGG
Sbjct  207  TLSDYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (769),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|KJB62485.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   384 bits (985),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 191/193 (99%), Positives = 192/193 (99%), Gaps = 0/193 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  171

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  172  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  231

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  141  ESTLHLVLRLRGG  103
            ESTLHLVLRLRGG
Sbjct  292  ESTLHLVLRLRGG  304


 Score =   383 bits (983),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 190/194 (98%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  216  ESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  114


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  190


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38



>ref|NP_001148453.1| LOC100282068 [Zea mays]
 ref|XP_002299930.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_003607671.1| Ubiquitin [Medicago truncatula]
 gb|AAC49014.1| ubiquitin [Zea mays]
 gb|ACG31521.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|EEE84735.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ACR37911.1| unknown [Zea mays]
 gb|AES89868.1| polyubiquitin 3 [Medicago truncatula]
 gb|AFW66440.1| putative ubiquitin family protein isoform 1 [Zea mays]
 gb|AFW66441.1| putative ubiquitin family protein isoform 2 [Zea mays]
Length=381

 Score =   387 bits (993),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG+
Sbjct  359  TLADYNIQKESTLHLVLRLRGGY  381


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_719867.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 ref|XP_719750.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 emb|CAA76783.1| polyubiquitin [Candida albicans]
 gb|EAL00878.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 gb|EAL01003.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 gb|EEQ44747.1| hypothetical protein CAWG_03035 [Candida albicans WO-1]
 emb|CCE42351.1| hypothetical protein CPAR2_809000 [Candida parapsilosis]
 gb|EMG49099.1| hypothetical protein G210_0209 [Candida maltosa Xu316]
 gb|KHC79264.1| polyubiquitin [Candida albicans SC5314]
Length=229

 Score =   381 bits (978),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 188/194 (97%), Positives = 193/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  215

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGGF
Sbjct  216  ESTLHLVLRLRGGF  229


 Score =   297 bits (761),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  114


 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  190


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38



>ref|XP_007339454.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EJD52725.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|KIM81538.1| hypothetical protein PILCRDRAFT_821319 [Piloderma croceum F 1598]
Length=305

 Score =   384 bits (985),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 190/203 (94%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TL+DYNIQKESTLHLVLRLRGGF
Sbjct  283  TLSDYNIQKESTLHLVLRLRGGF  305


 Score =   381 bits (978),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 189/203 (93%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TL+DYNIQKESTLHLVLRLRGG 
Sbjct  207  TLSDYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (768),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_001783045.1| predicted protein [Physcomitrella patens]
 gb|EDQ52114.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   380 bits (977),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 190/193 (98%), Positives = 190/193 (98%), Gaps = 0/193 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGG  103
            ESTLHLVLRLRGG
Sbjct  216  ESTLHLVLRLRGG  228


 Score =   299 bits (765),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK  IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  114


 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK  IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  190


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVK  IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  38



>gb|KIK28767.1| hypothetical protein PISMIDRAFT_672939, partial [Pisolithus microcarpus 
441]
Length=247

 Score =   381 bits (979),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 189/203 (93%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  45   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  104

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct  105  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV  164

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  165  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  224

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TL+DYNIQKESTLHLVLRLRGG 
Sbjct  225  TLSDYNIQKESTLHLVLRLRGGL  247


 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = -3

Query  612  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  433
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  60

Query  432  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  253
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  61   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  120

Query  252  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  171


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  3    IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  56


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  79   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  132


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  155  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  208



>gb|AIY27743.1| polyubiquitin Ubi10, partial [Betula luminifera]
Length=330

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 190/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFV+TLTG
Sbjct  101  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVRTLTG  160

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  161  KTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  220

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  221  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  280

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  281  TLADYNIQKESTLHLVLRLRGGM  303


 Score =   383 bits (984),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 189/203 (93%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV RLRGGMQIFVKTLTG
Sbjct  25   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVFRLRGGMQIFVKTLTG  84

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  85   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  144

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  145  LRLRGGMQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  204

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  205  TLADYNIQKESTLHLVLRLRGGM  227


 Score =   288 bits (738),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  177  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  236

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  237  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  296

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  247
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  297  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  330


 Score =   276 bits (705),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/153 (93%), Positives = 144/153 (94%), Gaps = 2/153 (1%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVK L  KTITLEV+    IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVK-LYSKTITLEVKLRH-IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  58

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  59   IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  118

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  119  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  151


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  211  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  264


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L  R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  59   IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  112


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  V+T  GK +  EVESSDT+DNVKA IQDKEGIPP
Sbjct  135  IQKESTLHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPP  188


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKA  704
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA
Sbjct  287  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  330



