BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF025A18

Length=739
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFL48180.1|  succinyl-CoA synthetase                                 234   1e-71   Capsicum annuum
ref|NP_001234574.1|  succinyl-CoA ligase [ADP-forming] subunit al...    234   1e-71   Solanum lycopersicum
gb|ABB29950.1|  succinyl-CoA ligase alpha 1 subunit-like                231   2e-71   Solanum tuberosum [potatoes]
gb|AIS71903.1|  mitochondrial succinyl-CoA ligase ADP-forming sub...    233   5e-71   Nicotiana tabacum [American tobacco]
ref|NP_001234277.1|  succinyl-CoA ligase [ADP-forming] subunit al...    231   9e-71   
ref|XP_006350379.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    232   9e-71   Solanum tuberosum [potatoes]
ref|XP_006348504.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    231   1e-70   Solanum tuberosum [potatoes]
ref|XP_009623368.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    231   2e-70   Nicotiana tomentosiformis
ref|XP_009781531.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    231   2e-70   Nicotiana sylvestris
ref|XP_009355925.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    227   4e-69   Pyrus x bretschneideri [bai li]
gb|EYU45725.1|  hypothetical protein MIMGU_mgv1a012075mg                224   6e-69   Erythranthe guttata [common monkey flower]
ref|XP_004161847.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    221   1e-68   
ref|XP_004299462.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    226   2e-68   Fragaria vesca subsp. vesca
gb|ABK95068.1|  unknown                                                 225   3e-68   Populus trichocarpa [western balsam poplar]
emb|CDP14400.1|  unnamed protein product                                225   4e-68   Coffea canephora [robusta coffee]
ref|XP_008467310.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    224   6e-68   Cucumis melo [Oriental melon]
gb|ABK94372.1|  unknown                                                 224   9e-68   Populus trichocarpa [western balsam poplar]
ref|XP_011022031.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    223   1e-67   Populus euphratica
ref|XP_002307162.2|  hypothetical protein POPTR_0005s09370g             223   1e-67   
ref|XP_004137529.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    222   5e-67   Cucumis sativus [cucumbers]
ref|XP_006658733.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    220   1e-66   Oryza brachyantha
ref|XP_008796686.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    221   1e-66   Phoenix dactylifera
ref|XP_009606229.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    216   1e-66   Nicotiana tomentosiformis
dbj|BAJ94034.1|  predicted protein                                      221   1e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010923343.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    221   1e-66   Elaeis guineensis
sp|Q6ZL94.1|SUCA_ORYSJ  RecName: Full=Probable succinyl-CoA ligas...    221   2e-66   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK03449.1|  predicted protein                                      220   2e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002318347.2|  hypothetical protein POPTR_0012s033101g            216   2e-66   
ref|XP_006399319.1|  hypothetical protein EUTSA_v10013993mg             221   2e-66   Eutrema salsugineum [saltwater cress]
ref|XP_002872045.1|  hypothetical protein ARALYDRAFT_489184             220   2e-66   
gb|ACN28789.1|  unknown                                                 218   3e-66   Zea mays [maize]
gb|EPS68438.1|  hypothetical protein M569_06331                         219   3e-66   Genlisea aurea
ref|XP_009413310.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    219   4e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004958125.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    219   5e-66   Setaria italica
ref|XP_008788992.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    219   5e-66   Phoenix dactylifera
ref|XP_009125723.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    219   6e-66   Brassica rapa
ref|XP_003562832.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    219   7e-66   Brachypodium distachyon [annual false brome]
ref|XP_002460917.1|  hypothetical protein SORBIDRAFT_02g037420          219   8e-66   Sorghum bicolor [broomcorn]
gb|ACG31861.1|  succinyl-CoA ligase alpha-chain 2                       218   9e-66   Zea mays [maize]
ref|XP_001762925.1|  predicted protein                                  218   1e-65   
ref|XP_010934473.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    219   1e-65   Elaeis guineensis
ref|XP_007152547.1|  hypothetical protein PHAVU_004G139300g             218   1e-65   Phaseolus vulgaris [French bean]
emb|CDY44764.1|  BnaC02g01230D                                          219   1e-65   Brassica napus [oilseed rape]
emb|CDX81092.1|  BnaC03g03460D                                          219   1e-65   
ref|NP_001149702.1|  succinyl-CoA ligase alpha-chain 2                  218   1e-65   Zea mays [maize]
gb|KDP45810.1|  hypothetical protein JCGZ_17417                         218   1e-65   Jatropha curcas
ref|XP_006847834.1|  hypothetical protein AMTR_s00029p00055000          218   1e-65   
gb|EEC82322.1|  hypothetical protein OsI_26601                          221   2e-65   Oryza sativa Indica Group [Indian rice]
ref|NP_001136494.1|  succinyl-CoA ligase alpha-chain 2                  218   2e-65   Zea mays [maize]
ref|XP_009131054.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    218   2e-65   Brassica rapa
ref|XP_002514510.1|  Succinyl-CoA ligase [GDP-forming] subunit al...    218   2e-65   Ricinus communis
ref|XP_002514509.1|  Succinyl-CoA ligase [GDP-forming] subunit al...    218   2e-65   Ricinus communis
emb|CDY21531.1|  BnaC09g47610D                                          218   3e-65   Brassica napus [oilseed rape]
ref|XP_008375061.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    218   3e-65   Malus domestica [apple tree]
ref|XP_001765853.1|  predicted protein                                  217   4e-65   
gb|EMS53891.1|  putative succinyl-CoA ligase [ADP-forming] subuni...    219   4e-65   Triticum urartu
ref|XP_003548295.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    217   4e-65   Glycine max [soybeans]
ref|XP_010423114.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    217   4e-65   Camelina sativa [gold-of-pleasure]
emb|CDY61908.1|  BnaC07g49680D                                          217   5e-65   Brassica napus [oilseed rape]
ref|NP_196447.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha-1     217   5e-65   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197716.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha-2     217   5e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452813.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    217   5e-65   Camelina sativa [gold-of-pleasure]
emb|CDX78333.1|  BnaA03g02450D                                          217   6e-65   
ref|XP_010491456.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    217   6e-65   Camelina sativa [gold-of-pleasure]
ref|XP_011047755.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    217   6e-65   Populus euphratica
ref|XP_008240339.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    216   7e-65   Prunus mume [ume]
emb|CDX69957.1|  BnaA10g23060D                                          216   9e-65   
ref|XP_010241497.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    216   9e-65   Nelumbo nucifera [Indian lotus]
ref|XP_002871316.1|  hypothetical protein ARALYDRAFT_487662             216   9e-65   
emb|CDY02216.1|  BnaA03g39510D                                          216   1e-64   
ref|XP_009136375.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    216   1e-64   Brassica rapa
ref|XP_006288079.1|  hypothetical protein CARUB_v10001317mg             216   1e-64   Capsella rubella
gb|KHN24503.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha-1...    216   1e-64   Glycine soja [wild soybean]
ref|XP_007209332.1|  hypothetical protein PRUPE_ppa008341mg             216   1e-64   Prunus persica
gb|KDP45811.1|  hypothetical protein JCGZ_17418                         216   1e-64   Jatropha curcas
emb|CAA48891.1|  succinate--CoA ligase (GDP-forming)                    216   1e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011091459.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    215   2e-64   Sesamum indicum [beniseed]
ref|XP_006493424.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    216   2e-64   Citrus sinensis [apfelsine]
gb|KJB79846.1|  hypothetical protein B456_013G069200                    215   2e-64   Gossypium raimondii
emb|CBI35274.3|  unnamed protein product                                215   2e-64   Vitis vinifera
gb|EYU19899.1|  hypothetical protein MIMGU_mgv1a009825mg                215   3e-64   Erythranthe guttata [common monkey flower]
ref|XP_008393504.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    215   3e-64   Malus domestica [apple tree]
ref|XP_004515280.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    214   3e-64   Cicer arietinum [garbanzo]
ref|XP_002268479.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    215   3e-64   Vitis vinifera
gb|AAM65450.1|  succinyl-CoA synthetase, alpha subunit                  215   3e-64   Arabidopsis thaliana [mouse-ear cress]
gb|KHG06820.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha-2...    214   4e-64   Gossypium arboreum [tree cotton]
gb|AGT16123.1|  succinyl-CoA ligase                                     218   5e-64   Saccharum hybrid cultivar R570
ref|XP_006441425.1|  hypothetical protein CICLE_v10020931mg             214   5e-64   Citrus clementina [clementine]
ref|XP_006484523.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    214   6e-64   Citrus sinensis [apfelsine]
ref|XP_006394592.1|  hypothetical protein EUTSA_v10004347mg             216   9e-64   
ref|NP_001241205.1|  uncharacterized protein LOC100782001               213   9e-64   Glycine max [soybeans]
ref|XP_010547709.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    214   9e-64   Tarenaya hassleriana [spider flower]
ref|XP_010546242.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    213   1e-63   Tarenaya hassleriana [spider flower]
gb|KHN23614.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha-1...    213   2e-63   Glycine soja [wild soybean]
gb|KJB31853.1|  hypothetical protein B456_005G211200                    213   2e-63   Gossypium raimondii
gb|KHG04322.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha-1...    213   3e-63   Gossypium arboreum [tree cotton]
ref|XP_002271746.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    212   3e-63   Vitis vinifera
ref|XP_006437603.1|  hypothetical protein CICLE_v10032075mg             211   6e-63   Citrus clementina [clementine]
gb|KFK27646.1|  hypothetical protein AALP_AA8G410300                    211   1e-62   Arabis alpina [alpine rockcress]
ref|XP_009122444.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    211   1e-62   Brassica rapa
ref|XP_003620150.1|  Succinyl-CoA ligase                                210   1e-62   Medicago truncatula
ref|XP_011003681.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    211   2e-62   Populus euphratica
ref|XP_010031908.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    209   4e-62   Eucalyptus grandis [rose gum]
ref|XP_007043270.1|  Succinyl-CoA ligase, alpha subunit                 209   5e-62   
ref|XP_010454606.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    209   7e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010421123.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    209   8e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010493442.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    208   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_006288023.1|  hypothetical protein CARUB_v10001256mg             209   1e-61   
ref|XP_010069514.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    208   2e-61   Eucalyptus grandis [rose gum]
ref|XP_010688675.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    206   1e-60   Beta vulgaris subsp. vulgaris [field beet]
gb|EMT17065.1|  Putative succinyl-CoA ligase (GDP-forming) subuni...    204   5e-60   
ref|XP_009389047.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    204   6e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006376608.1|  hypothetical protein POPTR_0012s00920g             200   3e-59   
ref|XP_001780609.1|  predicted protein                                  192   9e-56   
ref|XP_001693108.1|  succinyl-coa ligase alpha chain                    192   1e-55   Chlamydomonas reinhardtii
gb|KFH07184.1|  succinyl-CoA-synthetase alpha SCSA                      184   7e-55   Toxoplasma gondii MAS
ref|XP_011398589.1|  Succinyl-CoA ligase [ADP-forming] subunit al...    190   7e-55   Auxenochlorella protothecoides
gb|KDD74604.1|  hypothetical protein H632_c1190p0                       190   1e-54   Helicosporidium sp. ATCC 50920
ref|XP_002957241.1|  succinate-coa ligase alpha chain, succinyl-C...    189   2e-54   Volvox carteri f. nagariensis
ref|XP_003078495.1|  putative succinyl-CoA ligase alpha subunit (...    189   4e-54   Ostreococcus tauri
ref|XP_005643816.1|  succinyl-CoA ligase alpha chain                    187   8e-54   Coccomyxa subellipsoidea C-169
ref|XP_005843440.1|  hypothetical protein CHLNCDRAFT_141133             187   1e-53   Chlorella variabilis
ref|XP_001416813.1|  predicted protein                                  187   1e-53   Ostreococcus lucimarinus CCE9901
ref|XP_002368454.1|  succinyl-CoA ligase alpha subunit, putative        183   4e-52   Toxoplasma gondii ME49
ref|XP_008889195.1|  succinyl-CoA-synthetase alpha SCSA                 183   5e-52   
ref|XP_003881225.1|  2-oxoglutarate dehydrogenase E1 component,re...    182   2e-51   Neospora caninum Liverpool
ref|XP_002610474.1|  hypothetical protein BRAFLDRAFT_124275             181   2e-51   Branchiostoma floridae
emb|CBJ28950.1|  Succinate--CoA ligase (GDP-forming), alpha subunit     181   3e-51   Ectocarpus siliculosus
gb|ABE76513.1|  mitochondrial putative GDP-forming succinate-CoA ...    181   4e-51   Toxoplasma gondii
gb|EFA80958.1|  Endo-beta-N-acetylglucosaminidase                       187   4e-50   Heterostelium album PN500
ref|XP_004351803.1|  succinate-CoA ligase                               177   5e-50   Cavenderia fasciculata
ref|WP_038538362.1|  MULTISPECIES: succinate--CoA ligase                176   6e-50   Candidatus Jidaibacter acanthamoeba
dbj|GAM28077.1|  hypothetical protein SAMD00019534_112530               177   6e-50   Acytostelium subglobosum LB1
ref|WP_014363954.1|  succinyl-CoA synthetase subsunit alpha             176   7e-50   Rickettsia canadensis
ref|WP_040257675.1|  MULTISPECIES: succinate--CoA ligase                176   1e-49   spotted fever group
ref|WP_028099766.1|  succinate--CoA ligase                              176   1e-49   Dongia sp. URHE0060
ref|XP_001425910.1|  hypothetical protein                               176   2e-49   Paramecium tetraurelia strain d4-2
ref|WP_014014291.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    175   2e-49   spotted fever group
emb|CCQ75435.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha        175   2e-49   Magnetospira sp. QH-2
ref|WP_017443052.1|  succinyl-CoA synthetase subsunit alpha             174   3e-49   Rickettsia gravesii
ref|WP_008579810.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    174   4e-49   Rickettsia
ref|WP_012152767.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    174   4e-49   spotted fever group
ref|WP_014392217.1|  succinyl-CoA synthetase subsunit alpha             174   4e-49   Rickettsia amblyommatis
ref|WP_032138585.1|  succinate--CoA ligase                              174   4e-49   Rickettsia tamurae
ref|XP_005837665.1|  hypothetical protein GUITHDRAFT_157241             174   5e-49   Guillardia theta CCMP2712
ref|WP_012148768.1|  succinyl-CoA synthetase subsunit alpha             174   5e-49   Rickettsia canadensis
ref|WP_039594975.1|  succinate--CoA ligase                              174   5e-49   Rickettsia felis
ref|WP_011270994.1|  succinyl-CoA synthetase subsunit alpha             174   6e-49   Rickettsia felis
ref|WP_014409142.1|  succinyl-CoA synthetase subsunit alpha             174   8e-49   Rickettsia montanensis
ref|XP_008871215.1|  succinyl-CoA ligase [GDP-forming] subunit al...    174   1e-48   Aphanomyces invadans
ref|WP_012151579.1|  succinyl-CoA synthetase subsunit alpha             173   1e-48   Rickettsia bellii
ref|WP_012149562.1|  succinyl-CoA synthetase subsunit alpha             173   1e-48   Rickettsia akari [rickettsialpox]
ref|XP_001452638.1|  hypothetical protein                               174   1e-48   Paramecium tetraurelia strain d4-2
ref|WP_011477883.1|  succinyl-CoA synthetase subsunit alpha             173   1e-48   Rickettsia bellii
gb|ACC73801.1|  succinyl-CoA synthetase, alpha subunit                  172   2e-48   Paraburkholderia phymatum STM815
gb|ELU05339.1|  hypothetical protein CAPTEDRAFT_170724                  174   2e-48   Capitella teleta
ref|XP_001442597.1|  hypothetical protein                               174   2e-48   Paramecium tetraurelia strain d4-2
ref|WP_008519360.1|  succinyl-CoA synthetase subsunit alpha             172   2e-48   alpha proteobacterium IMCC14465
ref|XP_786544.2|  PREDICTED: succinyl-CoA ligase [ADP/GDP-forming...    173   2e-48   Strongylocentrotus purpuratus [purple urchin]
ref|WP_012110353.1|  succinyl-CoA synthetase subsunit alpha             172   3e-48   Parvibaculum lavamentivorans
ref|WP_021777427.1|  3-oxoacyl-Acyl-carrier protein reductase           172   3e-48   Candidatus Micropelagos thuwalensis
gb|KHJ84287.1|  succinate-CoA ligase, alpha subunit                     169   3e-48   Oesophagostomum dentatum [nodule worm]
ref|WP_027287415.1|  succinate--CoA ligase                              172   3e-48   Rhodovibrio salinarum
ref|WP_010423152.1|  succinyl-CoA synthetase subsunit alpha             172   4e-48   Rickettsia helvetica
gb|ABW76150.1|  succinyl-CoA synthetase alpha subunit                   172   4e-48   Blastocystis sp. ATCC 50177/Nand II
ref|XP_002160938.2|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    173   4e-48   
ref|XP_001007751.3|  succinyl-CoA synthetase, alpha subunit famil...    172   5e-48   Tetrahymena thermophila SB210
ref|WP_043950111.1|  succinate--CoA ligase                              171   6e-48   Candidatus Phaeomarinobacter ectocarpi
ref|XP_008608930.1|  succinyl-CoA ligase [GDP-forming] subunit al...    172   7e-48   Saprolegnia diclina VS20
ref|XP_003106288.1|  hypothetical protein CRE_15309                     172   7e-48   Caenorhabditis remanei
gb|KDO21510.1|  succinyl-CoA ligase subunit alpha                       171   8e-48   Saprolegnia parasitica CBS 223.65
emb|CAP27541.2|  Protein CBR-SUCL-1                                     172   8e-48   Caenorhabditis briggsae
ref|WP_017972286.1|  succinyl-CoA synthetase subsunit alpha             171   1e-47   
ref|NP_510450.1|  Protein SUCL-1                                        171   1e-47   Caenorhabditis elegans [roundworm]
ref|WP_016916757.1|  succinyl-CoA synthetase subsunit alpha             171   1e-47   Rickettsia honei
ref|XP_002645849.1|  Hypothetical protein CBG07585                      172   1e-47   Caenorhabditis briggsae
ref|XP_009524111.1|  hypothetical protein PHYSODRAFT_557468             171   1e-47   Phytophthora sojae
ref|XP_636263.1|  succinate-CoA ligase                                  171   2e-47   Dictyostelium discoideum AX4
ref|XP_006675876.1|  hypothetical protein BATDEDRAFT_36456              171   2e-47   Batrachochytrium dendrobatidis JAM81
gb|ETP44985.1|  succinyl-CoA ligase [GDP-forming] subunit alpha, ...    171   2e-47   Phytophthora parasitica P10297
ref|XP_008905429.1|  succinyl-CoA ligase [GDP-forming] subunit al...    171   2e-47   Phytophthora parasitica INRA-310
ref|WP_017943586.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    170   2e-47   
ref|WP_017970841.1|  succinyl-CoA synthetase subsunit alpha             170   2e-47   
ref|WP_029167294.1|  succinate--CoA ligase                              170   2e-47   
gb|EGT40414.1|  hypothetical protein CAEBREN_13872                      170   3e-47   Caenorhabditis brenneri
gb|AEV92218.1|  Succinyl-CoA synthetase alpha chain                     168   3e-47   Rickettsia slovaca 13-B
ref|XP_002908607.1|  succinyl-CoA ligase subunit alpha, mitochond...    171   3e-47   Phytophthora infestans T30-4
ref|XP_004029838.1|  succinyl-CoA synthetase, alpha subunit, puta...    170   4e-47   Ichthyophthirius multifiliis
ref|WP_014410679.1|  succinyl-CoA synthetase subsunit alpha             169   4e-47   Rickettsia parkeri
ref|WP_029374459.1|  succinate--CoA ligase                              168   4e-47   
gb|AAA85724.1|  succinyl coenzyme A synthetase alpha subunit            169   4e-47   Dictyostelium discoideum AX2
ref|WP_014419805.1|  succinyl-CoA synthetase subsunit alpha             169   5e-47   Rickettsia slovaca
ref|WP_014412789.1|  succinyl-CoA synthetase subsunit alpha             169   5e-47   Rickettsia australis
ref|WP_014746522.1|  succinyl-CoA synthetase subsunit alpha             169   5e-47   Tistrella mobilis
ref|WP_014364693.1|  succinyl-CoA synthetase subsunit alpha             169   5e-47   Rickettsia philipii
ref|WP_016770141.1|  succinyl-CoA synthetase subsunit alpha             169   5e-47   Rickettsia sibirica
ref|XP_002507022.1|  succinate-coa ligase                               170   5e-47   Micromonas commoda
ref|WP_004995747.1|  succinyl-CoA synthetase subsunit alpha             169   6e-47   Rickettsia sibirica
ref|WP_016926237.1|  succinyl-CoA synthetase subsunit alpha             169   6e-47   Rickettsia conorii
ref|WP_025896902.1|  succinate--CoA ligase                              169   6e-47   Sneathiella glossodoripedis
ref|WP_023507834.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha    167   6e-47   
ref|XP_009831202.1|  succinyl-CoA ligase [GDP-forming] subunit al...    169   7e-47   Aphanomyces astaci
ref|XP_003294260.1|  succinyl coenzyme A synthetase alpha subunit       169   7e-47   Dictyostelium purpureum
ref|WP_011190880.1|  succinyl-CoA synthetase subsunit alpha             168   7e-47   Rickettsia typhi
ref|WP_010977229.1|  succinyl-CoA synthetase subsunit alpha             168   7e-47   Rickettsia conorii
ref|WP_015508452.1|  Succinyl-CoA ligase [ADP-forming] subunit al...    167   9e-47   
ref|WP_012736402.1|  succinyl-CoA synthetase subsunit alpha             168   9e-47   Rickettsia peacockii
ref|WP_027300105.1|  succinate--CoA ligase                              168   1e-46   Rhodospirillales bacterium URHD0088
ref|WP_012150789.1|  succinyl-CoA synthetase subsunit alpha             168   1e-46   Rickettsia rickettsii
emb|CDJ51788.1|  succinyl-CoA ligase alpha subunit, putative            167   1e-46   Eimeria brunetti
ref|WP_013181525.1|  succinyl-CoA synthetase subunit alpha              168   1e-46   Waddlia chondrophila
emb|CEO17419.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha        168   1e-46   Rickettsia monacensis
emb|CCW71008.1|  unnamed protein product                                168   1e-46   Phytomonas sp. isolate Hart1
ref|WP_026071683.1|  succinate--CoA ligase                              167   1e-46   Occidentia massiliensis
gb|KHN81599.1|  putative succinyl-CoA ligase [ADP/GDP-forming] su...    170   1e-46   Toxocara canis
gb|ETN68207.1|  CoA-ligase                                              164   1e-46   Necator americanus
ref|WP_014952624.1|  succinyl-CoA synthetase subsunit alpha             167   1e-46   alpha proteobacterium HIMB5
ref|WP_028879580.1|  succinate--CoA ligase                              167   2e-46   Terasakiella pusilla
ref|WP_004597642.1|  succinyl-CoA synthetase subsunit alpha             167   2e-46   Rickettsia prowazekii
ref|XP_005717393.1|  succinyl-CoA synthetase alpha chain                168   2e-46   Chondrus crispus [carageen]
ref|WP_029016458.1|  succinate--CoA ligase                              167   2e-46   
ref|WP_029167879.1|  succinate--CoA ligase                              167   2e-46   
gb|ACO12801.1|  Succinyl-CoA ligase subunit alpha, mitochondrial ...    168   2e-46   Lepeophtheirus salmonis
ref|XP_002772148.1|  Succinyl-CoA ligase, putative                      168   2e-46   Perkinsus marinus ATCC 50983
ref|XP_009038265.1|  hypothetical protein AURANDRAFT_28269              167   3e-46   Aureococcus anophagefferens
ref|WP_012719686.1|  succinyl-CoA synthetase subsunit alpha             167   3e-46   Rickettsia africae
ref|XP_002779820.1|  Succinyl-CoA ligase, putative                      167   4e-46   Perkinsus marinus ATCC 50983
ref|XP_004831195.1|  succinyl-CoA ligase, putative                      167   4e-46   Theileria equi strain WA
ref|WP_027839641.1|  succinate--CoA ligase                              166   4e-46   
ref|WP_022735557.1|  succinyl-CoA synthetase subsunit alpha             166   5e-46   
gb|EWM26381.1|  succinyl- ligase subunit mitochondrial precursor        167   5e-46   Nannochloropsis gaditana
gb|EJW73256.1|  succinyl-CoA ligase subunit alpha                       162   8e-46   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|WP_020401362.1|  succinyl-CoA synthetase subsunit alpha             166   1e-45   Kordiimonas gwangyangensis
ref|XP_002781462.1|  Succinyl-CoA ligase, putative                      167   1e-45   Perkinsus marinus ATCC 50983
gb|ADI19715.1|  hypothetical protein                                    165   1e-45   uncultured bacterium EB000_36F02
ref|XP_002117441.1|  hypothetical protein TRIADDRAFT_61514              166   1e-45   Trichoplax adhaerens
gb|AEI89159.1|  succinyl-CoA synthetase, alpha subunit                  164   1e-45   Candidatus Midichloria mitochondrii IricVA
ref|WP_026871163.1|  hypothetical protein                               161   1e-45   
emb|CDZ80070.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha        165   1e-45   Candidatus Rubidus massiliensis
emb|CCG84081.1|  protein of unknown function                            166   1e-45   Taphrina deformans PYCC 5710
gb|AEE62179.1|  unknown                                                 166   2e-45   Dendroctonus ponderosae
ref|WP_014415904.1|  succinyl-CoA synthetase subsunit alpha             165   2e-45   Pararhodospirillum photometricum
ref|XP_003383961.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    166   2e-45   Amphimedon queenslandica
ref|WP_042311149.1|  succinate--CoA ligase                              164   2e-45   Burkholderiaceae
emb|CCI47060.1|  unnamed protein product                                165   2e-45   Albugo candida
gb|ENN72632.1|  hypothetical protein YQE_10730                          165   3e-45   Dendroctonus ponderosae
ref|WP_011388967.1|  succinyl-CoA synthetase subsunit alpha             164   3e-45   Rhodospirillum rubrum
gb|KFM62410.1|  Succinyl-CoA ligase subunit alpha, mitochondrial        165   3e-45   Stegodyphus mimosarum
dbj|GAA49470.1|  succinyl-CoA synthetase alpha subunit                  166   3e-45   Clonorchis sinensis [oriental liver fluke]
ref|XP_009162469.1|  hypothetical protein T265_00432                    165   3e-45   Opisthorchis viverrini [Southeast Asian liver fluke]
emb|CDJ80198.1|  CoA-binding and ATP-citrate lyase succinyl-CoA l...    165   3e-45   Haemonchus contortus [red stomach worm]
gb|KDR08649.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha, ...    165   3e-45   Zootermopsis nevadensis
ref|WP_041185489.1|  succinate--CoA ligase                              164   3e-45   Candidatus Midichloria mitochondrii
gb|ETN77515.1|  succinate-CoA ligase, alpha subunit                     165   3e-45   Necator americanus
ref|NP_001002577.2|  succinyl-CoA ligase [ADP/GDP-forming] subuni...    165   3e-45   Danio rerio [leopard danio]
ref|WP_009540580.1|  Succinyl-CoA ligase [ADP-forming] alpha chain      164   3e-45   Caenispirillum salinarum
ref|WP_023854650.1|  succinyl-CoA synthetase (ADP-forming) alpha ...    164   3e-45   Candidatus Pelagibacter ubique
gb|ABN12047.1|  putative succinate-CoA ligase, GDP-forming, alpha...    164   4e-45   Maconellicoccus hirsutus [pink hibiscus mealybug]
emb|CDH52273.1|  succinyl-ligase subunit mitochondrialprecursor         165   4e-45   Lichtheimia corymbifera JMRC:FSU:9682
ref|WP_026872999.1|  hypothetical protein                               159   4e-45   
ref|XP_004352450.1|  succinyl coenzyme A synthetase alpha subunit       164   4e-45   Acanthamoeba castellanii str. Neff
emb|CCI47059.1|  unnamed protein product                                165   4e-45   Albugo candida
emb|CDH53782.1|  probable succinyl-coa synthetase alpha gdp-forming     165   4e-45   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDS05386.1|  Putative Succinyl-CoA ligase                           165   4e-45   Lichtheimia ramosa
ref|WP_028035995.1|  succinate--CoA ligase                              164   5e-45   Candidatus Pelagibacter ubique
gb|EFX76555.1|  hypothetical protein DAPPUDRAFT_306118                  164   5e-45   Daphnia pulex
emb|CDS02808.1|  Putative Succinyl-CoA ligase                           164   6e-45   Lichtheimia ramosa
ref|WP_019645135.1|  succinyl-CoA synthetase subsunit alpha             163   6e-45   Novispirillum itersonii
gb|AAX27280.2|  SJCHGC04909 protein                                     164   7e-45   Schistosoma japonicum
gb|ERL86130.1|  hypothetical protein D910_03544                         160   7e-45   Dendroctonus ponderosae
gb|EKE09873.1|  hypothetical protein ACD_16C00100G0035                  163   7e-45   uncultured bacterium
ref|WP_028466118.1|  succinate--CoA ligase                              163   7e-45   Nisaea denitrificans
emb|CAX74373.1|  succinate-CoA ligase                                   164   7e-45   Schistosoma japonicum
ref|WP_004599470.1|  succinyl-CoA synthetase subsunit alpha             163   9e-45   Rickettsia prowazekii
ref|XP_008022993.1|  hypothetical protein SETTUDRAFT_167715             164   9e-45   Exserohilum turcica Et28A
gb|ACO14866.1|  Succinyl-CoA ligase subunit alpha, mitochondrial ...    164   1e-44   Caligus clemensi
ref|XP_011142324.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    164   1e-44   Harpegnathos saltator
emb|CBK23557.2|  Succinyl-CoA Synthetase subunit ? (SCS?)               163   1e-44   Blastocystis hominis
emb|CBK25395.2|  Succinyl-CoA Synthetase subunit ? (SCS?)               163   1e-44   Blastocystis hominis
emb|CCD79067.1|  succinyl-CoA synthetase-related                        164   1e-44   
ref|WP_018051680.1|  succinyl-CoA synthetase subsunit alpha             162   1e-44   
ref|WP_011386313.1|  succinyl-CoA synthetase subsunit alpha             162   1e-44   
ref|WP_002730338.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    162   1e-44   
ref|XP_003142812.1|  succinate-CoA ligase                               161   1e-44   
ref|WP_025280631.1|  MULTISPECIES: succinyl-CoA synthetase subuni...    162   2e-44   
ref|WP_009868831.1|  COG0074: Succinyl-CoA synthetase, alpha subunit    162   2e-44   
ref|WP_008621975.1|  succinyl-CoA synthetase subunit alpha              162   2e-44   
ref|WP_029011387.1|  succinate--CoA ligase                              162   2e-44   
ref|WP_038035751.1|  hypothetical protein                               162   2e-44   
gb|KGB32013.1|  Succinyl-CoA ligase [ADP/GDP-forming] subunit alp...    164   2e-44   
gb|EMD92563.1|  hypothetical protein COCHEDRAFT_1174674                 163   2e-44   
emb|CBK19683.2|  Succinyl-CoA Synthetase subunit ? (SCS?)               163   2e-44   
ref|WP_014703068.1|  succinyl-CoA synthetase subunit alpha              162   2e-44   
ref|WP_029453878.1|  succinate--CoA ligase                              162   2e-44   
emb|CDJ29687.1|  succinyl-CoA ligase alpha subunit, putative            163   3e-44   
ref|XP_003844248.1|  similar to succinyl-coa ligase subunit alpha       163   3e-44   
ref|XP_001931590.1|  succinyl-CoA ligase subunit alpha                  163   3e-44   
ref|WP_007089205.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    162   3e-44   
ref|WP_038603019.1|  succinate--CoA ligase                              162   3e-44   
ref|XP_003298377.1|  hypothetical protein PTT_09097                     162   3e-44   
ref|XP_011501014.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    163   3e-44   
ref|WP_012975136.1|  succinyl-CoA synthetase subsunit alpha             162   3e-44   
ref|XP_007693124.1|  hypothetical protein COCMIDRAFT_109035             162   3e-44   
ref|WP_023647879.1|  succinyl-CoA synthetase subsunit alpha             162   3e-44   
ref|WP_014246680.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    162   3e-44   
ref|XP_007696583.1|  hypothetical protein COCSADRAFT_34282              162   3e-44   
gb|KFD51556.1|  hypothetical protein M513_07606                         162   3e-44   
ref|WP_008336471.1|  succinyl-CoA synthetase subsunit alpha             162   3e-44   
ref|WP_017932594.1|  succinyl-CoA synthetase subsunit alpha             161   3e-44   
ref|XP_002289446.1|  precursor of synthetase                            162   4e-44   
ref|WP_026942183.1|  succinate--CoA ligase                              161   4e-44   
ref|WP_008544437.1|  succinyl-CoA synthetase subsunit alpha             161   4e-44   
ref|WP_014241630.1|  succinyl-CoA synthetase subsunit alpha             161   4e-44   
ref|WP_029455925.1|  succinate--CoA ligase                              161   4e-44   
ref|WP_019450887.1|  succinyl-CoA synthetase subsunit alpha             161   4e-44   
ref|WP_029133306.1|  succinyl-CoA synthetase subunit alpha              161   5e-44   
ref|WP_034838657.1|  succinate--CoA ligase                              160   5e-44   
emb|CEG68719.1|  Putative Succinyl-CoA ligase [GDP-forming] subun...    161   5e-44   
ref|WP_028368926.1|  succinate--CoA ligase                              161   5e-44   
ref|WP_042087115.1|  succinate--CoA ligase                              161   5e-44   
gb|EUB56696.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha         162   5e-44   
emb|CEI88671.1|  Putative Succinyl-CoA ligase [GDP-forming] subun...    162   5e-44   
ref|XP_966490.1|  PREDICTED: succinyl-CoA ligase subunit alpha, m...    162   5e-44   
ref|XP_006557408.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    162   6e-44   
ref|WP_008383363.1|  succinyl-CoA synthetase subsunit alpha             161   6e-44   
ref|WP_025293182.1|  succinate--CoA ligase                              161   6e-44   
ref|WP_034846091.1|  succinate--CoA ligase                              160   6e-44   
ref|WP_012520721.1|  succinyl-CoA synthetase subsunit alpha             160   6e-44   
ref|XP_001805534.1|  hypothetical protein SNOG_15384                    162   7e-44   
ref|WP_038528120.1|  succinate--CoA ligase                              160   7e-44   
ref|WP_006986959.1|  succinyl-CoA synthetase subunit alpha              160   7e-44   
ref|WP_006997672.1|  succinyl-CoA synthetase subsunit alpha             160   8e-44   
gb|EJD74626.1|  succinyl-CoA ligase alpha-chain                         161   8e-44   
ref|WP_012227174.1|  succinyl-CoA synthetase subsunit alpha             160   8e-44   
ref|WP_037499726.1|  succinate--CoA ligase                              160   8e-44   
ref|WP_028582882.1|  succinyl-CoA synthetase subsunit alpha             160   8e-44   
ref|WP_011281561.1|  succinyl-CoA synthetase subsunit alpha             160   9e-44   
ref|WP_024081748.1|  succinyl-CoA synthetase, alpha subunit, NAD(...    160   9e-44   
ref|XP_001891596.1|  succinyl-CoA ligase [GDP-forming] alpha-chai...    161   9e-44   
ref|WP_036001007.1|  succinate--CoA ligase                              160   9e-44   
ref|XP_007512066.1|  predicted protein                                  163   9e-44   
ref|WP_014464126.1|  succinyl-CoA synthetase subsunit alpha             160   1e-43   
ref|XP_002683450.1|  succinyl-CoA synthetase alpha subunit              161   1e-43   
ref|XP_001565674.1|  putative succinyl-CoA synthetase alpha subunit     160   1e-43   
ref|WP_022731741.1|  succinyl-CoA synthetase subsunit alpha             160   1e-43   
ref|WP_018413618.1|  succinyl-CoA synthetase subsunit alpha             160   1e-43   
gb|ACO11392.1|  Succinyl-CoA ligase subunit alpha, mitochondrial ...    161   1e-43   
ref|WP_007560100.1|  succinyl-CoA synthetase subsunit alpha             160   1e-43   
ref|WP_033068019.1|  succinate--CoA ligase                              160   1e-43   
ref|WP_035574930.1|  succinate--CoA ligase                              160   1e-43   
ref|WP_044827266.1|  succinate--CoA ligase                              160   2e-43   
ref|WP_008889739.1|  succinyl-CoA synthetase subsunit alpha             160   2e-43   
ref|XP_004347867.1|  succinate-CoA ligase                               160   2e-43   
ref|XP_011302934.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    160   2e-43   
ref|WP_022699107.1|  succinyl-CoA synthetase subsunit alpha             160   2e-43   
ref|WP_007733326.1|  succinyl-CoA synthetase subsunit alpha             159   2e-43   
ref|WP_019896185.1|  succinyl-CoA synthetase subunit alpha              160   2e-43   
gb|EFN82692.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha, ...    160   2e-43   
ref|XP_006623784.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    160   2e-43   
ref|WP_035931250.1|  succinate--CoA ligase                              159   2e-43   
emb|CCW64321.1|  unnamed protein product                                160   2e-43   
ref|XP_008558493.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    160   2e-43   
ref|WP_004141291.1|  succinyl-CoA synthetase subunit alpha              159   2e-43   
ref|WP_025437909.1|  succinate--CoA ligase                              159   2e-43   
gb|KIW09471.1|  hypothetical protein PV09_00350                         160   2e-43   
emb|CDQ00314.1|  Protein Bm13824, isoform d                             161   2e-43   
emb|CDS28334.1|  succinyl coenzyme A synthetase alpha subunit           160   3e-43   
ref|WP_041066241.1|  succinyl-CoA synthetase subunit alpha              159   3e-43   
gb|KFM71011.1|  Succinyl-CoA ligase [ADP/GDP-forming] subunit alp...    160   3e-43   
ref|WP_008652312.1|  MULTISPECIES: succinyl-CoA synthetase subuni...    159   3e-43   
dbj|BAQ15578.1|  succinyl-CoA ligase [ADP-forming] alpha chain          159   3e-43   
ref|WP_018953020.1|  succinyl-CoA synthetase subunit alpha              159   3e-43   
ref|XP_003876272.1|  putative succinyl-CoA synthetase alpha subunit     159   3e-43   
emb|CDJ86846.1|  CoA-binding and ATP-citrate lyase succinyl-CoA l...    160   3e-43   
emb|CCA20859.1|  unnamed protein product                                160   3e-43   
ref|WP_035883441.1|  succinate--CoA ligase                              159   3e-43   
ref|WP_012810730.1|  succinyl-CoA synthetase subsunit alpha             159   3e-43   
gb|AEE63452.1|  unknown                                                 160   3e-43   
ref|XP_007675614.1|  hypothetical protein BAUCODRAFT_147215             160   3e-43   
ref|XP_007336685.1|  succinate-CoA ligase                               160   3e-43   
ref|XP_008469540.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    160   3e-43   
ref|WP_029309537.1|  succinate--CoA ligase                              159   3e-43   
gb|EYC05957.1|  hypothetical protein Y032_0079g1274                     160   3e-43   
ref|XP_003876273.1|  putative succinyl-CoA synthetase alpha subunit     159   3e-43   
ref|WP_004829423.1|  MULTISPECIES: succinyl-CoA synthetase subuni...    159   3e-43   
ref|WP_041017693.1|  succinate--CoA ligase                              159   3e-43   
ref|WP_012637389.1|  succinyl-CoA synthetase subunit alpha              159   3e-43   
dbj|BAN20393.1|  succinyl-CoA synthetase small subunit, putative        160   3e-43   
ref|WP_038308672.1|  succinate--CoA ligase                              159   4e-43   
ref|WP_039735185.1|  succinate--CoA ligase                              159   4e-43   
ref|NP_497288.1|  Protein SUCL-2                                        159   4e-43   
ref|XP_003111691.1|  hypothetical protein CRE_03008                     159   4e-43   
ref|WP_029353326.1|  succinate--CoA ligase                              159   4e-43   
gb|EYC05958.1|  hypothetical protein Y032_0079g1274                     160   4e-43   
ref|WP_014188059.1|  succinyl-CoA synthetase subsunit alpha             159   4e-43   
ref|WP_011518841.1|  succinyl-CoA synthetase subsunit alpha             159   4e-43   
ref|WP_036137555.1|  succinyl-CoA synthetase subunit alpha              159   4e-43   
ref|WP_010665754.1|  succinyl-CoA synthetase subsunit alpha             159   4e-43   
ref|WP_033073970.1|  succinate--CoA ligase                              159   4e-43   
ref|WP_017775324.1|  succinyl-CoA synthetase subsunit alpha             159   4e-43   
ref|WP_009770390.1|  succinyl-CoA synthetase subsunit alpha             159   4e-43   
ref|XP_002642901.1|  Hypothetical protein CBG15175                      159   5e-43   
ref|WP_025527854.1|  succinate--CoA ligase                              158   5e-43   
ref|WP_010514537.1|  succinyl-CoA synthetase subsunit alpha             158   5e-43   
gb|KIH63986.1|  succinate-CoA ligase, alpha subunit                     159   5e-43   
ref|WP_043888020.1|  succinyl-CoA synthetase subunit alpha              158   5e-43   
ref|WP_029938263.1|  succinyl-CoA synthetase subunit alpha              158   5e-43   
ref|WP_036110573.1|  MULTISPECIES: succinyl-CoA synthetase subuni...    158   5e-43   
ref|XP_003435805.1|  AGAP001312-PB                                      156   5e-43   
ref|WP_043241854.1|  succinate--CoA ligase                              158   5e-43   
ref|WP_013944023.1|  succinyl-CoA synthetase subunit alpha              158   5e-43   
ref|WP_037446206.1|  succinate--CoA ligase                              158   6e-43   
ref|WP_010301571.1|  succinyl-CoA synthetase subsunit alpha             159   6e-43   
ref|WP_006577242.1|  succinyl-CoA synthetase, alpha subunit             158   6e-43   
ref|WP_012975782.1|  succinyl-CoA synthetase subsunit alpha             158   6e-43   
ref|XP_001611906.1|  succinyl-CoA synthetase, alpha subunit famil...    159   6e-43   
ref|XP_002425088.1|  succinyl-CoA ligase subunit alpha , putative       159   6e-43   
ref|WP_012531653.1|  succinyl-CoA synthetase subsunit alpha             158   6e-43   
ref|WP_006341717.1|  succinyl-CoA synthetase subunit alpha              158   7e-43   
ref|WP_026840722.1|  succinate--CoA ligase                              158   7e-43   
ref|WP_042704211.1|  succinate--CoA ligase                              158   7e-43   
ref|WP_043695705.1|  succinyl-CoA synthetase subunit alpha              158   7e-43   
ref|WP_013925587.1|  succinyl-CoA synthetase subunit alpha              158   7e-43   
gb|KJE93223.1|  succinate-CoA ligase                                    160   7e-43   
ref|XP_007728137.1|  succinyl-CoA ligase [GDP-forming] subunit al...    159   7e-43   
ref|XP_623800.2|  PREDICTED: succinyl-CoA ligase [ADP/GDP-forming...    159   7e-43   
ref|WP_012774714.1|  succinyl-CoA synthetase subsunit alpha             158   7e-43   
gb|KIA76927.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha         158   8e-43   
ref|WP_003823180.1|  succinyl-CoA synthetase subunit alpha              158   8e-43   
ref|WP_012461854.1|  succinyl-CoA synthetase subsunit alpha             158   8e-43   
gb|EYC05959.1|  hypothetical protein Y032_0079g1274                     159   8e-43   
emb|CDW58541.1|  succinyl coenzyme A ligase (GDP forming) subunit...    159   8e-43   
ref|XP_011167335.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    159   8e-43   
gb|EFZ13224.1|  hypothetical protein SINV_06825                         159   8e-43   
ref|XP_001466253.1|  putative succinyl-CoA synthetase alpha subunit     158   8e-43   
ref|XP_004995026.1|  succinyl-CoA ligase subunit alpha                  159   9e-43   
ref|WP_023886805.1|  succinyl-CoA ligase [ADP-forming] subunit alpha    158   9e-43   
gb|KHD05655.1|  succinyl-CoA synthetase subunit alpha                   158   9e-43   
ref|XP_011349727.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    159   9e-43   
ref|XP_001683973.1|  putative succinyl-CoA synthetase alpha subunit     158   9e-43   
gb|EPQ18023.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha, ...    155   9e-43   
ref|WP_036315568.1|  succinyl-CoA synthetase subunit alpha              157   9e-43   
ref|WP_012567360.1|  succinyl-CoA synthetase subsunit alpha             157   9e-43   
gb|EGT47789.1|  hypothetical protein CAEBREN_09545                      158   1e-42   
ref|WP_007039745.1|  succinyl-CoA synthetase subunit alpha              158   1e-42   
ref|WP_004717274.1|  MULTISPECIES: succinyl-CoA ligase [ADP-formi...    158   1e-42   
ref|WP_043879654.1|  succinate--CoA ligase                              157   1e-42   
ref|WP_011370796.1|  succinyl-CoA synthetase subunit alpha              157   1e-42   
ref|XP_008216372.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    159   1e-42   
dbj|BAF90012.1|  succinyl-CoA ligase alpha subunit                      157   1e-42   
ref|NP_001156571.1|  succinyl coenzyme A synthetase alpha subunit       159   1e-42   
ref|XP_011264080.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    159   1e-42   
ref|WP_014955396.1|  succinyl-CoA synthetase subsunit alpha             157   1e-42   
ref|XP_003694335.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    159   1e-42   
ref|WP_011444840.1|  succinyl-CoA synthetase subsunit alpha             157   1e-42   
ref|WP_015259246.1|  Succinyl-CoA ligase [ADP-forming] alpha chain      157   1e-42   
ref|WP_011632769.1|  succinyl-CoA synthetase subsunit alpha             157   1e-42   
ref|WP_029004230.1|  succinate--CoA ligase                              154   1e-42   
ref|WP_035502491.1|  succinate--CoA ligase                              157   1e-42   
ref|WP_009725908.1|  succinyl-CoA ligase (ADP-forming) subunit alpha    157   1e-42   
gb|KDQ20665.1|  hypothetical protein BOTBODRAFT_124404                  158   1e-42   
ref|WP_016354339.1|  succinyl-CoA ligase [ADP-forming] subunit alpha    157   1e-42   
ref|WP_012317924.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    157   1e-42   
ref|WP_010685286.1|  MULTISPECIES: succinyl-CoA synthetase subuni...    157   1e-42   
emb|CDR96783.1|  succinyl-CoA synthetase, alpha subunit family pr...    158   1e-42   
gb|EAQ24006.1|  succinyl-CoA synthase, alpha subunit                    153   1e-42   
ref|WP_042671903.1|  succinate--CoA ligase                              157   1e-42   
ref|WP_043354951.1|  MULTISPECIES: succinate--CoA ligase                157   1e-42   
ref|WP_043107133.1|  succinyl-CoA synthetase subunit alpha              157   1e-42   
ref|WP_012098529.1|  succinyl-CoA synthetase subsunit alpha             158   1e-42   
ref|WP_003618449.1|  succinyl-CoA synthetase subsunit alpha             157   2e-42   
ref|WP_029012089.1|  succinate--CoA ligase                              157   2e-42   
gb|ETO36756.1|  succinyl-CoA ligase                                     157   2e-42   
ref|WP_029005676.1|  succinate--CoA ligase                              154   2e-42   
gb|EIE88371.1|  succinyl-CoA ligase [GDP-forming] subunit alpha         158   2e-42   
gb|EIE85313.1|  succinyl-CoA ligase [GDP-forming] subunit alpha         158   2e-42   
ref|XP_005536091.1|  succinyl-CoA synthetase alpha chain                159   2e-42   
ref|WP_041861374.1|  succinate--CoA ligase                              157   2e-42   
ref|WP_042303375.1|  succinate--CoA ligase                              157   2e-42   
ref|WP_022673205.1|  succinyl-CoA synthetase subsunit alpha             157   2e-42   
ref|WP_008211359.1|  succinyl-CoA synthetase subunit alpha              157   2e-42   
gb|EPY30588.1|  succinyl-CoA synthetase alpha subunit                   157   2e-42   
ref|WP_010509731.1|  succinyl-CoA synthetase subsunit alpha             157   2e-42   
ref|WP_034954425.1|  succinate--CoA ligase                              157   2e-42   
ref|WP_006447072.1|  succinyl-CoA synthetase subsunit alpha             157   2e-42   
ref|WP_003599893.1|  succinyl-CoA synthetase subsunit alpha             157   2e-42   
gb|EKD41951.1|  hypothetical protein ACD_73C00426G0001                  155   2e-42   
ref|WP_011630281.1|  succinyl-CoA synthetase subunit alpha              157   2e-42   
dbj|BAO89370.1|  succinyl-coA ligase [ADP-forming] subunit alpha        157   2e-42   
ref|XP_006623783.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    158   2e-42   
ref|WP_029563137.1|  succinate--CoA ligase                              157   2e-42   
ref|WP_035967511.1|  succinate--CoA ligase                              156   2e-42   
ref|WP_040724763.1|  succinyl-CoA synthetase subunit alpha              156   3e-42   
ref|WP_044429963.1|  succinate--CoA ligase                              156   3e-42   
gb|ACE03401.1|  succinyl-CoA synthetase, alpha subunit                  157   3e-42   
ref|XP_003395160.1|  PREDICTED: succinyl-CoA ligase [GDP-forming]...    157   3e-42   
ref|WP_041471245.1|  succinyl-CoA synthetase subsunit alpha             157   3e-42   
ref|WP_039710457.1|  succinate--CoA ligase                              157   3e-42   
ref|WP_004514035.1|  succinyl-CoA synthetase subsunit alpha             156   3e-42   
ref|XP_002059015.1|  GJ15342                                            158   3e-42   