>dbj|BAL61087.1| polyubiquitin [Dianthus caryophyllus]
Length=229

 Score =   380 bits (977),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 190/193 (98%), Positives = 190/193 (98%), Gaps = 0/193 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGG  103
            ESTLHLVLRLRGG
Sbjct  216  ESTLHLVLRLRGG  228


 Score =   299 bits (765),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK  IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  114


 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK  IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  190


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVK  IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  38



>ref|XP_001830230.1| ubiquitin [Coprinopsis cinerea okayama7#130]
 gb|EAU91601.1| ubiquitin [Coprinopsis cinerea okayama7#130]
Length=305

 Score =   384 bits (985),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 190/194 (98%), Positives = 193/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  171

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQI
Sbjct  172  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQI  231

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  291

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGGF
Sbjct  292  ESTLHLVLRLRGGF  305


 Score =   379 bits (973),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TL+DYNIQKESTLHLVLRLRGG 
Sbjct  207  TLSDYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (763),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK  IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  114


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|KEH31155.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   386 bits (992),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  359  TLADYNIQKESTLHLVLRLRGGF  381


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   384 bits (985),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TL+DYNIQKESTLHLVLRLRGG 
Sbjct  283  TLSDYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_006372519.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP50316.1| polyubiquitin family protein [Populus trichocarpa]
Length=305

 Score =   384 bits (985),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 191/194 (98%), Positives = 191/194 (98%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  171

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  172  SDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  231

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGGF
Sbjct  292  ESTLHLVLRLRGGF  305


 Score =   381 bits (978),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 190/194 (98%), Positives = 190/194 (98%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  216  ESTLHLVLRLRGGM  229


 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK  IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  114


 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK  IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  190


 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK  IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  266


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVK  IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  38



>ref|XP_006288300.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21198.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=306

 Score =   384 bits (985),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   383 bits (984),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQ+KEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPP  190


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_002872109.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48368.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=383

 Score =   386 bits (992),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  104  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  163

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  164  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  223

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  224  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  283

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  284  TLADYNIQKESTLHLVLRLRGGM  306


 Score =   385 bits (990),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  180  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  239

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  240  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  299

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG+PPDQQRLIFAGKQLEDGR
Sbjct  300  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGVPPDQQRLIFAGKQLEDGR  359

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  360  TLADYNIQKESTLHLVLRLRGG  381


 Score =   382 bits (982),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  P DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  28   KAKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  87

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  88   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  147

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  148  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  207

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  208  TLADYNIQKESTLHLVLRLRGGM  230


 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  2    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYN  61

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  62   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  121

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  122  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  154


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  62   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  115


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  138  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  191


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  214  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  267


 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEG+PP
Sbjct  290  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGVPP  343


 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIP  677
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIP
Sbjct  2    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  38



>ref|XP_010227188.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=339

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  61   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  120

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  121  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  180

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  181  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  240

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  241  TLADYNIQKESTLHLVLRLRGGM  263


 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  137  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  196

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  197  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  256

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  257  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  316

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  317  TLADYNIQKESTLHLVLRLRGG  338


 Score =   309 bits (791),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = -3

Query  567  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  388
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  32   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  91

Query  387  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  208
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  92   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  151

Query  207  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  152  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  187


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  95   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  148


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  171  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  224


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  247  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  300


 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  796  RGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  32   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  72



>ref|XP_006381473.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP59270.1| polyubiquitin family protein [Populus trichocarpa]
Length=306

 Score =   383 bits (984),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/194 (98%), Positives = 191/194 (98%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  216  ESTLHLVLRLRGGM  229


 Score =   383 bits (983),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
             TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  NTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  283  TLADYNIQKESTLHLVLRLRGG  304


 Score =   300 bits (767),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVE+SDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVENSDTIDNVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  G  +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVE+SDTIDNVK  IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVENSDTIDNVKVKIQDKEGIPP  38



>ref|XP_003082269.1| polyubiquitin (ISS) [Ostreococcus tauri]
Length=288

 Score =   382 bits (982),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/194 (99%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  12   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  71

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  72   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  131

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  132  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  191

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  192  ESTLHLVLRLRGGM  205


 Score =   337 bits (863),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  79   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  138

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  139  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  198

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  172
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  199  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  257


 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/120 (98%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -3

Query  459  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  280
            +GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV
Sbjct  10   DGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  69

Query  279  ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  70   ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  129


 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 61/106 (58%), Gaps = 11/106 (10%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPPGPAEAD  656
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP     D
Sbjct  189  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP-----D  243

Query  655  LRRKTARGRPYPRRLQHPEGVHPPSRAPFERRHANLRQDPDRQDHH  518
             +R    G+      Q  +GVH P  AP  R   +L       DH+
Sbjct  244  QQRLIFAGK------QLEDGVHAPLGAPLARWPVSLVIHFVLADHY  283