>gb|AFL48180.1| succinyl-CoA synthetase [Capsicum annuum]
 gb|AFL48181.1| succinyl-CoA synthetase [Capsicum annuum]
Length=326

 Score =   234 bits (596),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERF+ADPQTEGIVLIGEIGGT
Sbjct  185  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFIADPQTEGIVLIGEIGGT  244

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ LKEAGVT
Sbjct  245  AEEDAAALIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALKEAGVT  304

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            VCESPAK+G TMLDVF +RGL
Sbjct  305  VCESPAKIGITMLDVFKQRGL  325



>ref|NP_001234574.1| succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial 
[Solanum lycopersicum]
 sp|Q6DQL1.1|SUCA2_SOLLC RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial; Short=SlSCoALalpha2; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAT67464.1| succinyl-CoA ligase alpha 2 subunit [Solanum lycopersicum]
Length=337

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERF+ADPQTEGIVLIGEIGGT
Sbjct  196  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFIADPQTEGIVLIGEIGGT  255

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ LKEAGVT
Sbjct  256  AEEDAAALIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALKEAGVT  315

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            VCESPAK+G TMLDVF +RGL
Sbjct  316  VCESPAKIGVTMLDVFKQRGL  336



>gb|ABB29950.1| succinyl-CoA ligase alpha 1 subunit-like [Solanum tuberosum]
Length=262

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F+ADPQTEGIVLIGEIGGT
Sbjct  121  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFIADPQTEGIVLIGEIGGT  180

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ LKEAGVT
Sbjct  181  AEEDAAALIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALKEAGVT  240

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            VCESPAK+G +ML+VF +RGL+
Sbjct  241  VCESPAKIGVSMLEVFKQRGLV  262



>gb|AIS71903.1| mitochondrial succinyl-CoA ligase ADP-forming subunit alpha-2 
[Nicotiana tabacum]
Length=340

 Score =   233 bits (593),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+FVADPQTEGIVLIGEIGGT
Sbjct  199  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVADPQTEGIVLIGEIGGT  258

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAAFIKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ LKEAGVT
Sbjct  259  AEEDAAAFIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALKEAGVT  318

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            VCESPAK+G +MLDVF +RGL+
Sbjct  319  VCESPAKIGASMLDVFKQRGLV  340



>ref|NP_001234277.1| succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Solanum lycopersicum]
 sp|Q8GTQ9.1|SUCA1_SOLLC RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial; Short=SlSCoALalpha1; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAN86619.1| succinyl-CoA ligase alpha 1 subunit [Solanum lycopersicum]
Length=332

 Score =   231 bits (590),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F+ADPQTEGIVLIGEIGGT
Sbjct  191  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFIADPQTEGIVLIGEIGGT  250

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ LKEAGVT
Sbjct  251  AEEDAAALIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALKEAGVT  310

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            VCESPAK+G +ML+VF +RGL+
Sbjct  311  VCESPAKIGVSMLEVFKQRGLV  332



>ref|XP_006350379.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Solanum tuberosum]
Length=337

 Score =   232 bits (591),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 130/141 (92%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERF+ADPQTEGIVLIGEIGGT
Sbjct  196  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFIADPQTEGIVLIGEIGGT  255

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IK SGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ LKEAGVT
Sbjct  256  AEEDAAALIKASGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALKEAGVT  315

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            VCESPAK+G TMLDVF +RGL
Sbjct  316  VCESPAKIGVTMLDVFKQRGL  336



>ref|XP_006348504.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Solanum tuberosum]
Length=332

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F+ADPQTEGIVLIGEIGGT
Sbjct  191  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFIADPQTEGIVLIGEIGGT  250

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ LKEAGVT
Sbjct  251  AEEDAAALIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALKEAGVT  310

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            VCESPAK+G +ML+VF +RGL+
Sbjct  311  VCESPAKIGVSMLEVFKQRGLV  332



>ref|XP_009623368.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Nicotiana tomentosiformis]
Length=338

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+FVADPQTEGIVLIGEIGGT
Sbjct  197  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVADPQTEGIVLIGEIGGT  256

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAAFIKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI  LKEAGVT
Sbjct  257  AEEDAAAFIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKITALKEAGVT  316

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            VCESPAK+G +MLDVF +RGL+
Sbjct  317  VCESPAKIGASMLDVFKQRGLV  338



>ref|XP_009781531.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Nicotiana sylvestris]
Length=338

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQS+CVGIGGDPFNGTNFVDCLE+FVADPQTEGIVLIGEIGGT
Sbjct  197  SGTLTYEAVFQTTAVGLGQSSCVGIGGDPFNGTNFVDCLEKFVADPQTEGIVLIGEIGGT  256

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAAFIKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ LKEAGVT
Sbjct  257  AEEDAAAFIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALKEAGVT  316

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            VCESPAK+G +MLDVF +RGL+
Sbjct  317  VCESPAKIGASMLDVFKQRGLV  338



>ref|XP_009355925.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Pyrus x bretschneideri]
Length=334

 Score =   227 bits (579),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC++RF+ DPQTEGIVLIGEIGGT
Sbjct  192  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIDRFLQDPQTEGIVLIGEIGGT  251

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  252  AEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  311

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  MLDVF +RGL+
Sbjct  312  VVESPAKIGAAMLDVFKQRGLV  333



>gb|EYU45725.1| hypothetical protein MIMGU_mgv1a012075mg [Erythranthe guttata]
Length=262

 Score =   224 bits (572),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCL +F+ DPQTEGIVLIGEIGGT
Sbjct  121  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLRKFLVDPQTEGIVLIGEIGGT  180

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  181  AEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  240

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+GT ML+VF +RGL+
Sbjct  241  VVESPAKIGTAMLEVFKQRGLV  262



>ref|XP_004161847.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like, partial [Cucumis sativus]
Length=192

 Score =   221 bits (564),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+E+F+ DPQTEGIVLIGEIGGT
Sbjct  50   SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLVDPQTEGIVLIGEIGGT  109

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KP+V FIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  110  AEEDAAALIKESGTDKPIVGFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  169

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G +ML+VF +RGL+
Sbjct  170  VVESPAKIGVSMLEVFKQRGLV  191



>ref|XP_004299462.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Fragaria vesca subsp. vesca]
Length=337

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+E+F+ADPQTEGIVLIGEIGGT
Sbjct  195  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCMEKFLADPQTEGIVLIGEIGGT  254

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IK SGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  255  AEEDAAALIKASGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  314

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  MLDVF +RGL+
Sbjct  315  VVESPAKIGVAMLDVFKQRGLV  336



>gb|ABK95068.1| unknown [Populus trichocarpa]
Length=331

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+E+F+ADPQTEGIVLIGEIGGT
Sbjct  189  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVEKFLADPQTEGIVLIGEIGGT  248

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA  IKESGTEKPVVAFIAG+TAPPGRRMGHAGAIVSGGKGTAQDKI+TL++AGV 
Sbjct  249  AEEDAATLIKESGTEKPVVAFIAGVTAPPGRRMGHAGAIVSGGKGTAQDKIKTLRDAGVI  308

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+GT MLDVF +RGL+
Sbjct  309  VVESPAKIGTAMLDVFKERGLV  330



>emb|CDP14400.1| unnamed protein product [Coffea canephora]
Length=333

 Score =   225 bits (573),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+FVADPQTEGIVLIGEIGGT
Sbjct  192  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVADPQTEGIVLIGEIGGT  251

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAAFIKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ LKEAGVT
Sbjct  252  AEEDAAAFIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKILKEAGVT  311

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  + DVF +RGL+
Sbjct  312  VVESPAKIGAAIFDVFKQRGLV  333



>ref|XP_008467310.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Cucumis melo]
Length=342

 Score =   224 bits (572),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+E+F+ADPQTEGIVLIGEIGGT
Sbjct  200  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLADPQTEGIVLIGEIGGT  259

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KP+V FIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  260  AEEDAAALIKESGTDKPIVGFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  319

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G +ML+VF +RGL+
Sbjct  320  VVESPAKIGVSMLEVFKQRGLV  341



>gb|ABK94372.1| unknown [Populus trichocarpa]
Length=331

 Score =   224 bits (570),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+++F+ADPQTEGIVLIGEIGGT
Sbjct  189  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVKKFLADPQTEGIVLIGEIGGT  248

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA  IKESGTEKPVVAFIAG+TAPPGRRMGHAGAIVSGGKGTAQDKI+TL++AGV 
Sbjct  249  AEEDAATIIKESGTEKPVVAFIAGVTAPPGRRMGHAGAIVSGGKGTAQDKIKTLRDAGVI  308

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+GT MLDVF +RGL+
Sbjct  309  VVESPAKIGTAMLDVFKERGLV  330



>ref|XP_011022031.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Populus euphratica]
Length=331

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+++F+ADPQTEGIVLIGEIGGT
Sbjct  189  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVKKFLADPQTEGIVLIGEIGGT  248

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA  IKESGTEKPVVAFIAG+TAPPGRRMGHAGAIVSGGKGTAQDKI+TL++AGV 
Sbjct  249  AEEDAATLIKESGTEKPVVAFIAGVTAPPGRRMGHAGAIVSGGKGTAQDKIKTLRDAGVI  308

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+GT MLDVF +RGL+
Sbjct  309  VVESPAKIGTAMLDVFKERGLV  330



>ref|XP_002307162.2| hypothetical protein POPTR_0005s09370g [Populus trichocarpa]
 gb|EEE94158.2| hypothetical protein POPTR_0005s09370g [Populus trichocarpa]
Length=331

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+++F+ADPQTEGIVLIGEIGGT
Sbjct  189  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVKKFLADPQTEGIVLIGEIGGT  248

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA  IKESGTEKPVVAFIAG+TAPPGRRMGHAGAIVSGGKGTAQDKI+TL++AGV 
Sbjct  249  AEEDAATLIKESGTEKPVVAFIAGVTAPPGRRMGHAGAIVSGGKGTAQDKIKTLRDAGVI  308

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+GT MLDVF +RGL+
Sbjct  309  VVESPAKIGTAMLDVFKERGLV  330



>ref|XP_004137529.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Cucumis sativus]
 gb|KGN64210.1| Succinyl-CoA ligase alpha 1 subunit [Cucumis sativus]
Length=342

 Score =   222 bits (566),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+E+F+ DPQTEGIVLIGEIGGT
Sbjct  200  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLVDPQTEGIVLIGEIGGT  259

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KP+V FIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  260  AEEDAAALIKESGTDKPIVGFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  319

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G +ML+VF +RGL+
Sbjct  320  VVESPAKIGVSMLEVFKQRGLV  341



>ref|XP_006658733.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like, partial [Oryza brachyantha]
Length=294

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGT
Sbjct  152  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGT  211

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAAFI+ES T+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ L+EAGVT
Sbjct  212  AEEDAAAFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALREAGVT  271

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G+TM ++F +RG+L
Sbjct  272  VVESPAKIGSTMFEIFKQRGML  293



>ref|XP_008796686.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Phoenix dactylifera]
Length=340

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+ RF+ DPQTEGIVLIGEIGGT
Sbjct  198  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTRFLEDPQTEGIVLIGEIGGT  257

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA  I+ESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EA VT
Sbjct  258  AEEDAAVLIQESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREADVT  317

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  MLDVF +RGL+
Sbjct  318  VVESPAKIGAAMLDVFKQRGLV  339



>ref|XP_009606229.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Nicotiana tomentosiformis]
Length=179

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  713  VFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaaf  534
            VFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F+ADPQTEGIVLIGEIGGTAEE+AAA 
Sbjct  46   VFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFIADPQTEGIVLIGEIGGTAEEDAAAL  105

Query  533  IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKL  354
            IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGT+QDKI+ LKEAGVTVCESPAK+
Sbjct  106  IKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTSQDKIKALKEAGVTVCESPAKI  165

Query  353  GTTMLDVFTKRGL  315
            G TMLD F +RGL
Sbjct  166  GVTMLDAFKQRGL  178



>dbj|BAJ94034.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92411.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=329

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVG+GGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGT
Sbjct  187  SGTLTYEAVFQTTAVGLGQSTCVGMGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGT  246

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAAFI+ES TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ L+EAGVT
Sbjct  247  AEEDAAAFIRESKTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALREAGVT  306

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G+TM ++F +RG++
Sbjct  307  VVESPAKIGSTMFEIFKQRGMV  328



>ref|XP_010923343.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Elaeis guineensis]
Length=340

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+ RF+ DPQTEGIVLIGEIGGT
Sbjct  198  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTRFLDDPQTEGIVLIGEIGGT  257

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA I+ESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  258  AEEDAAALIRESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  317

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  MLDVF + GL+
Sbjct  318  VVESPAKIGVAMLDVFKQHGLV  339



>sp|Q6ZL94.1|SUCA_ORYSJ RecName: Full=Probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial; AltName: Full=Succinyl-CoA synthetase 
subunit alpha; Short=SCS-alpha; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAC83073.1| putative succinyl-CoA ligase alpha subunit [Oryza sativa Japonica 
Group]
 gb|EAZ40411.1| hypothetical protein OsJ_24862 [Oryza sativa Japonica Group]
 dbj|BAH01520.1| unnamed protein product [Oryza sativa Japonica Group]
Length=331

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGT
Sbjct  189  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGT  248

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAAFI+ES T+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ L+EAGVT
Sbjct  249  AEEDAAAFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALREAGVT  308

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G+TM ++F +RG+L
Sbjct  309  VVESPAKIGSTMFEIFKQRGML  330



>dbj|BAK03449.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=329

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVG+GGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGT
Sbjct  187  SGTLTYEAVFQTTAVGLGQSTCVGMGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGT  246

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAAFI+ES TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ L+EAGVT
Sbjct  247  AEEDAAAFIRESKTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALREAGVT  306

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G+TM ++F +RG++
Sbjct  307  VVESPAKIGSTMFEIFKQRGMV  328



>ref|XP_002318347.2| hypothetical protein POPTR_0012s033101g, partial [Populus trichocarpa]
 gb|EEE96567.2| hypothetical protein POPTR_0012s033101g, partial [Populus trichocarpa]
Length=192

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+E+F+ DPQTEGI+LIGEIGGT
Sbjct  50   SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLVDPQTEGIILIGEIGGT  109

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  110  AEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  169

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            V ESPAK+G  MLDVF +RGL
Sbjct  170  VVESPAKIGVAMLDVFKQRGL  190



>ref|XP_006399319.1| hypothetical protein EUTSA_v10013993mg [Eutrema salsugineum]
 gb|ESQ40772.1| hypothetical protein EUTSA_v10013993mg [Eutrema salsugineum]
Length=347

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGT
Sbjct  204  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGT  263

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV 
Sbjct  264  AEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVK  323

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M D+F +RGLL
Sbjct  324  VVESPAKIGAAMYDLFQERGLL  345



>ref|XP_002872045.1| hypothetical protein ARALYDRAFT_489184 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48304.1| hypothetical protein ARALYDRAFT_489184 [Arabidopsis lyrata subsp. 
lyrata]
Length=339

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F ADPQTEGIVLIGEIGGT
Sbjct  197  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFADPQTEGIVLIGEIGGT  256

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGV 
Sbjct  257  AEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVK  316

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M ++F +RGLL
Sbjct  317  VVESPAKIGAAMFEIFQERGLL  338



>gb|ACN28789.1| unknown [Zea mays]
Length=263

 Score =   218 bits (554),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGT
Sbjct  121  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVNDPQTEGIVLIGEIGGT  180

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FI+ES T+KPVVAFIAGLTAPPGRRMGHAGAIV+GGKGTAQDKI+ L+EAGVT
Sbjct  181  AEEDAATFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVAGGKGTAQDKIKALREAGVT  240

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G+TM ++F +RG++
Sbjct  241  VVESPAKIGSTMFEIFKQRGMV  262



>gb|EPS68438.1| hypothetical protein M569_06331, partial [Genlisea aurea]
Length=329

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQT+AVGLGQSTCVGIGGDPFNGTNFVDC+++F+ DPQTEGIVLIGEIGGT
Sbjct  189  SGTLTYEAVFQTSAVGLGQSTCVGIGGDPFNGTNFVDCIQKFLVDPQTEGIVLIGEIGGT  248

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKPVV+FIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  249  AEEDAAALIKESGTEKPVVSFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  308

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            V ESPAK+G  MLD F ++GL
Sbjct  309  VVESPAKIGVAMLDAFKQKGL  329



>ref|XP_009413310.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Musa acuminata subsp. malaccensis]
Length=336

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCL +F+ DPQTEGIVLIGEIGGT
Sbjct  194  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLRKFLEDPQTEGIVLIGEIGGT  253

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA I+ES TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  254  AEEDAAALIQESKTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  313

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  MLDVF +R L+
Sbjct  314  VVESPAKIGVAMLDVFKQRRLV  335



>ref|XP_004958125.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like [Setaria italica]
Length=332

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGT
Sbjct  190  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGT  249

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAAFI+ES T+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ L+EAGVT
Sbjct  250  AEEDAAAFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALREAGVT  309

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G+TM ++F +RG++
Sbjct  310  VVESPAKIGSTMFEIFKQRGMV  331



>ref|XP_008788992.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Phoenix dactylifera]
Length=341

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTT VGLGQSTCVGIGGDPFNGTNFVDC+ RF+ DPQTEGIVLIGEIGGT
Sbjct  199  SGTLTYEAVFQTTVVGLGQSTCVGIGGDPFNGTNFVDCITRFLEDPQTEGIVLIGEIGGT  258

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA I+ESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  259  AEEDAAALIRESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  318

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  MLDVF + GL+
Sbjct  319  VVESPAKIGAAMLDVFKQGGLV  340



>ref|XP_009125723.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Brassica rapa]
 emb|CDY40757.1| BnaAnng06200D [Brassica napus]
Length=342

 Score =   219 bits (559),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGT
Sbjct  199  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGT  258

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV 
Sbjct  259  AEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVK  318

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M D+F +RGLL
Sbjct  319  VVESPAKIGAAMYDLFKERGLL  340



>ref|XP_003562832.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Brachypodium distachyon]
Length=327

 Score =   219 bits (557),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVG+GGDPFNGTNFVDCLE+FVADPQTEGIV+IGEIGGT
Sbjct  185  SGTLTYEAVFQTTAVGLGQSTCVGMGGDPFNGTNFVDCLEKFVADPQTEGIVVIGEIGGT  244

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAAFI+ES TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ L++AGVT
Sbjct  245  AEEDAAAFIQESKTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALRDAGVT  304

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G+TM ++F +RG++
Sbjct  305  VVESPAKIGSTMFELFKQRGMV  326



>ref|XP_002460917.1| hypothetical protein SORBIDRAFT_02g037420 [Sorghum bicolor]
 gb|EER97438.1| hypothetical protein SORBIDRAFT_02g037420 [Sorghum bicolor]
Length=332

 Score =   219 bits (557),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGT
Sbjct  190  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGT  249

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FI+ES T+KPVVAFIAGLTAPPGRRMGHAGAIV+GGKGTAQDKI+ L+EAGVT
Sbjct  250  AEEDAATFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVAGGKGTAQDKIKALREAGVT  309

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G+TM ++F +RG++
Sbjct  310  VVESPAKIGSTMFEIFKQRGMV  331



>gb|ACG31861.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
Length=320

 Score =   218 bits (556),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGT
Sbjct  178  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGT  237

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FI+ES T+KPVVAFIAGLTAPPGRRMGHAGAIV+GGKGTAQDKI+ L+EAGVT
Sbjct  238  AEEDAATFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVAGGKGTAQDKIKALREAGVT  297

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G+TM ++F +RG++
Sbjct  298  VVESPAKIGSTMFEIFKQRGMV  319



>ref|XP_001762925.1| predicted protein [Physcomitrella patens]
 gb|EDQ72130.1| predicted protein [Physcomitrella patens]
Length=324

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGG+
Sbjct  183  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVNDPQTEGIVLIGEIGGS  242

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAAFIKESGT+KPVV+FIAGLTAPPGRRMGHAGAI+SGGKGTA DKI  L+ AGVT
Sbjct  243  AEEDAAAFIKESGTQKPVVSFIAGLTAPPGRRMGHAGAIISGGKGTATDKINALRAAGVT  302

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            VCESPA++G+TML VF +R L+
Sbjct  303  VCESPAQIGSTMLRVFQERALI  324



>ref|XP_010934473.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Elaeis guineensis]
Length=340

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTT VGLGQSTCVGIGGDPFNGTNFVDC+ RF+ DPQT+GIVLIGEIGGT
Sbjct  198  SGTLTYEAVFQTTTVGLGQSTCVGIGGDPFNGTNFVDCITRFLEDPQTKGIVLIGEIGGT  257

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA I+ES TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  258  AEEDAAALIRESRTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  317

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  MLDVF +RGL+
Sbjct  318  VVESPAKIGAAMLDVFKQRGLV  339



>ref|XP_007152547.1| hypothetical protein PHAVU_004G139300g [Phaseolus vulgaris]
 gb|ESW24541.1| hypothetical protein PHAVU_004G139300g [Phaseolus vulgaris]
Length=324

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCL +F+ DPQTEGI+LIGEIGGT
Sbjct  182  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLRKFIPDPQTEGIILIGEIGGT  241

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTL+EAGVT
Sbjct  242  AEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLREAGVT  301

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  MLDVF +RGL+
Sbjct  302  VVESPAKIGAAMLDVFKRRGLV  323



>emb|CDY44764.1| BnaC02g01230D [Brassica napus]
Length=343

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGT
Sbjct  200  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGT  259

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV 
Sbjct  260  AEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVK  319

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M D+F +RGLL
Sbjct  320  VVESPAKIGAAMYDLFKERGLL  341



>emb|CDX81092.1| BnaC03g03460D [Brassica napus]
Length=346

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGT
Sbjct  203  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGT  262

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV 
Sbjct  263  AEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVK  322

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M D+F +RGLL
Sbjct  323  VVESPAKIGAAMYDLFKERGLL  344



>ref|NP_001149702.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
 gb|ACG36440.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
 tpg|DAA41208.1| TPA: succinyl-CoA ligase alpha-chain 2 [Zea mays]
Length=331

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGT
Sbjct  189  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVNDPQTEGIVLIGEIGGT  248

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FI+ES T+KPVVAFIAGLTAPPGRRMGHAGAIV+GGKGTAQDKI+ L+EAGVT
Sbjct  249  AEEDAATFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVAGGKGTAQDKIKALREAGVT  308

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G+TM ++F +RG++
Sbjct  309  VVESPAKIGSTMFEIFKQRGMV  330



>gb|KDP45810.1| hypothetical protein JCGZ_17417 [Jatropha curcas]
Length=339

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+ERF+ADPQTEGI+LIGEIGGT
Sbjct  197  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIERFLADPQTEGIILIGEIGGT  256

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA  IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  257  AEEDAAKLIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  316

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            V ESPAK+G  MLDVF +RGL
Sbjct  317  VVESPAKIGLAMLDVFKQRGL  337



>ref|XP_006847834.1| hypothetical protein AMTR_s00029p00055000 [Amborella trichopoda]
 gb|ERN09415.1| hypothetical protein AMTR_s00029p00055000 [Amborella trichopoda]
Length=314

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+++F+ DPQTEGIVLIGEIGGT
Sbjct  172  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIKKFLEDPQTEGIVLIGEIGGT  231