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  37   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  90


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  113  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  166



>emb|CEF99839.1| Ubiquitin conserved site [Ostreococcus tauri]
Length=339

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 193/196 (98%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  70   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  129

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  130  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  189

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  190  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  249

Query  141  ESTLHLVLRLRGGF*I  94
            ESTLHLVLRLRGG  I
Sbjct  250  ESTLHLVLRLRGGMQI  265


 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/193 (99%), Positives = 192/193 (99%), Gaps = 0/193 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  146  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  205

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  206  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  265

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  266  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  325

Query  141  ESTLHLVLRLRGG  103
            ESTLHLVLRLRGG
Sbjct  326  ESTLHLVLRLRGG  338


 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  94

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  95   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  154

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*I  94
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  I
Sbjct  155  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  189


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  95   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  148


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  171  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  224


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  247  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  300


 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  72



>gb|KIL68862.1| hypothetical protein M378DRAFT_157997 [Amanita muscaria Koide 
BX008]
Length=305

 Score =   383 bits (983),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 190/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TL+DYNIQKESTLHLVLRLRGG 
Sbjct  283  TLSDYNIQKESTLHLVLRLRGGL  305


 Score =   383 bits (983),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 190/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TL+DYNIQKESTLHLVLRLRGG 
Sbjct  207  TLSDYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (772),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_010062974.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
Length=425

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/194 (99%), Positives = 193/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  232  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  291

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  292  SDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  351

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  352  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  411

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGGF
Sbjct  412  ESTLHLVLRLRGGF  425


 Score =   385 bits (990),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 193/196 (98%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  80   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  139

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  140  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  199

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  200  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  259

Query  141  ESTLHLVLRLRGGF*I  94
            ESTLHLVLRLRGG  I
Sbjct  260  ESTLHLVLRLRGGMQI  275


 Score =   385 bits (988),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 192/196 (98%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  156  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  215

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  216  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  275

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  276  FVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  335

Query  141  ESTLHLVLRLRGGF*I  94
            ESTLHLVLRLRGG  I
Sbjct  336  ESTLHLVLRLRGGMQI  351


 Score =   305 bits (780),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 154/159 (97%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = -3

Query  570  LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  391
            LR  MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  41   LRVKMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  100

Query  390  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  211
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  101  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  160

Query  210  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*I  94
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  I
Sbjct  161  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  199


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  105  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  158


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  181  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  234


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  333  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  386


 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDT+DNVKA IQDKEGIPP
Sbjct  257  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPP  310


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 39/68 (57%), Gaps = 6/68 (9%)
 Frame = -2

Query  877  RKKVXGXGXPXXLXLQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXI  698
            +KK    G      L K S L      R  MQ  VKT  GK +  EVESSDT+DNVKA I
Sbjct  21   QKKTQTLGALSPFDLSKFSSL------RVKMQIFVKTLTGKTITLEVESSDTVDNVKAKI  74

Query  697  QDKEGIPP  674
            QDKEGIPP
Sbjct  75   QDKEGIPP  82



>ref|XP_010911599.1| PREDICTED: polyubiquitin 4 [Elaeis guineensis]
Length=384

 Score =   386 bits (991),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   386 bits (991),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  359  TLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (777),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_008020911.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
 gb|EOA91885.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
Length=305

 Score =   383 bits (983),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 190/194 (98%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  216  ESTLHLVLRLRGGM  229


 Score =   382 bits (982),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 190/193 (98%), Positives = 192/193 (99%), Gaps = 0/193 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  171

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  172  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  231

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  141  ESTLHLVLRLRGG  103
            ESTLHLVLRLRGG
Sbjct  292  ESTLHLVLRLRGG  304


 Score =   300 bits (769),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  114


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  190


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  266


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38



>ref|XP_006396612.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 ref|XP_010537979.1| PREDICTED: polyubiquitin [Tarenaya hassleriana]
 emb|CAJ86369.1| OSIGBa0117N13.13 [Oryza sativa Indica Group]
 emb|CAJ86419.1| H0303G06.8 [Oryza sativa Indica Group]
 gb|EAY95663.1| hypothetical protein OsI_17529 [Oryza sativa Indica Group]
 gb|ESQ38065.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=381

 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  359  TLADYNIQKESTLHLVLRLRGGL  381


 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_007154493.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
 gb|ESW26487.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
Length=429

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  227  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  286

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  287  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  346

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  347  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  406

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  407  TLADYNIQKESTLHLVLRLRGGF  429


 Score =   385 bits (988),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  75   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  134

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  135  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  194

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  195  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  254