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIV+GGKGTAQDKI+TL+E G T
Sbjct  232  AEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVAGGKGTAQDKIKTLREVGAT  291

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M +VF +RGLL
Sbjct  292  VVESPAKIGAAMHEVFKQRGLL  313



>gb|EEC82322.1| hypothetical protein OsI_26601 [Oryza sativa Indica Group]
Length=432

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGT
Sbjct  290  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGT  349

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAAFI+ES T+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ L+EAGVT
Sbjct  350  AEEDAAAFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALREAGVT  409

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G+TM ++F +RG+L
Sbjct  410  VVESPAKIGSTMFEIFKQRGML  431



>ref|NP_001136494.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
 gb|ACF82043.1| unknown [Zea mays]
 tpg|DAA63303.1| TPA: succinyl-CoA ligase alpha-chain 2 [Zea mays]
Length=331

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGT
Sbjct  189  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGT  248

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FI+ES T+KPVVAFIAGLTAPPGRRMGHAGAIV+GGKGTAQDKI+ L+EAGVT
Sbjct  249  AEEDAATFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVAGGKGTAQDKIKALREAGVT  308

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G+TM ++F +RG++
Sbjct  309  VVESPAKIGSTMFEIFKQRGMV  330



>ref|XP_009131054.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Brassica rapa]
Length=343

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGT
Sbjct  200  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGT  259

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV 
Sbjct  260  AEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVK  319

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M D+F +RGLL
Sbjct  320  VVESPAKIGAAMYDLFKERGLL  341



>ref|XP_002514510.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial 
precursor, putative [Ricinus communis]
 gb|EEF47910.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial 
precursor, putative [Ricinus communis]
Length=334

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+E+F+ADPQTEGI+LIGEIGGT
Sbjct  192  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLADPQTEGIILIGEIGGT  251

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TLKEAGVT
Sbjct  252  AEEDAAALIKESGTDKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLKEAGVT  311

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            V ESPAK+G  MLDVF +RGL
Sbjct  312  VVESPAKIGVAMLDVFKQRGL  332



>ref|XP_002514509.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial 
precursor, putative [Ricinus communis]
 gb|EEF47909.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial 
precursor, putative [Ricinus communis]
Length=334

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+E+F+ADPQTEGI+LIGEIGGT
Sbjct  192  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLADPQTEGIILIGEIGGT  251

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TLKEAGVT
Sbjct  252  AEEDAAALIKESGTDKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLKEAGVT  311

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            V ESPAK+G  MLDVF +RGL
Sbjct  312  VVESPAKIGVAMLDVFKQRGL  332



>emb|CDY21531.1| BnaC09g47610D [Brassica napus]
Length=347

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGT
Sbjct  204  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGT  263

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IK SGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV 
Sbjct  264  AEEDAAALIKASGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVK  323

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G+ M D+F +RGLL
Sbjct  324  VVESPAKIGSAMYDLFKERGLL  345



>ref|XP_008375061.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Malus domestica]
Length=334

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC++RF+ DPQTEGI+LIGEIGGT
Sbjct  192  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIDRFLQDPQTEGIILIGEIGGT  251

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  252  AEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  311

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  MLDVF +RGL+
Sbjct  312  VVESPAKIGAAMLDVFKQRGLV  333



>ref|XP_001765853.1| predicted protein [Physcomitrella patens]
 gb|EDQ69444.1| predicted protein [Physcomitrella patens]
Length=324

 Score =   217 bits (552),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGG+
Sbjct  183  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGS  242

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAAFI+ESGT+KPVV+FIAGLTAPPGRRMGHAGAI+SGGKGTA DKI  L+ AGVT
Sbjct  243  AEEDAAAFIRESGTQKPVVSFIAGLTAPPGRRMGHAGAIISGGKGTATDKINALRAAGVT  302

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            VCESPA++G TML VF +R L+
Sbjct  303  VCESPAQIGATMLKVFEERALI  324



>gb|EMS53891.1| putative succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial 
[Triticum urartu]
Length=383

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVG+GGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGT
Sbjct  241  SGTLTYEAVFQTTAVGLGQSTCVGMGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGT  300

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAAFI+ES TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ L++AGVT
Sbjct  301  AEEDAAAFIQESKTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALRDAGVT  360

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G+TM ++F +RG++
Sbjct  361  VVESPAKIGSTMFELFKQRGMV  382



>ref|XP_003548295.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like [Glycine max]
Length=325

 Score =   217 bits (552),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCL++F+ DPQTEGI+LIGEIGGT
Sbjct  183  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLQKFLTDPQTEGIILIGEIGGT  242

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  243  AEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  302

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  MLDVF +RGL+
Sbjct  303  VVESPAKIGAAMLDVFKQRGLV  324



>ref|XP_010423114.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Camelina sativa]
Length=343

 Score =   217 bits (553),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGT
Sbjct  200  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGT  259

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV 
Sbjct  260  AEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVK  319

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G+ M ++F +RGLL
Sbjct  320  VVESPAKIGSAMYELFQERGLL  341



>emb|CDY61908.1| BnaC07g49680D [Brassica napus]
Length=345

 Score =   217 bits (553),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQT+AVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGT
Sbjct  203  SGTLTYEAVFQTSAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGT  262

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGV 
Sbjct  263  AEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVK  322

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M ++F +RGLL
Sbjct  323  VVESPAKIGAAMFELFQERGLL  344



>ref|NP_196447.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-1 [Arabidopsis 
thaliana]
 sp|P68209.1|SUCA1_ARATH RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial; AltName: Full=Succinyl-CoA synthetase subunit 
alpha-1; Short=SCS-alpha-1; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA05023.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 emb|CAC08330.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gb|AAL61940.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gb|AAM47932.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gb|AAM60889.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gb|AED91279.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-1 [Arabidopsis 
thaliana]
Length=347

 Score =   217 bits (553),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGT
Sbjct  204  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGT  263

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV 
Sbjct  264  AEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVK  323

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G+ M ++F +RGLL
Sbjct  324  VVESPAKIGSAMYELFQERGLL  345



>ref|NP_197716.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2 [Arabidopsis 
thaliana]
 sp|Q8LAD2.2|SUCA2_ARATH RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial; AltName: Full=Succinyl-CoA synthetase subunit 
alpha-2; Short=SCS-alpha-2; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB11180.1| succinyl-CoA synthetase, alpha subunit [Arabidopsis thaliana]
 gb|AAM12993.1| succinyl-CoA synthetase, alpha subunit [Arabidopsis thaliana]
 gb|AAM47926.1| succinyl-CoA synthetase alpha subunit [Arabidopsis thaliana]
 gb|AED93141.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2 [Arabidopsis 
thaliana]
Length=341

 Score =   217 bits (552),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGT
Sbjct  199  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGT  258

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKE+GT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGV 
Sbjct  259  AEEDAAALIKENGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVK  318

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M ++F +RGLL
Sbjct  319  VVESPAKIGAAMFELFQERGLL  340



>ref|XP_010452813.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Camelina sativa]
Length=347

 Score =   217 bits (553),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGT
Sbjct  204  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGT  263

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV 
Sbjct  264  AEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVK  323

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G+ M ++F +RGLL
Sbjct  324  VVESPAKIGSAMYELFQERGLL  345



>emb|CDX78333.1| BnaA03g02450D [Brassica napus]
Length=346

 Score =   217 bits (552),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGT
Sbjct  203  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGT  262

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV 
Sbjct  263  AEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVK  322

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M D+F +RG L
Sbjct  323  VVESPAKIGAAMYDLFKERGFL  344



>ref|XP_010491456.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Camelina sativa]
Length=348

 Score =   217 bits (552),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGT
Sbjct  205  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGT  264

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV 
Sbjct  265  AEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVK  324

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G+ M ++F +RGLL
Sbjct  325  VVESPAKIGSAMYELFQERGLL  346



>ref|XP_011047755.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Populus euphratica]
Length=342

 Score =   217 bits (552),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+E+F+ DPQTEGI+LIGEIGGT
Sbjct  200  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLVDPQTEGIILIGEIGGT  259

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  260  AEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  319

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            V ESPAK+G  MLDVF +RGL
Sbjct  320  VVESPAKIGVAMLDVFKQRGL  340



>ref|XP_008240339.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Prunus mume]
Length=329

 Score =   216 bits (551),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC++RF+ DPQTEGI+LIGEIGGT
Sbjct  187  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIDRFLEDPQTEGIILIGEIGGT  246

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  247  AEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  306

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  MLDVF +RGL+
Sbjct  307  VVESPAKIGVAMLDVFKQRGLV  328



>emb|CDX69957.1| BnaA10g23060D [Brassica napus]
Length=347

 Score =   216 bits (551),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGT
Sbjct  204  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGT  263

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV 
Sbjct  264  AEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVK  323

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M ++F +RGLL
Sbjct  324  VVESPAKIGAAMYELFKERGLL  345



>ref|XP_010241497.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Nelumbo nucifera]
 ref|XP_010241498.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Nelumbo nucifera]
 ref|XP_010241499.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Nelumbo nucifera]
Length=346

 Score =   216 bits (551),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+ +F+ DPQTEGI+LIGEIGGT
Sbjct  204  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCMNKFLVDPQTEGIILIGEIGGT  263

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  264  AEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  323

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  MLDVF +RGLL
Sbjct  324  VVESPAKIGAAMLDVFKQRGLL  345



>ref|XP_002871316.1| hypothetical protein ARALYDRAFT_487662 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47575.1| hypothetical protein ARALYDRAFT_487662 [Arabidopsis lyrata subsp. 
lyrata]
Length=347

 Score =   216 bits (551),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGT
Sbjct  204  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGT  263

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV 
Sbjct  264  AEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVK  323

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M ++F +RGLL
Sbjct  324  VVESPAKIGAAMYELFQERGLL  345



>emb|CDY02216.1| BnaA03g39510D [Brassica napus]
Length=346

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQT+AVGLGQSTCVGIGGDPFNGTNFVDCL++F  DPQTEGIVLIGEIGGT
Sbjct  204  SGTLTYEAVFQTSAVGLGQSTCVGIGGDPFNGTNFVDCLDKFFVDPQTEGIVLIGEIGGT  263

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGV 
Sbjct  264  AEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVK  323

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M ++F +RGLL
Sbjct  324  VVESPAKIGAAMFELFQERGLL  345



>ref|XP_009136375.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Brassica rapa]
Length=346

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQT+AVGLGQSTCVGIGGDPFNGTNFVDCL++F  DPQTEGIVLIGEIGGT
Sbjct  204  SGTLTYEAVFQTSAVGLGQSTCVGIGGDPFNGTNFVDCLDKFFVDPQTEGIVLIGEIGGT  263

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGV 
Sbjct  264  AEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVK  323

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M ++F +RGLL
Sbjct  324  VVESPAKIGAAMFELFQERGLL  345



>ref|XP_006288079.1| hypothetical protein CARUB_v10001317mg [Capsella rubella]
 gb|EOA20977.1| hypothetical protein CARUB_v10001317mg [Capsella rubella]
Length=347

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGT
Sbjct  204  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGT  263

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV 
Sbjct  264  AEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVK  323

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M ++F +RGLL
Sbjct  324  VVESPAKIGAAMYELFQERGLL  345



>gb|KHN24503.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Glycine soja]
Length=352

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCL++F+ DPQTEGI+LIGEIGGT
Sbjct  210  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLQKFLTDPQTEGIILIGEIGGT  269

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  270  AEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  329

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  MLDVF +RGL+
Sbjct  330  VVESPAKIGAAMLDVFKQRGLV  351



>ref|XP_007209332.1| hypothetical protein PRUPE_ppa008341mg [Prunus persica]
 gb|EMJ10531.1| hypothetical protein PRUPE_ppa008341mg [Prunus persica]
Length=336

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC++RF+ DPQTEGI+LIGEIGGT
Sbjct  194  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIDRFLEDPQTEGIILIGEIGGT  253

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  254  AEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  313

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  MLDVF +RGL+
Sbjct  314  VVESPAKIGVAMLDVFKQRGLV  335



>gb|KDP45811.1| hypothetical protein JCGZ_17418 [Jatropha curcas]
Length=341

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+ERF+ DPQTEGI+LIGEIGGT
Sbjct  199  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIERFLVDPQTEGIILIGEIGGT  258

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA  IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTL+EAG T
Sbjct  259  AEEDAAQLIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLREAGAT  318

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  MLD+F +RGL+
Sbjct  319  VVESPAKIGVAMLDIFKQRGLV  340



>emb|CAA48891.1| succinate--CoA ligase (GDP-forming) [Arabidopsis thaliana]
Length=345

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGT
Sbjct  203  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGT  262

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKE+GT+KPVVAFIAGLTAPPGRRMGHAG IVSGGKGTAQDKI++L++AGV 
Sbjct  263  AEEDAAALIKENGTDKPVVAFIAGLTAPPGRRMGHAGRIVSGGKGTAQDKIKSLRDAGVK  322

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAKLG  M ++F +RGLL
Sbjct  323  VVESPAKLGAAMFELFQERGLL  344



>ref|XP_011091459.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Sesamum indicum]
Length=330

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+E+F+ DPQTEGI+LIGEIGGT
Sbjct  189  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLVDPQTEGIILIGEIGGT  248

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  249  AEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  308

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            V ESPAK+GT ML+VF +RGL
Sbjct  309  VVESPAKIGTAMLEVFKQRGL  329



>ref|XP_006493424.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like [Citrus sinensis]
Length=347

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTT VGLGQSTCVGIGGDPFNGTNFVDCLE+F+ DPQTEGI+LIGEIGGT
Sbjct  205  SGTLTYEAVFQTTVVGLGQSTCVGIGGDPFNGTNFVDCLEKFLVDPQTEGIILIGEIGGT  264

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  265  AEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  324

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            V ESPAK+G+ ML+VF +RGL
Sbjct  325  VVESPAKIGSAMLEVFKQRGL  345



>gb|KJB79846.1| hypothetical protein B456_013G069200 [Gossypium raimondii]
Length=335

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+ +F+ADPQTEGI+LIGEIGGT
Sbjct  193  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTKFLADPQTEGIILIGEIGGT  252

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  253  AEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  312

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M DVF +RGLL
Sbjct  313  VVESPAKIGVAMHDVFKQRGLL  334



>emb|CBI35274.3| unnamed protein product [Vitis vinifera]
Length=336

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQST VGIGGDPFNGTNFVDC+++F+ DPQTEGIVLIGEIGGT
Sbjct  193  SGTLTYEAVFQTTAVGLGQSTSVGIGGDPFNGTNFVDCIKKFLVDPQTEGIVLIGEIGGT  252

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA  IKES TEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  253  AEEDAAQLIKESKTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  312

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  ML+ F ++GL+
Sbjct  313  VVESPAKMGVAMLEAFKQKGLI  334



>gb|EYU19899.1| hypothetical protein MIMGU_mgv1a009825mg [Erythranthe guttata]
Length=330

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCL++F+ DPQTEGI+LIGEIGGT
Sbjct  189  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLQKFLVDPQTEGIILIGEIGGT  248

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  249  AEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  308

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  ML+VF +RGL+
Sbjct  309  VVESPAKIGIAMLEVFKQRGLV  330



>ref|XP_008393504.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Malus domestica]
Length=334

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC++RF+ DPQTEGI+LIGEIGGT
Sbjct  192  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIDRFLQDPQTEGIILIGEIGGT  251

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EA VT
Sbjct  252  AEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREADVT  311

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  MLDVF +RGL+
Sbjct  312  VVESPAKIGLAMLDVFKQRGLV  333



>ref|XP_004515280.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like [Cicer arietinum]
Length=327

 Score =   214 bits (546),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV+QTTAVGLGQSTCVGIGGDPFNGTNFVDCL +F+ADPQTEGI+LIGEIGGT
Sbjct  185  SGTLTYEAVYQTTAVGLGQSTCVGIGGDPFNGTNFVDCLTKFIADPQTEGIILIGEIGGT  244

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTL+EAGVT
Sbjct  245  AEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLREAGVT  304

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M D+F ++GL+
Sbjct  305  VVESPAKIGAAMFDIFKQKGLV  326



>ref|XP_002268479.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Vitis vinifera]
Length=340

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQST VGIGGDPFNGTNFVDC+++F+ DPQTEGIVLIGEIGGT
Sbjct  197  SGTLTYEAVFQTTAVGLGQSTSVGIGGDPFNGTNFVDCIKKFLVDPQTEGIVLIGEIGGT  256

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA  IKES TEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  257  AEEDAAQLIKESKTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  316

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  ML+ F ++GL+
Sbjct  317  VVESPAKMGVAMLEAFKQKGLI  338



>gb|AAM65450.1| succinyl-CoA synthetase, alpha subunit [Arabidopsis thaliana]
Length=341

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGT
Sbjct  199  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGT  258

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKE+GT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDK ++L++AGV 
Sbjct  259  AEEDAAALIKENGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKTKSLRDAGVK  318

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M ++F +RGLL
Sbjct  319  VVESPAKIGAAMFELFQERGLL  340



>gb|KHG06820.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial 
[Gossypium arboreum]
Length=335

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+ +F+ADPQTEGI+LIGEIGGT
Sbjct  193  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTKFLADPQTEGIILIGEIGGT  252

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  253  AEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  312

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M DVF +RGLL
Sbjct  313  VVESPAKIGVAMHDVFKQRGLL  334



>gb|AGT16123.1| succinyl-CoA ligase [Saccharum hybrid cultivar R570]
Length=458

 Score =   218 bits (554),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGT
Sbjct  189  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGT  248

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FI+ES T+KPVVAFIAGLTAPPGRRMGHAGAIV+GGKGTAQDKI+ L+EAGVT
Sbjct  249  AEEDAATFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVAGGKGTAQDKIKALREAGVT  308

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G+TM ++F +RG++
Sbjct  309  VVESPAKIGSTMFEIFKQRGMV  330



>ref|XP_006441425.1| hypothetical protein CICLE_v10020931mg [Citrus clementina]
 gb|ESR54665.1| hypothetical protein CICLE_v10020931mg [Citrus clementina]
Length=347

 Score =   214 bits (546),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTT VGLGQSTCVG+GGDPFNGTNFVDCLE+F+ DPQTEGI+LIGEIGGT
Sbjct  205  SGTLTYEAVFQTTVVGLGQSTCVGVGGDPFNGTNFVDCLEKFLVDPQTEGIILIGEIGGT  264

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  265  AEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  324

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            V ESPAK+G+ ML+VF +RGL
Sbjct  325  VVESPAKIGSAMLEVFKQRGL  345



>ref|XP_006484523.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Citrus sinensis]
Length=331

 Score =   214 bits (545),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+ +F+ADPQTEGI+LIGEIGGT
Sbjct  189  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTKFIADPQTEGIILIGEIGGT  248

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  249  AEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  308

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            V ESPAK+G  ML+VF +RGL
Sbjct  309  VVESPAKIGAAMLEVFKQRGL  329



>ref|XP_006394592.1| hypothetical protein EUTSA_v10004347mg [Eutrema salsugineum]
 gb|ESQ31878.1| hypothetical protein EUTSA_v10004347mg [Eutrema salsugineum]
Length=401

 Score =   216 bits (549),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGT
Sbjct  259  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGT  318

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++A V 
Sbjct  319  AEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAEVK  378

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M ++F +RGLL
Sbjct  379  VVESPAKIGAAMFELFQERGLL  400



>ref|NP_001241205.1| uncharacterized protein LOC100782001 [Glycine max]
 gb|ACU24596.1| unknown [Glycine max]
Length=324

 Score =   213 bits (543),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCL++F+ DPQTEGI+LIGEIGGT
Sbjct  182  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLQKFLTDPQTEGIILIGEIGGT  241

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IK+SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGV 
Sbjct  242  AEEDAAALIKDSGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVM  301

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  MLDVF +RGL+
Sbjct  302  VVESPAKIGAAMLDVFKQRGLV  323



>ref|XP_010547709.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Tarenaya hassleriana]
Length=348

 Score =   214 bits (544),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV+CLE+F  DPQTEGI+LIGEIGGT
Sbjct  199  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVNCLEKFFVDPQTEGIILIGEIGGT  258

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++LK+AGVT
Sbjct  259  AEEEAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLKDAGVT  318

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G+ M D+F +RGLL
Sbjct  319  VVESPAKIGSAMHDIFQERGLL  340



>ref|XP_010546242.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Tarenaya hassleriana]
Length=346

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGI+LIGEIGGT
Sbjct  199  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIILIGEIGGT  258

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGVT
Sbjct  259  AEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVT  318

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  MLD+F  RGL+
Sbjct  319  VVESPAKIGAAMLDIFQDRGLV  340



>gb|KHN23614.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Glycine soja]
Length=345

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCL++F+ DPQTEGI+LIGEIGGT
Sbjct  203  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLQKFLTDPQTEGIILIGEIGGT  262

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IK+SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGV 
Sbjct  263  AEEDAAALIKDSGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVM  322

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  MLDVF +RGL+
Sbjct  323  VVESPAKIGAAMLDVFKQRGLV  344



>gb|KJB31853.1| hypothetical protein B456_005G211200 [Gossypium raimondii]
Length=346

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+ +F+ADPQTEGI+LIGEIGGT
Sbjct  204  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTKFLADPQTEGIILIGEIGGT  263

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  264  AEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  323

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M +VF +RGLL
Sbjct  324  VVESPAKIGVAMHEVFKQRGLL  345



>gb|KHG04322.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Gossypium arboreum]
Length=346

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+ +F+ADPQTEGI+LIGEIGGT
Sbjct  204  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTKFLADPQTEGIILIGEIGGT  263

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  264  AEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  323

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M +VF +RGLL
Sbjct  324  VVESPAKIGVAMHEVFKQRGLL  345



>ref|XP_002271746.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Vitis vinifera]
 emb|CBI29046.3| unnamed protein product [Vitis vinifera]
Length=329

 Score =   212 bits (539),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+++F+ADPQTEGI+LIGEIGGT
Sbjct  187  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVKKFLADPQTEGIILIGEIGGT  246

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL++ G T
Sbjct  247  AEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLRDVGAT  306

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  MLDVF +RGL+
Sbjct  307  VVESPAKIGVAMLDVFKQRGLV  328



>ref|XP_006437603.1| hypothetical protein CICLE_v10032075mg [Citrus clementina]
 gb|ESR50843.1| hypothetical protein CICLE_v10032075mg [Citrus clementina]
Length=331

 Score =   211 bits (538),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+ +F+ADPQTEGI+LIGEIGGT
Sbjct  189  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTKFIADPQTEGIILIGEIGGT  248

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKES TEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  249  AEEDAAALIKESRTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  308

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            V ESPAK+G  ML+VF +RGL
Sbjct  309  VVESPAKIGAAMLEVFKQRGL  329



>gb|KFK27646.1| hypothetical protein AALP_AA8G410300 [Arabis alpina]
Length=347

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGI+LIGEIGGT
Sbjct  205  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIILIGEIGGT  264

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGV 
Sbjct  265  AEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVK  324

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M D+F +RGLL
Sbjct  325  VVESPAKIGAAMFDIFQERGLL  346



>ref|XP_009122444.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Brassica rapa]
Length=347

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGT
Sbjct  204  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGT  263

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IK +GT  PVV+FIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV 
Sbjct  264  AEEDAAALIKANGTVNPVVSFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVK  323

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M D+F +RGLL
Sbjct  324  VVESPAKIGAAMYDLFKERGLL  345



>ref|XP_003620150.1| Succinyl-CoA ligase [Medicago truncatula]
 gb|AES76368.1| succinyl-CoA ligase [ADP-forming] subunit alpha-2 [Medicago truncatula]
Length=323

 Score =   210 bits (535),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV+QTTAVGLGQSTCVGIGGDPFNGTNFVDCL +F+ADPQTEGI+LIGEIGGT
Sbjct  181  SGTLTYEAVYQTTAVGLGQSTCVGIGGDPFNGTNFVDCLTKFLADPQTEGIILIGEIGGT  240

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI TL+EAGVT
Sbjct  241  AEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKISTLREAGVT  300

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M ++F ++GL+
Sbjct  301  VVESPAKIGAAMFEIFKQKGLV  322



>ref|XP_011003681.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Populus euphratica]
 ref|XP_011003682.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Populus euphratica]
Length=373

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+E+F+AD QTEGI+LIGEIGGT
Sbjct  231  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLADSQTEGIILIGEIGGT  290

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGTEKPV AFIAG TAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  291  AEEDAAALIKESGTEKPVAAFIAGQTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  350

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            V ESPAK+G  MLDVF +RGL
Sbjct  351  VVESPAKIGVAMLDVFKQRGL  371



>ref|XP_010031908.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Eucalyptus grandis]
 gb|KCW51304.1| hypothetical protein EUGRSUZ_J00864 [Eucalyptus grandis]
Length=333

 Score =   209 bits (533),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+ +F+ DPQTEGI+LIGEIGGT
Sbjct  191  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIRKFLVDPQTEGIILIGEIGGT  250

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKES TEKPVV FIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  251  AEEDAAALIKESKTEKPVVGFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  310

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  ML+VF +RGL+
Sbjct  311  VVESPAKIGAAMLEVFKQRGLV  332



>ref|XP_007043270.1| Succinyl-CoA ligase, alpha subunit [Theobroma cacao]
 gb|EOX99101.1| Succinyl-CoA ligase, alpha subunit [Theobroma cacao]
Length=351

 Score =   209 bits (533),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+ +F+ DPQTEGIV+IGEIGGT
Sbjct  209  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTKFLDDPQTEGIVIIGEIGGT  268

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  269  AEEDAAALIKESGTKKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  328

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  ML+VF +RGL+
Sbjct  329  VVESPAKIGVAMLNVFKERGLV  350



>ref|XP_010454606.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Camelina sativa]
Length=346

 Score =   209 bits (532),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGI+LIGEIGGT
Sbjct  204  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIILIGEIGGT  263

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGV 
Sbjct  264  AEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVK  323

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M ++F +RGLL
Sbjct  324  VVESPAKIGAAMFEIFQERGLL  345



>ref|XP_010421123.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Camelina sativa]
Length=345

 Score =   209 bits (531),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGI+LIGEIGGT
Sbjct  203  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIILIGEIGGT  262

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGV 
Sbjct  263  AEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVK  322

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M ++F +RGLL
Sbjct  323  VVESPAKIGAAMFEIFQERGLL  344



>ref|XP_010493442.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Camelina sativa]
Length=345

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGI+LIGEIGGT
Sbjct  203  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIILIGEIGGT  262

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGV 
Sbjct  263  AEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVK  322

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M ++F +RGLL
Sbjct  323  VVESPAKIGAAMFEIFQERGLL  344



>ref|XP_006288023.1| hypothetical protein CARUB_v10001256mg, partial [Capsella rubella]
 gb|EOA20921.1| hypothetical protein CARUB_v10001256mg, partial [Capsella rubella]
Length=359

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGI+LIGEIGGT
Sbjct  217  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIILIGEIGGT  276

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGV 
Sbjct  277  AEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVK  336

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  M ++F +RGLL
Sbjct  337  VVESPAKIGAAMFEIFQERGLL  358



>ref|XP_010069514.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Eucalyptus grandis]
 gb|KCW57892.1| hypothetical protein EUGRSUZ_H00643 [Eucalyptus grandis]
Length=339

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFV DPQTEGI+LIGEIGGT
Sbjct  196  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVVDPQTEGIILIGEIGGT  255

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAAFIKES TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQ KI  L+EAGVT
Sbjct  256  AEEDAAAFIKESKTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQGKIEALREAGVT  315

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAK+G  MLDV  ++GL+
Sbjct  316  VVESPAKIGAAMLDVLKQKGLV  337



>ref|XP_010688675.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Beta vulgaris subsp. vulgaris]
Length=342

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQT+AVGLGQST VGIGGDPFNGTNFVDCLE+F+ DPQTEGI+LIGEIGGT
Sbjct  200  SGTLTYEAVFQTSAVGLGQSTVVGIGGDPFNGTNFVDCLEKFIEDPQTEGIILIGEIGGT  259

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA IKES TEKPVV+FIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI TL+ AGVT
Sbjct  260  AEEDAAAVIKESKTEKPVVSFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKITTLRGAGVT  319

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPA++G  MLDVF +RGLL
Sbjct  320  VVESPAQMGAAMLDVFKQRGLL  341



>gb|EMT17065.1| Putative succinyl-CoA ligase (GDP-forming) subunit alpha, mitochondrial 
[Aegilops tauschii]
Length=356

 Score =   204 bits (520),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 136/168 (81%), Gaps = 26/168 (15%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTE-----------  591
            SGTLTYEAVFQTTAVGLGQSTCVG+GGDPFNGTNFVDCLE+FV DPQTE           
Sbjct  188  SGTLTYEAVFQTTAVGLGQSTCVGMGGDPFNGTNFVDCLEKFVDDPQTEVMFSSVNAVIS  247

Query  590  ---------------GIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMG  456
                           GIVLIGEIGGTAEE+AAAFI+ES TEKPVVAFIAGLTAPPGRRMG
Sbjct  248  LLSIILIGKIGMCLLGIVLIGEIGGTAEEDAAAFIRESKTEKPVVAFIAGLTAPPGRRMG  307

Query  455  HAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  312
            HAGAIVSGGKGTAQDKI+ L++AGVTV ESPAK+G+TM ++F +RG++
Sbjct  308  HAGAIVSGGKGTAQDKIKALRDAGVTVVESPAKIGSTMFELFKQRGMV  355



>ref|XP_009389047.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Musa acuminata subsp. malaccensis]
Length=341

 Score =   204 bits (519),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTT VGLGQSTCVGIGGDPFNGTNFVDC+ +F+ DPQTEGI+LIGEIGGT
Sbjct  199  SGTLTYEAVFQTTNVGLGQSTCVGIGGDPFNGTNFVDCITKFLDDPQTEGIILIGEIGGT  258

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAA I ESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGV 
Sbjct  259  AEEDAAALILESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVM  318

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            V ESPAK+G  ML+VF +RGL
Sbjct  319  VVESPAKIGVAMLEVFKQRGL  339



>ref|XP_006376608.1| hypothetical protein POPTR_0012s00920g [Populus trichocarpa]
 gb|ERP54405.1| hypothetical protein POPTR_0012s00920g [Populus trichocarpa]
Length=282

 Score =   200 bits (509),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -3

Query  734  GTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggta  555
            G   ++ VFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+E+F+AD QTEGI+LIGEIGGTA
Sbjct  141  GIPQHDMVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLADSQTEGIILIGEIGGTA  200

Query  554  eeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTV  375
            EE+AAA IKESGTEKPVVAFIAG TAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV
Sbjct  201  EEDAAALIKESGTEKPVVAFIAGQTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTV  260

Query  374  CESPAKLGTTMLDVFTKRGL  315
             ESPAK+G  MLDVF +RGL
Sbjct  261  VESPAKIGVAMLDVFKQRGL  280



>ref|XP_001780609.1| predicted protein [Physcomitrella patens]
 gb|EDQ54592.1| predicted protein [Physcomitrella patens]
Length=299

 Score =   192 bits (487),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTT VGLGQSTC+GIGGDPF+GT+FVDCL  FV DPQTEG+VLIGEIGG+
Sbjct  158  SGTLTYEAVFQTTRVGLGQSTCIGIGGDPFSGTSFVDCLRCFVKDPQTEGVVLIGEIGGS  217

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
             EE+AA FI  SGT+KPVVAF+AGLTAPPGRRMGHAGAI++GG+GTAQ K++ L+ AGVT
Sbjct  218  GEEDAARFIVSSGTQKPVVAFVAGLTAPPGRRMGHAGAIIAGGRGTAQAKMKALRAAGVT  277

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPA LG T+L VF  R LL
Sbjct  278  VVESPAHLGKTILKVFRDRRLL  299



>ref|XP_001693108.1| succinyl-coa ligase alpha chain [Chlamydomonas reinhardtii]
 ref|XP_001693109.1| succinyl-CoA ligase [Chlamydomonas reinhardtii]
 gb|EDP03134.1| succinyl-coa ligase alpha chain [Chlamydomonas reinhardtii]
 gb|EDP03135.1| succinyl-CoA ligase [Chlamydomonas reinhardtii]
Length=329

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTT  GLGQST VGIGGDPFNGTNFVDCLERFV DPQTEGI++IGEIGGT
Sbjct  188  SGTLTYEAVFQTTNQGLGQSTVVGIGGDPFNGTNFVDCLERFVKDPQTEGIIMIGEIGGT  247

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA FI++SGT+KPVV+FIAGLTAPPGRRMGHAGAI+SGGKGTA DKI+ L+EAGVT
Sbjct  248  AEEEAAEFIRKSGTKKPVVSFIAGLTAPPGRRMGHAGAIISGGKGTATDKIKALEEAGVT  307

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            V  SPA++G TM+ V  +RGL
Sbjct  308  VTRSPAQMGVTMMRVMKERGL  328



>gb|KFH07184.1| succinyl-CoA-synthetase alpha SCSA, partial [Toxoplasma gondii 
MAS]
Length=147

 Score =   184 bits (468),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 121/142 (85%), Gaps = 1/142 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT  GLGQSTCVGIGGDPFNGTNF+DCLERFV DP+T+GIVLIGEIGG+
Sbjct  5    SGTLTYEAVNQTTQTGLGQSTCVGIGGDPFNGTNFIDCLERFVNDPETKGIVLIGEIGGS  64

Query  557  aeeeaaafIKESGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEEEAAA++KE   E KPVV+FIAGLTAPPGRRMGHAGAIVSGGKGTA+ KI  L++AGV
Sbjct  65   AEEEAAAWLKEHNKEQKPVVSFIAGLTAPPGRRMGHAGAIVSGGKGTAEGKIAALEDAGV  124

Query  380  TVCESPAKLGTTMLDVFTKRGL  315
             V  +PA +G  ML+V    GL
Sbjct  125  HVVRNPAAMGQKMLEVMQAAGL  146



>ref|XP_011398589.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Auxenochlorella protothecoides]
 gb|KFM25693.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Auxenochlorella protothecoides]
Length=321

 Score =   190 bits (483),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTT  GLGQST VGIGGDPFNGTNFVDCLERFVADPQTEGI++IGEIGGT
Sbjct  180  SGTLTYEAVFQTTQQGLGQSTVVGIGGDPFNGTNFVDCLERFVADPQTEGIIMIGEIGGT  239

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA F++ SGT+KPVV+FIAGLTAPPGRRMGHAGAI+SGGKGTA DKI  L+ AGVT
Sbjct  240  AEEEAADFLRASGTDKPVVSFIAGLTAPPGRRMGHAGAIISGGKGTAGDKIAALEAAGVT  299

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V +SPA++G  M  +F +RGLL
Sbjct  300  VSQSPAQMGVAMKKLFEERGLL  321



>gb|KDD74604.1| hypothetical protein H632_c1190p0 [Helicosporidium sp. ATCC 50920]
Length=326

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV+QTTA GLGQST VGIGGDPFNGTNFVDCLERFV DPQTEGI++IGEIGGT
Sbjct  185  SGTLTYEAVYQTTAEGLGQSTVVGIGGDPFNGTNFVDCLERFVEDPQTEGIIMIGEIGGT  244

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA FI+ SGT+KPVV+FIAGLTAPPGRRMGHAGAIVSGGKGTA DKI  L+ AGVT
Sbjct  245  AEEEAAEFIRASGTDKPVVSFIAGLTAPPGRRMGHAGAIVSGGKGTAADKIAALEAAGVT  304

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V +SPA++G  M  +F +R LL
Sbjct  305  VSQSPAQMGAAMKRIFKERNLL  326



>ref|XP_002957241.1| succinate-coa ligase alpha chain, succinyl-CoA synthetase mitochondrial 
precursor [Volvox carteri f. nagariensis]
 gb|EFJ41739.1| succinate-coa ligase alpha chain, succinyl-CoA synthetase mitochondrial 
precursor [Volvox carteri f. nagariensis]
Length=328

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTT  GLGQST VGIGGDPFNGTNFVDCLERFV DPQTEGI++IGEIGGT
Sbjct  187  SGTLTYEAVFQTTNQGLGQSTVVGIGGDPFNGTNFVDCLERFVKDPQTEGIIMIGEIGGT  246

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA FIK SGT+KPVV+FIAGLTAPPGRRMGHAGAI+SGGKG A DKI  L+ AGVT
Sbjct  247  AEEEAAEFIKASGTQKPVVSFIAGLTAPPGRRMGHAGAIISGGKGRASDKIEALESAGVT  306

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            V  SPA++G+TM+ V  +RGL
Sbjct  307  VTRSPAQMGSTMMRVMRERGL  327