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  255  TLADYNIQKESTLHLVLRLRGGM  277


 Score =   385 bits (988),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  151  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  210

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  211  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  270

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  271  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  330

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  331  TLADYNIQKESTLHLVLRLRGGM  353


 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  49   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  108

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  109  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  168

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  169  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  201


 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  109  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  162


 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  185  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  238


 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  261  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  314


 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  337  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  390


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  49   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  86



>gb|EYU33608.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=381

 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  359  TLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  255  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  314

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  315  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  374

Query  348  LRLRGGM  328
            LRLRGG+
Sbjct  375  LRLRGGV  381


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_010558157.1| PREDICTED: polyubiquitin-like [Tarenaya hassleriana]
Length=382

 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  359  TLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|KFX48439.1| Polyubiquitin [Talaromyces marneffei PM1]
Length=218

 Score =   379 bits (974),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  717  ITSRPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT  538
            IT   + + ++  PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKT
Sbjct  13   ITLESKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKT  72

Query  537  LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  358
            LTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTL
Sbjct  73   LTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTL  132

Query  357  HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  178
            HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLE
Sbjct  133  HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLE  192

Query  177  DGRTLADYNIQKESTLHLVLRLRGG  103
            DGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  193  DGRTLSDYNIQKESTLHLVLRLRGG  217


 Score =   268 bits (686),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 141/153 (92%), Gaps = 11/153 (7%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLE           +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLE-----------SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  49

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  50   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  109

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  110  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  142


 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  50   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  103


 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  126  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  179



>gb|EWZ40370.1| ubiquitin C [Fusarium oxysporum Fo47]
Length=229

 Score =   380 bits (975),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 188/193 (97%), Positives = 192/193 (99%), Gaps = 0/193 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  215

Query  141  ESTLHLVLRLRGG  103
            ESTLHLVLRLRGG
Sbjct  216  ESTLHLVLRLRGG  228


 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  114


 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  190


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38



>ref|NP_001105376.1| polyubiquitin [Zea mays]
 gb|AAC49025.1| polyubiquitin [Zea mays]
Length=381

 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   384 bits (987),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLV+RLRGG 
Sbjct  283  TLADYNIQKESTLHLVVRLRGGM  305


 Score =   384 bits (986),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            +RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  VRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  359  TLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L VR RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVVRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|ACS68205.1| ubiquitin 10.2 [Brassica napus]
Length=381

 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  359  TLADYNIQKESTLHLVLRLRGGI  381


 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_009108753.1| PREDICTED: polyubiquitin 11-like [Brassica rapa]
Length=229

 Score =   380 bits (975),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 189/203 (93%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKE+ LHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKETNLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVK LTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKNLTGKTITLEVESSDTIDNVKAKIQDKEDIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  207  TLADYNIQKESTLHLVLRLRGGF  229


 Score =   300 bits (767),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKE+ LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKETNLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKE+ L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKETNLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VK   GK +  EVESSDTIDNVKA IQDKE IPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKNLTGKTITLEVESSDTIDNVKAKIQDKEDIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|EGO00904.1| hypothetical protein SERLA73DRAFT_178893 [Serpula lacrymans var. 
lacrymans S7.3]
Length=312

 Score =   383 bits (983),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 189/203 (93%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TL+DYNIQKESTLHLVLRLRGG 
Sbjct  207  TLSDYNIQKESTLHLVLRLRGGM  229


 Score =   371 bits (952),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 183/197 (93%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVL  118
            TL+DYNIQKESTLHLV 
Sbjct  283  TLSDYNIQKESTLHLVF  299


 Score =   301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|AGV54228.1| polyubiquitin-like protein [Phaseolus vulgaris]
Length=381

 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  359  TLADYNIQKESTLHLVLRLRGGL  381


 Score =   380 bits (975),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 190/203 (94%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
              LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  SWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (975),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 190/203 (94%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  LRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVSWLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   297 bits (761),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLV  LRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVSWLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L    RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|ABU40645.1| polyubiquitin [Triticum aestivum]
Length=380

 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  359  TLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_010240636.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
 ref|XP_010240784.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=383

 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  29   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  88

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  89   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  148

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  149  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  208

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  209  TLADYNIQKESTLHLVLRLRGGM  231


 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  105  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  164

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  165  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  224

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  225  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  284

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  285  TLADYNIQKESTLHLVLRLRGGM  307


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  181  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  240

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  241  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  300

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  301  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  360

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  361  TLADYNIQKESTLHLVLRLRGG  382


 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  3    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  62

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  63   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  122

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  123  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  155


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  63   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  116


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  139  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  192


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  215  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  268


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  291  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  344


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  3    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  40