>ref|XP_003078495.1| putative succinyl-CoA ligase alpha subunit (ISS) [Ostreococcus 
tauri]
 emb|CAL53236.1| Succinyl-CoA synthetase-like [Ostreococcus tauri]
Length=331

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV+QTT  GLGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGI++IGEIGGT
Sbjct  190  SGTLTYEAVYQTTVTGLGQSTCVGIGGDPFNGTNFVDCLEKFVKDPQTEGIIMIGEIGGT  249

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA FI+ SGT+KP+V+FIAGLTAPPGRRMGHAGAI+SGGKG A DKI  L+ AGV 
Sbjct  250  AEEEAAEFIRASGTDKPIVSFIAGLTAPPGRRMGHAGAIISGGKGGASDKIAALEAAGVR  309

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V +SPAK+G  M D+F +R +L
Sbjct  310  VVKSPAKMGQAMYDMFAERKML  331



>ref|XP_005643816.1| succinyl-CoA ligase alpha chain [Coccomyxa subellipsoidea C-169]
 gb|EIE19272.1| succinyl-CoA ligase alpha chain [Coccomyxa subellipsoidea C-169]
Length=299

 Score =   187 bits (474),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTT  GLGQST VGIGGDPFNGTNFVDCLERF+ DPQTEGI++IGEIGGT
Sbjct  158  SGTLTYEAVFQTTQQGLGQSTVVGIGGDPFNGTNFVDCLERFLKDPQTEGIIMIGEIGGT  217

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA  IK SGT+KP+++FIAGLTAPPGRRMGHAGAI+SGGKGTA DKI  L+ AGVT
Sbjct  218  AEEEAAELIKASGTDKPILSFIAGLTAPPGRRMGHAGAIISGGKGTATDKINALESAGVT  277

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            V +SPA++GT M  + ++RGL
Sbjct  278  VVKSPAQMGTAMKKIMSERGL  298



>ref|XP_005843440.1| hypothetical protein CHLNCDRAFT_141133 [Chlorella variabilis]
 gb|EFN51338.1| hypothetical protein CHLNCDRAFT_141133 [Chlorella variabilis]
Length=330

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTT  GLGQST VGIGGDPFNGTNFVDCLERFV DPQTEGI++IGEIGG+
Sbjct  189  SGTLTYEAVFQTTNEGLGQSTVVGIGGDPFNGTNFVDCLERFVLDPQTEGIIMIGEIGGS  248

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA F+  SGT KPVV+FIAGLTAPPGRRMGHAGAI+SGGKGTAQDKI+ L+ AGVT
Sbjct  249  AEEEAAEFLIASGTTKPVVSFIAGLTAPPGRRMGHAGAIISGGKGTAQDKIKALEAAGVT  308

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            V  SPA++G TM  V  +RGL
Sbjct  309  VTNSPAQMGVTMKRVMQERGL  329



>ref|XP_001416813.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95106.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=344

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV+QTT  GLGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGI++IGEIGGT
Sbjct  203  SGTLTYEAVYQTTVAGLGQSTCVGIGGDPFNGTNFVDCLEKFVKDPQTEGIIMIGEIGGT  262

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA FI+ SGTEKP+V+FIAGLTAPPGRRMGHAGAI+SGGKG+A DKI  L+  GV 
Sbjct  263  AEEEAAEFIRASGTEKPIVSFIAGLTAPPGRRMGHAGAIISGGKGSAGDKIAALERVGVR  322

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V +SPAK+G  M ++F +R +L
Sbjct  323  VVKSPAKMGQAMYEMFGERNML  344



>ref|XP_002368454.1| succinyl-CoA ligase alpha subunit, putative [Toxoplasma gondii 
ME49]
 gb|EPR59792.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii GT1]
 gb|EPT28025.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii ME49]
 gb|ESS33942.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii VEG]
 gb|KFG27848.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii p89]
 gb|KFG42366.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG53411.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii FOU]
 gb|KFG62784.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii RUB]
 gb|KFH09138.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii VAND]
Length=333

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 121/142 (85%), Gaps = 1/142 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT  GLGQSTCVGIGGDPFNGTNF+DCLERFV DP+T+GIVLIGEIGG+
Sbjct  191  SGTLTYEAVNQTTQTGLGQSTCVGIGGDPFNGTNFIDCLERFVNDPETKGIVLIGEIGGS  250

Query  557  aeeeaaafIKESGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEEEAAA++KE   E KPVV+FIAGLTAPPGRRMGHAGAIVSGGKGTA+ KI  L++AGV
Sbjct  251  AEEEAAAWLKEHNKEQKPVVSFIAGLTAPPGRRMGHAGAIVSGGKGTAEGKIAALEDAGV  310

Query  380  TVCESPAKLGTTMLDVFTKRGL  315
             V  +PA +G  ML+V    GL
Sbjct  311  HVVRNPAAMGQKMLEVMQAAGL  332



>ref|XP_008889195.1| succinyl-CoA-synthetase alpha SCSA [Hammondia hammondi]
 gb|KEP60333.1| succinyl-CoA-synthetase alpha SCSA [Hammondia hammondi]
Length=333

 Score =   183 bits (465),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 121/142 (85%), Gaps = 1/142 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT  GLGQSTCVGIGGDPFNGTNF+DCLERFV DP+T+GIVLIGEIGG+
Sbjct  191  SGTLTYEAVNQTTQTGLGQSTCVGIGGDPFNGTNFIDCLERFVNDPETKGIVLIGEIGGS  250

Query  557  aeeeaaafIKESGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEEEAAA++KE   E KPVV+FIAGLTAPPGRRMGHAGAIVSGGKGTA+ KI  L++AGV
Sbjct  251  AEEEAAAWLKEHNKERKPVVSFIAGLTAPPGRRMGHAGAIVSGGKGTAEGKIAALEDAGV  310

Query  380  TVCESPAKLGTTMLDVFTKRGL  315
             V  +PA +G  ML+V    GL
Sbjct  311  HVVRNPAAMGQKMLEVMQAAGL  332



>ref|XP_003881225.1| 2-oxoglutarate dehydrogenase E1 component,related [Neospora caninum 
Liverpool]
 emb|CBZ51192.1| 2-oxoglutarate dehydrogenase E1 component,related [Neospora caninum 
Liverpool]
Length=361

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 121/142 (85%), Gaps = 1/142 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            +GTLTYEAV QTT  GLGQSTCVGIGGDPFNGTNF+DCLERFV DP+T+GIVLIGEIGG+
Sbjct  219  TGTLTYEAVNQTTQTGLGQSTCVGIGGDPFNGTNFIDCLERFVNDPETKGIVLIGEIGGS  278

Query  557  aeeeaaafIKESGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEEEAAA++KE   E KPVV+FIAGLTAPPGRRMGHAGAIVSGGKGTA+ KI  L++AGV
Sbjct  279  AEEEAAAWLKEHNKEQKPVVSFIAGLTAPPGRRMGHAGAIVSGGKGTAEGKIAALEDAGV  338

Query  380  TVCESPAKLGTTMLDVFTKRGL  315
             V  +PA +G  ML+V    GL
Sbjct  339  HVVRNPAAMGQKMLEVMQAAGL  360



>ref|XP_002610474.1| hypothetical protein BRAFLDRAFT_124275 [Branchiostoma floridae]
 gb|EEN66484.1| hypothetical protein BRAFLDRAFT_124275 [Branchiostoma floridae]
Length=323

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 119/144 (83%), Gaps = 3/144 (2%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT  GLGQ+ C+GIGGDPFNGTNFVDCLE F+ DP T+GIV+IGEIGG+
Sbjct  180  SGTLTYEAVHQTTRAGLGQTLCIGIGGDPFNGTNFVDCLEVFLGDPATKGIVMIGEIGGS  239

Query  557  aeeeaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEA  387
             EE AA ++KE  T   +KPVV+FIAG+TAPPGRRMGHAGAI+SGGKG AQDKI+ L+EA
Sbjct  240  MEESAAEYLKEHNTGPNKKPVVSFIAGVTAPPGRRMGHAGAIISGGKGAAQDKIQALQEA  299

Query  386  GVTVCESPAKLGTTMLDVFTKRGL  315
            GV V  SPA++GTTML    K GL
Sbjct  300  GVEVTMSPAQMGTTMLQEMQKLGL  323



>emb|CBJ28950.1| Succinate--CoA ligase (GDP-forming), alpha subunit [Ectocarpus 
siliculosus]
Length=322

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV+QTT  G+GQSTCVGIGGDPFNGTNF+DCLERF  DP+TEGIV+IGEIGG 
Sbjct  179  SGTLTYEAVWQTTVTGMGQSTCVGIGGDPFNGTNFIDCLERFTKDPETEGIVMIGEIGGQ  238

Query  557  aeeeaaafIKESGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEE+AA ++ E G   KPVV+FIAG TAPPGRRMGHAGAI+SGGKGTA  K   L++AGV
Sbjct  239  AEEDAAEWLMEHGDPAKPVVSFIAGSTAPPGRRMGHAGAIISGGKGTAAAKFAALEDAGV  298

Query  380  TVCESPAKLGTTMLDVFTKRGL  315
             +  SPA+LG+TM+  F +RG+
Sbjct  299  YISRSPAQLGSTMVRAFEERGM  320



>gb|ABE76513.1| mitochondrial putative GDP-forming succinate-CoA ligase alpha 
subunit [Toxoplasma gondii]
Length=333

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 119/137 (87%), Gaps = 1/137 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT  GLGQSTCVGIGGDPFNGTNF+DCLERFV DP+T+GIVLIGEIGG+
Sbjct  191  SGTLTYEAVNQTTQTGLGQSTCVGIGGDPFNGTNFIDCLERFVNDPETKGIVLIGEIGGS  250

Query  557  aeeeaaafIKESGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEEEAAA++KE   E KPVV+FIAGLTAPPGRRMGHAGAIVSGGKGTA+ KI  L++AGV
Sbjct  251  AEEEAAAWLKEHNKEQKPVVSFIAGLTAPPGRRMGHAGAIVSGGKGTAEGKIAALEDAGV  310

Query  380  TVCESPAKLGTTMLDVF  330
             V  +PA +G  ML+V 
Sbjct  311  HVVRNPAAMGQKMLEVM  327



>gb|EFA80958.1| Endo-beta-N-acetylglucosaminidase [Polysphondylium pallidum PN500]
Length=1362

 Score =   187 bits (476),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 106/142 (75%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDPFNGTNFVDCL+ F  DPQTEGI+LIGEIGG 
Sbjct  180  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPFNGTNFVDCLKLFTKDPQTEGIILIGEIGGE  239

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA +++E+ T+KPVV+FIAGLTAPPGRRMGHAGAI+SGGKG A  K++ L++AGV 
Sbjct  240  AEEEAAQWLRENPTDKPVVSFIAGLTAPPGRRMGHAGAIISGGKGGADSKMKALQDAGVI  299

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            +  SPAKLGTTML+   +R   
Sbjct  300  MSLSPAKLGTTMLEAMNRRNFF  321



>ref|XP_004351803.1| succinate-CoA ligase [Dictyostelium fasciculatum]
 gb|EGG15083.1| succinate-CoA ligase [Dictyostelium fasciculatum]
Length=320

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDPFNGTNFVDCL+ F  DPQTEGI+LIGEIGG 
Sbjct  179  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPFNGTNFVDCLKLFTKDPQTEGIILIGEIGGE  238

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA ++KE+ T+KPVV+FIAGLTAPPGRRMGHAGAI+SGGKG A  K++ L++AGV 
Sbjct  239  AEEEAALWLKENPTDKPVVSFIAGLTAPPGRRMGHAGAIISGGKGGADSKMKALQDAGVI  298

Query  377  VCESPAKLGTTMLDVFTKRG  318
            +  SPAKLG TML+   K G
Sbjct  299  MSLSPAKLGVTMLEAMKKIG  318



>ref|WP_038538362.1| MULTISPECIES: succinate--CoA ligase [unclassified Holosporaceae]
 gb|AIF80946.1| succinyl-CoA synthetase subunit alpha [endosymbiont of Acanthamoeba 
sp. UWC8]
 gb|KIE05138.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [endosymbiont 
of Acanthamoeba sp. UWC36]
Length=292

 Score =   176 bits (447),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAV LGQSTCVGIGGDP NGTNFVD LE FV D +TE I++IGEIGGT
Sbjct  154  SGTLTYEAVAQTTAVNLGQSTCVGIGGDPVNGTNFVDVLELFVKDEETEAIIMIGEIGGT  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AE + A FIKES T+KPVV FIAG+TAPPG+RMGHAGAIVSGG+ TA+ KI  +K AG+ 
Sbjct  214  AEVDGANFIKESKTKKPVVGFIAGITAPPGKRMGHAGAIVSGGQDTAESKIEAMKSAGIF  273

Query  377  VCESPAKLGTTMLDVFTKR  321
            V ESPA LGTTMLD    +
Sbjct  274  VSESPASLGTTMLDALKSK  292



>dbj|GAM28077.1| hypothetical protein SAMD00019534_112530 [Acytostelium subglobosum 
LB1]
Length=320

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDPFNGTNFVDCL+ F  DPQTEGI+LIGEIGG 
Sbjct  181  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPFNGTNFVDCLKLFTQDPQTEGIILIGEIGGE  240

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA +++++ T KPVV+FIAGLTAPPGRRMGHAGAI+SGGKG A  K++ L++AGV 
Sbjct  241  AEEEAAQWLRDNPTNKPVVSFIAGLTAPPGRRMGHAGAIISGGKGGADSKMKALQDAGVV  300

Query  377  VCESPAKLGTTMLDVFTKR  321
            +  SPAKLGTTML+V   R
Sbjct  301  MSLSPAKLGTTMLEVMNSR  319



>ref|WP_014363954.1| succinyl-CoA synthetase subsunit alpha [Rickettsia canadensis]
 gb|AFB21145.1| succinyl-CoA synthetase subunit alpha [Rickettsia canadensis 
str. CA410]
Length=292

 Score =   176 bits (447),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+A+ FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK+  L+ AG+T
Sbjct  214  AEEDASDFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGIT  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  274  ITRSPADIGKTMLDLLNK  291



>ref|WP_040257675.1| MULTISPECIES: succinate--CoA ligase [spotted fever group]
 gb|KIJ89270.1| succinate--CoA ligase [Candidatus Rickettsia asemboensis]
Length=292

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC++ F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIDMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK+  L+ AGVT
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVT  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  274  ITRSPADIGKTMLDLLNK  291



>ref|WP_028099766.1| succinate--CoA ligase [Dongia sp. URHE0060]
Length=291

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA GLGQSTC+GIGGDP NGTNFVDCL+ F+ DP+T+GIV+IGEIGG+
Sbjct  154  SGTLTYEAVAQTTAAGLGQSTCIGIGGDPVNGTNFVDCLDLFLGDPETQGIVMIGEIGGS  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA F+K S  +KPVV FIAG+TAPPGRRMGHAGAI+SGGKG A DKI  +K AG++
Sbjct  214  AEEEAATFLKASKVKKPVVGFIAGVTAPPGRRMGHAGAIISGGKGGAGDKIEAMKSAGIS  273

Query  377  VCESPAKLGTTMLDVFTK  324
            V ESPA LG+ M+    K
Sbjct  274  VAESPASLGSAMVKAMGK  291



>ref|XP_001425910.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK58512.1| unnamed protein product [Paramecium tetraurelia]
Length=312

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT  GLGQST VGIGGDPFNGTNF+D LERF+ DP+TEGIV+IGEIGG 
Sbjct  170  SGTLTYEAVDQTTRAGLGQSTVVGIGGDPFNGTNFIDVLERFMVDPETEGIVMIGEIGGE  229

Query  557  aeeeaaafIKESGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
             EE AA +IK++  + KPVV FIAG+TAPP RRMGHAGAIVS GKG+A +KIR L++AG+
Sbjct  230  NEEMAAEWIKQNNPKNKPVVGFIAGITAPPERRMGHAGAIVSKGKGSAPEKIRALEQAGI  289

Query  380  TVCESPAKLGTTMLDVFTKRGL  315
             V +SPA++G TML+V  +RGL
Sbjct  290  RVVKSPAQIGKTMLEVMKERGL  311



>ref|WP_014014291.1| MULTISPECIES: succinyl-CoA synthetase subsunit alpha [spotted 
fever group]
 gb|AEK74640.1| succinyl-CoA synthetase subunit alpha [Rickettsia heilongjiangensis 
054]
 dbj|BAK96677.1| succinyl-CoA synthetase alpha subunit [Rickettsia japonica YH]
Length=292

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ GG G+A+DK+ TL+ AGVT
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGGTGSAEDKLETLQSAGVT  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  274  ITRSPADIGKTMLDLLNK  291



>emb|CCQ75435.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Magnetospira 
sp. QH-2]
Length=291

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT  GLGQSTC+GIGGDP NGTNF+DCL+ F+ADP+T+GIV+IGEIGG+
Sbjct  154  SGTLTYEAVAQTTTAGLGQSTCIGIGGDPVNGTNFIDCLDLFLADPETQGIVMIGEIGGS  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S T+KPVV FIAG+TAPPG+RMGHAGAI+SGGKGTA  KI  ++ AG+ 
Sbjct  214  AEEDAAEFIKQSKTKKPVVGFIAGVTAPPGKRMGHAGAIISGGKGTADAKIEAMRSAGIE  273

Query  377  VCESPAKLGTTML  339
            V +SPA LG+TML
Sbjct  274  VADSPAALGSTML  286



>ref|WP_017443052.1| succinyl-CoA synthetase subsunit alpha [Candidatus Rickettsia 
gravesii]
Length=292

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GG G+A+DK+  L+ AGVT
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGTGSAEDKLEALQSAGVT  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  274  ITRSPADIGKTMLDLLNK  291



>ref|WP_008579810.1| MULTISPECIES: succinyl-CoA synthetase subsunit alpha [Rickettsia]
 gb|EER21581.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Rickettsia endosymbiont 
of Ixodes scapularis]
 gb|KDO03309.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Rickettsia sp. 
ISO7]
Length=292

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP N TNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNDTNFVDCIEMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK+  L+ AGVT
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVT  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  274  ITRSPADIGKTMLDLLNK  291