>ref|XP_002508175.1| ubiquitin [Micromonas sp. RCC299]
 ref|XP_003061956.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|EEH53668.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|ACO69433.1| ubiquitin [Micromonas sp. RCC299]
 gb|KEH20642.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  359  TLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_010454368.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   385 bits (990),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  359  TLADYNIQKESTLHLVLRLRGG  380


 Score =   385 bits (988),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   302 bits (774),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDT+DNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPP  114


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_002874006.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50265.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   385 bits (990),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (990),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  359  TLADYNIQKESTLHLVLRLRGG  380


 Score =   302 bits (774),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|ADD52202.1| ubiquitin [Catharanthus roseus]
 gb|AEK98798.1| ubiquitin [Carthamus tinctorius]
Length=381

 Score =   385 bits (990),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI AGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLILAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  359  TLADYNIQKESTLHLVLRLRGGF  381


 Score =   382 bits (980),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLAD NIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADCNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   381 bits (978),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 190/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + +++ ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKTQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDT DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD NIQKESTLHLV
Sbjct  87   KTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADCNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   295 bits (755),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAK QDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKTQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLAD NIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADCNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDT DNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPP  114


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA  QDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKTQDKEGIPP  38



>ref|XP_001420612.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98905.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|KHN17791.1| Polyubiquitin 4 [Glycine soja]
Length=381

 Score =   385 bits (990),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (990),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  359  TLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>emb|CDR41572.1| RHTO0S06e03070g1_1 [Rhodosporidium toruloides]
Length=230

 Score =   380 bits (975),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN+QKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNVQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TL DYNIQKESTLHLVLRLRGG
Sbjct  207  TLQDYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (768),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTL+DYN+QKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  VQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|KIK92093.1| hypothetical protein PAXRUDRAFT_830299, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=229

 Score =   380 bits (975),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 189/202 (94%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TL+DYNIQKESTLHLVLRLRGG
Sbjct  207  TLSDYNIQKESTLHLVLRLRGG  228


 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|AAQ07453.1| ubiquitin [Musa acuminata AAA Group]
Length=381

 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   384 bits (985),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITL+VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITL+VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLKVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  359  TLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  +VESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|NP_568397.1| ubiquitin 4 [Arabidopsis thaliana]
 ref|XP_002881273.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010420904.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 ref|XP_010493166.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 sp|P0CH32.1|UBQ4_ARATH RecName: Full=Polyubiquitin 4; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA31331.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAB53929.1| polyubiquitin [Arabidopsis thaliana]
 gb|EFH57532.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED92867.1| ubiquitin 4 [Arabidopsis thaliana]
 prf||1515347A poly-ubiquitin
Length=382

 Score =   385 bits (990),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (990),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   385 bits (989),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  359  TLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|NP_001174480.1| Os05g0504766 [Oryza sativa Japonica Group]
 ref|XP_002438904.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 ref|XP_006656385.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
 ref|XP_007027294.1| Ubiquitin 4 [Theobroma cacao]
 ref|XP_010240640.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 ref|XP_010240789.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 gb|AAD30173.1|AF148448_1 polyubiquitin [Sporobolus stapfianus]
 gb|AAW56906.1| polyubiquitin [Oryza sativa Japonica Group]
 gb|EAY98614.1| hypothetical protein OsI_20535 [Oryza sativa Indica Group]
 gb|EEE64284.1| hypothetical protein OsJ_19121 [Oryza sativa Japonica Group]
 gb|EER90271.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 dbj|BAH93208.1| Os05g0504766 [Oryza sativa Japonica Group]
 dbj|BAJ91806.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04112.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFH53939.1| polyubiquitin 4 [Brachypodium distachyon]
 gb|AFH53940.1| polyubiquitin 10 [Brachypodium distachyon]
 gb|EOY07796.1| Ubiquitin 4 [Theobroma cacao]
 gb|AGT16803.1| polyubiquitin [Saccharum hybrid cultivar R570]
Length=381

 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   385 bits (989),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  359  TLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_002953480.1| polyubiquitin [Volvox carteri f. nagariensis]
 gb|EFJ45453.1| polyubiquitin [Volvox carteri f. nagariensis]
Length=305

 Score =   382 bits (982),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 190/194 (98%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  171

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  172  SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  231

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  292  ESTLHLVLRLRGGL  305


 Score =   382 bits (982),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 190/194 (98%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  216  ESTLHLVLRLRGGM  229


 Score =   300 bits (768),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTI+NVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPP  114


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTI+NVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPP  190


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTI+NVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPP  266


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTI+NVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPP  38



>ref|XP_010270791.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=382

 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (988),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   385 bits (988),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  359  TLADYNIQKESTLHLVLRLRGGI  381


 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_006428816.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
 gb|ESR42056.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
Length=382

 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   385 bits (989),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  359  TLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_010696408.1| PREDICTED: polyubiquitin 4 [Beta vulgaris subsp. vulgaris]
Length=382

 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  359  TLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK  IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>sp|Q58G87.2|UBQ3_ORYSJ RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin-related; 
Contains: RecName: Full=Ubiquitin; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE04243.3| OSJNBa0089N06.4 [Oryza sativa Japonica Group]
 gb|EAZ32071.1| hypothetical protein OsJ_16259 [Oryza sativa Japonica Group]
Length=381

 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  359  TLADYNIQKESTLHLVLRLRGGL  381


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   300 bits (769),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVE SDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPP  38



>gb|EYU18102.1| hypothetical protein MIMGU_mgv1a008166mg [Erythranthe guttata]
Length=383

 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/194 (99%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  216  ESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  359  TLADYNIQKESTLHLVLRLRGG  380


 Score =   301 bits (771),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDT+DNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDT+DNVK+ IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKSKIQDKEGIPP  38



>gb|AAY86773.1| polyubiquitin [Noccaea caerulescens]
Length=382

 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   385 bits (988),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  359  TLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_009596689.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=382

 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   385 bits (988),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  359  TLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_010431529.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Camelina 
sativa]
Length=457

 Score =   388 bits (996),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  255  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  314

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  315  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  374

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  375  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  434

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  435  TLADYNIQKESTLHLVLRLRGGF  457


 Score =   385 bits (990),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  359  TLADYNIQKESTLHLVLRLRGGM  381


 Score =   383 bits (984),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFV TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVXTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   383 bits (984),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFV TLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVXTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  418


 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  V T  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVXTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_009591312.1| PREDICTED: polyubiquitin 4 [Nicotiana tomentosiformis]
 ref|XP_011468093.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 4-like [Fragaria 
vesca subsp. vesca]
Length=382

 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   385 bits (988),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  359  TLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_010421267.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   384 bits (986),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKE+TLHLVLRLRGG 
Sbjct  283  TLADYNIQKETTLHLVLRLRGGM  305


 Score =   384 bits (985),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE+TLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKETTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  359  TLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKE+ L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKETTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>gb|KJB62483.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=381

 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/193 (99%), Positives = 192/193 (99%), Gaps = 0/193 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  188  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  247

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  248  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  307

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  308  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  367

Query  141  ESTLHLVLRLRGG  103
            ESTLHLVLRLRGG
Sbjct  368  ESTLHLVLRLRGG  380


 Score =   384 bits (986),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 191/194 (98%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  171

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  172  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  231

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  292  ESTLHLVLRLRGGM  305


 Score =   383 bits (983),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 190/194 (98%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  216  ESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  114


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  190


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  38



>ref|XP_010324327.1| PREDICTED: polyubiquitin isoform X2 [Solanum lycopersicum]
Length=381

 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  P DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPSDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  359  TLADYNIQKESTLHLVLRLRGGF  381


 Score =   382 bits (982),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   382 bits (982),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIP 
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPS  190


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>emb|CCL99875.1| predicted protein [Fibroporia radiculosa]
Length=312

 Score =   382 bits (982),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 189/203 (93%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  110  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  169

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct  170  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV  229

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  230  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  289

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TL+DYNIQKESTLHLVLRLRGG 
Sbjct  290  TLSDYNIQKESTLHLVLRLRGGL  312


 Score =   382 bits (982),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 189/203 (93%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  34   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  93

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct  94   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV  153

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  154  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  213

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TL+DYNIQKESTLHLVLRLRGG 
Sbjct  214  TLSDYNIQKESTLHLVLRLRGGM  236


 Score =   301 bits (771),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  8    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  67

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  68   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  127

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  128  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  160


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  68   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  121


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  144  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  197


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  220  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  273


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -2

Query  793  GGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
              MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  6    SNMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  45



>gb|KIM67150.1| hypothetical protein SCLCIDRAFT_1210637 [Scleroderma citrinum 
Foug A]
Length=305

 Score =   382 bits (981),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 189/203 (93%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQVKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TL+DYNIQKESTLHLVLRLRGG 
Sbjct  207  TLSDYNIQKESTLHLVLRLRGGM  229


 Score =   381 bits (979),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 189/202 (94%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TL+DYNIQKESTLHLVLRLRGG
Sbjct  283  TLSDYNIQKESTLHLVLRLRGG  304


 Score =   297 bits (760),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQVKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQ KEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQVKEGIPP  38



>gb|AAX40652.1| polyubiquitin [Oryza sativa Japonica Group]
Length=381

 Score =   385 bits (989),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   384 bits (987),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL+FAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLVFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  359  TLADYNIQKESTLHLVLRLRGGL  381


 Score =   384 bits (987),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL+FAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLVFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   300 bits (769),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVE SDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPP  38



>ref|XP_002266370.1| PREDICTED: polyubiquitin 4-like [Vitis vinifera]
Length=383

 Score =   385 bits (989),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   385 bits (988),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  359  TLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_006302388.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35286.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=383

 Score =   385 bits (989),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   385 bits (988),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  359  TLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|NP_849299.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_849301.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002872749.1| hexameric polyubiquitin [Arabidopsis lyrata subsp. lyrata]
 ref|XP_004145098.1| PREDICTED: polyubiquitin 10-like [Cucumis sativus]
 ref|XP_004153450.1| PREDICTED: polyubiquitin 10-like [Cucumis sativus]
 ref|XP_004248312.1| PREDICTED: polyubiquitin [Solanum lycopersicum]
 ref|XP_006360086.1| PREDICTED: polyubiquitin-like isoform X1 [Solanum tuberosum]
 ref|XP_006289516.1| hypothetical protein CARUB_v10003053mg [Capsella rubella]
 ref|XP_006393349.1| hypothetical protein EUTSA_v10011466mg [Eutrema salsugineum]
 ref|XP_006452179.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 ref|XP_006452180.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 ref|XP_006452185.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 ref|XP_006452187.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 ref|XP_006475213.1| PREDICTED: polyubiquitin 10-like [Citrus sinensis]
 ref|XP_007154502.1| hypothetical protein PHAVU_003G123900g [Phaseolus vulgaris]
 ref|XP_007211602.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008371127.1| PREDICTED: polyubiquitin [Malus domestica]
 ref|XP_009357406.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009340939.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009594377.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
 ref|XP_009792248.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_010023555.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
 ref|XP_010538672.1| PREDICTED: polyubiquitin [Tarenaya hassleriana]
 ref|XP_010694241.1| PREDICTED: polyubiquitin [Beta vulgaris subsp. vulgaris]
 ref|XP_010644404.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_010644405.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_010644406.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_011097919.1| PREDICTED: polyubiquitin [Sesamum indicum]
 sp|P0CG85.1|UBI1P_NICSY RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Nicotiana sylvestris]
 sp|Q8H159.2|UBQ10_ARATH RecName: Full=Polyubiquitin 10; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAA34123.1| hexameric polyubiquitin [Nicotiana sylvestris]
 gb|AAA68878.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAD03341.1| ubiquitin [Pisum sativum]
 gb|AAD03342.1| ubiquitin [Pisum sativum]
 gb|AAM98141.1| polyubiquitin UBQ10 [Arabidopsis thaliana]
 gb|ABK92469.1| unknown [Populus trichocarpa]
 emb|CAN64480.1| hypothetical protein VITISV_002813 [Vitis vinifera]
 gb|ACS68204.1| ubiquitin 10.1 [Brassica napus]
 gb|EFH49008.1| hexameric polyubiquitin [Arabidopsis lyrata subsp. lyrata]
 dbj|BAJ34175.1| unnamed protein product [Thellungiella halophila]
 gb|AEE82500.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82502.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|EMJ12801.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EOA22414.1| hypothetical protein CARUB_v10003053mg [Capsella rubella]
 emb|CCQ25958.1| polyubiquitin 10 [Coffea arabica]
 gb|ESQ30635.1| hypothetical protein EUTSA_v10011466mg [Eutrema salsugineum]
 gb|ESR65419.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 gb|ESR65420.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 gb|ESR65425.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 gb|ESR65427.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 gb|ESW26496.1| hypothetical protein PHAVU_003G123900g [Phaseolus vulgaris]
 gb|EYU19215.1| hypothetical protein MIMGU_mgv1a004313mg [Erythranthe guttata]
 gb|KDO52958.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDO52959.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDO52960.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KEH18409.1| polyubiquitin 3 [Medicago truncatula]
 gb|KEH18410.1| polyubiquitin 3 [Medicago truncatula]
 gb|KGN49132.1| hypothetical protein Csa_6G514925 [Cucumis sativus]
 gb|KHN15480.1| Polyubiquitin 10 [Glycine soja]
 gb|AJA36490.1| ubiquitin [Prunus persica]
 gb|KJB62627.1| hypothetical protein B456_009G426900 [Gossypium raimondii]
 gb|KJB62631.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
 gb|KJB62632.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
Length=457

 Score =   388 bits (996),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  255  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  314

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  315  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  374

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  375  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  434

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGGF
Sbjct  435  TLADYNIQKESTLHLVLRLRGGF  457


 Score =   385 bits (989),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   385 bits (989),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   385 bits (989),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  359  TLADYNIQKESTLHLVLRLRGGM  381


 Score =   303 bits (775),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190


 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  418


 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>emb|CDP08567.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   384 bits (987),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 193/195 (99%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -3

Query  678  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  499
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS
Sbjct  90   PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  149

Query  498  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  319
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  150  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  209

Query  318  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  139
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  210  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  269

Query  138  STLHLVLRLRGGF*I  94
            STLHLVLRLRGG  I
Sbjct  270  STLHLVLRLRGGMQI  284


 Score =   355 bits (912),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 180/193 (93%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  678  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  499
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS
Sbjct  166  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  225

Query  498  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  319
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
Sbjct  226  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  285

Query  318  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  139
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI   
Sbjct  286  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNITPL  345

Query  138  STLHLVLRLRGGF  100
            +   L  + R  F
Sbjct  346  TMSRLRSKTRRAF  358


 Score =   302 bits (774),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  54   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  113

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  114  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  173

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*I  94
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  I
Sbjct  174  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  208


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  114  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  167


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  190  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  243


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  266  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  319


 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  54   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  91



>ref|XP_005644220.1| polyubiquitin [Coccomyxa subellipsoidea C-169]
 gb|EIE19676.1| polyubiquitin [Coccomyxa subellipsoidea C-169]
Length=305

 Score =   382 bits (981),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 189/194 (97%), Positives = 193/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  112  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  171

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTI+NVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  172  SDTIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  231

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  232  FVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  291

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGGF
Sbjct  292  ESTLHLVLRLRGGF  305


 Score =   380 bits (975),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 188/194 (97%), Positives = 192/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  36   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  95

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTI+NVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  96   SDTIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  156  FVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  215

Query  141  ESTLHLVLRLRGGF  100
            ESTLHLVLRLRGG 
Sbjct  216  ESTLHLVLRLRGGM  229


 Score =   297 bits (761),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTI+NVK+ IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPP  114


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTI+NVK+ IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPP  190


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTI+NVK+ IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPP  266


 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTI+NVK+ IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPP  38



>emb|CCT70325.1| UBI4-Ubiquitin [Fusarium fujikuroi IMI 58289]
Length=281

 Score =   381 bits (979),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 188/193 (97%), Positives = 192/193 (99%), Gaps = 0/193 (0%)
 Frame = -3

Query  681  FPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  502
             PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  88   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  147

Query  501  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  322
            SDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQI
Sbjct  148  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQI  207

Query  321  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  142
            FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  208  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  267

Query  141  ESTLHLVLRLRGG  103
            ESTLHLVLRLRGG
Sbjct  268  ESTLHLVLRLRGG  280


 Score =   353 bits (905),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 175/180 (97%), Positives = 179/180 (99%), Gaps = 0/180 (0%)
 Frame = -3

Query  639  LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  460
            LEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDK
Sbjct  26   LEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDK  85

Query  459  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  280
            EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV
Sbjct  86   EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  145

Query  279  ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            ESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  146  ESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  205


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  37   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  90


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  113  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  166


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVK+ IQDKEGIPP
Sbjct  189  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  242



>ref|XP_004956019.1| PREDICTED: polyubiquitin 4-like [Setaria italica]
Length=381

 Score =   385 bits (989),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  179  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  238

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  239  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  298

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  299  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  358

Query  168  TLADYNIQKESTLHLVLRLRGG  103
            TLADYNIQKESTLHLVLRLRGG
Sbjct  359  TLADYNIQKESTLHLVLRLRGG  380


 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  27   KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  86

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  87   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  146

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTID+VKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  147  LRLRGGMQIFVKTLTGKTITLEVESSDTIDHVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  206

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  207  TLADYNIQKESTLHLVLRLRGGM  229


 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  103  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTID+VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  163  KTITLEVESSDTIDHVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  222

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  223  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  282

Query  168  TLADYNIQKESTLHLVLRLRGGF  100
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  283  TLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  558  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  379
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  100
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  114


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  266


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  342


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  835  LQKESXLXLGVRXRGGMQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            +QKES L L +R RGGMQ  VKT  GK +  EVESSDTID+VKA IQDKEGIPP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDHVKAKIQDKEGIPP  190


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  787  MQXXVKTXXGKALXXEVESSDTIDNVKAXIQDKEGIPP  674
            MQ  VKT  GK +  EVESSDTIDNVKA IQDKEGIPP
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  38



>ref|XP_008441422.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Cucumis melo]
Length=457

 Score =   388 bits (996),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  708  RPRSKTRKEFPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  529
            + + + ++  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  255  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  314

Query  528  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  349
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  315  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  374

Query  348  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  169
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  375  LRLRGGMQIFVKTLTGK