>ref|WP_012152767.1| MULTISPECIES: succinyl-CoA synthetase subsunit alpha [spotted 
fever group]
 gb|ABV84792.1| Succinyl-CoA synthetase alpha chain [Rickettsia massiliae MTU5]
 gb|AFB31772.1| succinyl-CoA synthetase subunit alpha [Rickettsia massiliae str. 
AZT80]
 gb|AFC72363.1| succinyl-CoA synthetase subunit alpha [Rickettsia rhipicephali 
str. 3-7-female6-CWPP]
Length=292

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GG G+A+DK+  L+ AGVT
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGTGSAKDKLEALQSAGVT  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  274  ITRSPADIGKTMLDLLNK  291



>ref|WP_014392217.1| succinyl-CoA synthetase subsunit alpha [Candidatus Rickettsia 
amblyommii]
 gb|AFC69698.1| succinyl-CoA synthetase subunit alpha [Candidatus Rickettsia 
amblyommii str. GAT-30V]
Length=292

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GG G+A+DK+  L+ AGVT
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIITGGTGSAEDKLEALQSAGVT  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  274  ITRSPADIGKTMLDLLNK  291



>ref|WP_032138585.1| succinate--CoA ligase [Rickettsia tamurae]
Length=292

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP N TNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNDTNFVDCIEMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK+  L+ AGVT
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVT  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  274  ITRSPADIGKTMLDLLNK  291



>ref|XP_005837665.1| hypothetical protein GUITHDRAFT_157241 [Guillardia theta CCMP2712]
 gb|EKX50685.1| hypothetical protein GUITHDRAFT_157241 [Guillardia theta CCMP2712]
Length=297

 Score =   174 bits (442),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV+QTT +GLGQS  VGIGGDPFNGT+  DC+E F+ DP TEGIVLIGEIGG+
Sbjct  159  SGTLTYEAVYQTTQMGLGQSIVVGIGGDPFNGTSHKDCVEFFLQDPDTEGIVLIGEIGGS  218

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            +EEEAA  +K S  +KP V+FIAGLTAPPGRRMGHAGAI+SGGKGTAQDKI+ L+ AGV 
Sbjct  219  SEEEAAEVMKNSKIKKPAVSFIAGLTAPPGRRMGHAGAIISGGKGTAQDKIKALESAGVY  278

Query  377  VCESPAKLGTTMLDVFTK  324
            V  SPAK+G TM+    K
Sbjct  279  VTNSPAKIGETMMKAMGK  296



>ref|WP_012148768.1| succinyl-CoA synthetase subsunit alpha [Rickettsia canadensis]
 gb|ABV73572.1| succinyl-CoA synthetase alpha subunit [Rickettsia canadensis 
str. McKiel]
Length=292

 Score =   174 bits (441),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+A+ FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK+  L+ AG+T
Sbjct  214  AEEDASDFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGIT  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +   PA +G TMLD+  K
Sbjct  274  ITRCPADIGKTMLDLLNK  291



>ref|WP_039594975.1| succinate--CoA ligase [Rickettsia felis]
 gb|KHO03566.1| succinate--CoA ligase [Rickettsia felis]
Length=292

 Score =   174 bits (441),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC++ F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIDMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK+  L+ AGVT
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVT  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TM D+  K
Sbjct  274  ITRSPADIGKTMFDLLNK  291



>ref|WP_011270994.1| succinyl-CoA synthetase subsunit alpha [Rickettsia felis]
 sp|Q4ULQ8.1|SUCD_RICFE RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha; 
AltName: Full=Succinyl-CoA synthetase subunit alpha; Short=SCS-alpha 
[Rickettsia felis URRWXCal2]
 gb|AAY61515.1| Succinyl-CoA synthetase alpha chain [Rickettsia felis URRWXCal2]
 gb|KHO02928.1| succinate--CoA ligase [Rickettsia felis str. LSU]
Length=292

 Score =   174 bits (440),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC++ F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIDMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK+  L+ AGVT
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVT  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TM D+  K
Sbjct  274  ITRSPADIGKTMFDLLNK  291



>ref|WP_014409142.1| succinyl-CoA synthetase subsunit alpha [Rickettsia montanensis]
 emb|CAC33597.1| Succinyl-CoA synthetase alpha subunit [Rickettsia montanensis]
 gb|AFC72998.1| succinyl-CoA synthetase subunit alpha [Rickettsia montanensis 
str. OSU 85-930]
Length=292

 Score =   174 bits (440),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT VGLGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTTVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GG G+A+DKI  L+ AGVT
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGTGSAEDKIEALQSAGVT  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  274  ITRSPADIGKTMLDLLNK  291



>ref|XP_008871215.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Aphanomyces invadans]
 gb|ETW00190.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Aphanomyces invadans]
Length=312

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 119/140 (85%), Gaps = 1/140 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT  GLGQST +GIGGDPFNGTNF+DCLERF  DP+TEGI++IGEIGGT
Sbjct  170  SGTLTYEAVHQTTTTGLGQSTVIGIGGDPFNGTNFIDCLERFTNDPETEGIIMIGEIGGT  229

Query  557  aeeeaaafIKESGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEEEAA ++ E G   KPVV+FIAG+TAPPGRRMGHAGAIVSGGKGTA+ K   L++AGV
Sbjct  230  AEEEAAEWLMEHGDPNKPVVSFIAGITAPPGRRMGHAGAIVSGGKGTAEGKFAALEKAGV  289

Query  380  TVCESPAKLGTTMLDVFTKR  321
            TV  SPA+LGTTML  F KR
Sbjct  290  TVTRSPARLGTTMLQQFAKR  309



>ref|WP_012151579.1| succinyl-CoA synthetase subsunit alpha [Rickettsia bellii]
 gb|ABV78618.1| succinyl-CoA synthetase subunit alpha [Rickettsia bellii OSU 
85-389]
Length=291

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC++ F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPINGTNFVDCIDMFLQDDETKAIIMIGEIGGD  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE AA FIK S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK+  L+ AGVT
Sbjct  214  AEENAADFIKHSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVT  273

Query  377  VCESPAKLGTTMLDVFT  327
            +  SPA +G TMLD+  
Sbjct  274  ITRSPADIGKTMLDLLN  290



>ref|WP_012149562.1| succinyl-CoA synthetase subsunit alpha [Rickettsia akari]
 gb|ABV74929.1| succinyl-CoA synthetase subunit alpha [Rickettsia akari str. 
Hartford]
Length=292

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC++ F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIDMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GG+G+A+DK+  L+ AGVT
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGQGSAEDKLEVLQSAGVT  273

Query  377  VCESPAKLGTTMLDVFTK  324
            + +SPA +G TM D+  K
Sbjct  274  ITKSPADIGKTMFDLLNK  291



>ref|XP_001452638.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK85241.1| unnamed protein product [Paramecium tetraurelia]
Length=312

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT  GLGQST VGIGGDPFNGTNF+D LERF+ DP+TEGIV+IGEIGG 
Sbjct  170  SGTLTYEAVDQTTRAGLGQSTVVGIGGDPFNGTNFIDVLERFMVDPETEGIVMIGEIGGE  229

Query  557  aeeeaaafIKESGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
             EE AA +IK++  + KPVV FIAG+TAPP RRMGHAGAIVS GKG+A +KIR L++AG+
Sbjct  230  NEEMAADWIKKNNPKNKPVVGFIAGITAPPERRMGHAGAIVSKGKGSAPEKIRALEQAGI  289

Query  380  TVCESPAKLGTTMLDVFTKRGL  315
             V +SPA++G TML+V  ++GL
Sbjct  290  RVVKSPAQIGKTMLEVMKEKGL  311



>ref|WP_011477883.1| succinyl-CoA synthetase subsunit alpha [Rickettsia bellii]
 sp|Q1RH56.1|SUCD_RICBR RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha; 
AltName: Full=Succinyl-CoA synthetase subunit alpha; Short=SCS-alpha 
[Rickettsia bellii RML369-C]
 gb|ABE05308.1| Succinyl-CoA synthetase alpha chain [Rickettsia bellii RML369-C]
Length=291

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC++ F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIDMFLQDDETKAIIMIGEIGGD  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE AA FIK S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK+  L+ AGVT
Sbjct  214  AEENAADFIKHSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVT  273

Query  377  VCESPAKLGTTMLDVFT  327
            +  SPA +G TMLD+  
Sbjct  274  ITRSPADIGKTMLDLLN  290



>gb|ACC73801.1| succinyl-CoA synthetase, alpha subunit [Burkholderia phymatum 
STM815]
Length=278

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA GLGQ+TC+GIGGDP NGTNF+DCLE F+AD +TEG+++IGEIGG+
Sbjct  142  SGTLTYEAVAQTTAAGLGQTTCIGIGGDPVNGTNFIDCLEMFLADDETEGVIMIGEIGGS  201

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA F+K+S T KPVV FIAG +APPGRRMGHAGAI+SGGKGTA  KI  ++ AG+ 
Sbjct  202  AEEDAAQFLKDSRTNKPVVGFIAGTSAPPGRRMGHAGAIISGGKGTAGAKIDAMRSAGIH  261

Query  377  VCESPAKLGTTMLDVF  330
            V +SPA LG TML  F
Sbjct  262  VAQSPAALGETMLKAF  277



>gb|ELU05339.1| hypothetical protein CAPTEDRAFT_170724 [Capitella teleta]
Length=334

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QT+ VGLGQ+ CVGIGGDPFNGTNF+DCL+ F+ DP+TEGIVLIGEIGG 
Sbjct  190  SGTLTYEAVHQTSLVGLGQTVCVGIGGDPFNGTNFIDCLDVFLKDPETEGIVLIGEIGGQ  249

Query  557  aeeeaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEA  387
            AEE AA F+KE  +    KPVV+FIAGLTAPPGRRMGHAGAI+SGGKG AQ+KI  L+ A
Sbjct  250  AEERAADFLKEHNSGPNAKPVVSFIAGLTAPPGRRMGHAGAIISGGKGGAQEKIAALENA  309

Query  386  GVTVCESPAKLGTTMLDVFTKRG  318
            GV V  SPA++G+TML      G
Sbjct  310  GVLVTRSPAQMGSTMLKAMQDAG  332



>ref|XP_001442597.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK75200.1| unnamed protein product [Paramecium tetraurelia]
Length=337

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT  GLGQST VGIGGDPFNGTNF+D LERF+ DP+TEGIV+IGEIGG 
Sbjct  195  SGTLTYEAVDQTTRAGLGQSTVVGIGGDPFNGTNFIDVLERFMVDPETEGIVMIGEIGGE  254

Query  557  aeeeaaafIKESGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
             EE AA +IK++  + KPVV FIAG+TAPP RRMGHAGAIVS GKG+A +KIR L++AG+
Sbjct  255  NEEMAADWIKKNNPKNKPVVGFIAGITAPPERRMGHAGAIVSKGKGSAPEKIRALEQAGI  314

Query  380  TVCESPAKLGTTMLDVFTKRGL  315
             V +SPA++G TML+V  ++GL
Sbjct  315  RVVKSPAQIGKTMLEVMKEKGL  336



>ref|WP_008519360.1| succinyl-CoA synthetase subsunit alpha [alpha proteobacterium 
IMCC14465]
 gb|EJW21264.1| hypothetical protein IMCC14465_10600 [alpha proteobacterium IMCC14465]
Length=291

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA GLGQSTC+GIGGDP NGTNF+DCLE F+ D QTE I++IGEIGG+
Sbjct  154  SGTLTYEAVAQTTAAGLGQSTCIGIGGDPVNGTNFIDCLELFLGDEQTESIIMIGEIGGS  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA F+K S  +KPVV FIAG+TAPPGRRMGHAGAI+SGGKG A+DK+  ++ AG+T
Sbjct  214  AEEEAAEFLKSSAVKKPVVGFIAGVTAPPGRRMGHAGAIISGGKGGAEDKMEAMRSAGIT  273

Query  377  VCESPAKLGTTMLDVFT  327
            V  SPA LGTT+  +  
Sbjct  274  VSPSPAALGTTLSQILN  290



>ref|XP_786544.2| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial-like [Strongylocentrotus purpuratus]
Length=326

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 118/143 (83%), Gaps = 3/143 (2%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQ+ CVGIGGDPFNGTNFVDCLE F+ DP TEGIVLIGEIGG 
Sbjct  182  SGTLTYEAVAQTTAVGLGQTLCVGIGGDPFNGTNFVDCLEIFLNDPATEGIVLIGEIGGG  241

Query  557  aeeeaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEA  387
            AEE+AA F+K+  +    KPV AFIAGLTAPPGRRMGHAGAI+SGGKG A +KI+ LK+A
Sbjct  242  AEEKAAEFLKQHNSGPDAKPVAAFIAGLTAPPGRRMGHAGAIISGGKGGATEKIQALKDA  301

Query  386  GVTVCESPAKLGTTMLDVFTKRG  318
            GV V  SPA++GTT+L    K G
Sbjct  302  GVVVTMSPAQMGTTILKEMEKIG  324



>ref|WP_012110353.1| succinyl-CoA synthetase subsunit alpha [Parvibaculum lavamentivorans]
 gb|ABS63073.1| succinyl-CoA synthetase, alpha subunit [Parvibaculum lavamentivorans 
DS-1]
Length=291

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA GLGQSTC+GIGGDP NGTNF+DCLE F+ DP T  I++IGEIGG+
Sbjct  154  SGTLTYEAVAQTTAAGLGQSTCIGIGGDPVNGTNFIDCLEMFLGDPDTTSIIMIGEIGGS  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA F+K S  +KP+V FIAG+TAPPGRRMGHAGAI+SGGKG A+DK+  ++ AG+T
Sbjct  214  AEEDAAEFLKASKVKKPIVGFIAGVTAPPGRRMGHAGAIISGGKGGAEDKMEAMRSAGIT  273

Query  377  VCESPAKLGTTMLDVF  330
            V +SP+ LGTT+++V 
Sbjct  274  VAKSPSALGTTLVEVL  289



>ref|WP_021777427.1| 3-oxoacyl-Acyl-carrier protein reductase [alpha proteobacterium 
RS24]
 gb|ERL46449.1| 3-oxoacyl-Acyl-carrier protein reductase [alpha proteobacterium 
RS24]
Length=291

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA GLGQSTC+GIGGDP NGTNF+DCLE F+ D QTE I++IGEIGG+
Sbjct  154  SGTLTYEAVAQTTAAGLGQSTCIGIGGDPVNGTNFIDCLELFLGDDQTESIIMIGEIGGS  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA F+K S  +KPVV FIAG+TAPPGRRMGHAGAI+SGGKG A+DK+  ++ AG+T
Sbjct  214  AEEEAAEFLKSSSVKKPVVGFIAGVTAPPGRRMGHAGAIISGGKGGAEDKMEAMRSAGIT  273

Query  377  VCESPAKLGTTMLDVFT  327
            V  SPA LGTT+  +  
Sbjct  274  VSPSPAALGTTLSQILN  290



>gb|KHJ84287.1| succinate-CoA ligase, alpha subunit, partial [Oesophagostomum 
dentatum]
Length=196

 Score =   169 bits (428),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 116/142 (82%), Gaps = 3/142 (2%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT VGLGQ+ CVGIGGDPFNGTNF+DCL  F+ DP T+G++LIGEIGG+
Sbjct  49   SGTLTYEAVHQTTQVGLGQTLCVGIGGDPFNGTNFIDCLSIFLEDPHTKGMILIGEIGGS  108

Query  557  aeeeaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEA  387
            AEEEAA F+ E+ +    KPV AFIAGLTAPPGRRMGHAGAI+S GKGTA DKI+ LKEA
Sbjct  109  AEEEAAQFLVENNSGPNAKPVAAFIAGLTAPPGRRMGHAGAIISRGKGTATDKIKALKEA  168

Query  386  GVTVCESPAKLGTTMLDVFTKR  321
            GV V +SP+KLG T+     ++
Sbjct  169  GVHVTDSPSKLGITIAKALLEK  190



>ref|WP_027287415.1| succinate--CoA ligase [Rhodovibrio salinarum]
Length=291

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA GLGQSTC+GIGGDP NGTNFVDC++ F+ D +TEGIV+IGEIGGT
Sbjct  154  SGTLTYEAVSQTTAAGLGQSTCIGIGGDPVNGTNFVDCIDMFLKDDETEGIVMIGEIGGT  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA F+K+S  +KP V FIAGLTAPPGRRMGHAGAI+SGGKG A+DKI  +++AG+ 
Sbjct  214  AEEEAAEFLKQSSVKKPTVGFIAGLTAPPGRRMGHAGAIISGGKGGAEDKIAAMRDAGIH  273

Query  377  VCESPAKLGTTMLDVF  330
            V +SPA +G+TM+   
Sbjct  274  VADSPASIGSTMVKAL  289



>ref|WP_010423152.1| succinyl-CoA synthetase subsunit alpha [Rickettsia helvetica]
Length=292

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ +++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEIFLKDDETKAMIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++ GKG+A+DK+  L+ AGVT
Sbjct  214  AEEDAADFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIITRGKGSAEDKLEALQSAGVT  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  274  ITRSPADIGKTMLDLLNK  291



>gb|ABW76150.1| succinyl-CoA synthetase alpha subunit [Blastocystis sp. NandII]
 gb|ABY62723.1| mitochondrial succinyl-CoA synthetase alpha subunit [Blastocystis 
sp. ATCC 50177]
Length=318

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 114/141 (81%), Gaps = 1/141 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT  GLGQST VGIGGDPFNGTNF+DCLERF  DPQTEGIV+IGEIGGT
Sbjct  176  SGTLTYEAVHQTTMYGLGQSTVVGIGGDPFNGTNFIDCLERFTNDPQTEGIVMIGEIGGT  235

Query  557  aeeeaaafIKESGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEE+AA ++K+ G   KPVV+FIAG TAPPGRRMGHAGAI+SGGKGTA+ K+  L  AGV
Sbjct  236  AEEDAAEWLKQYGNPNKPVVSFIAGRTAPPGRRMGHAGAIISGGKGTAKAKMEALTSAGV  295

Query  380  TVCESPAKLGTTMLDVFTKRG  318
             V E+PA +G  M ++    G
Sbjct  296  KVVETPAMIGEAMFNMMKAAG  316



>ref|XP_002160938.2| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Hydra vulgaris]
Length=332

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 109/139 (78%), Gaps = 3/139 (2%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigei--g  564
            SGTLTYEAV QT+ VGLGQS CVGIGGDPFNGTNF+DCLE F+ DP+T+G+++IGEI   
Sbjct  182  SGTLTYEAVHQTSTVGLGQSLCVGIGGDPFNGTNFIDCLEVFLKDPETKGMIMIGEIGGA  241

Query  563  gtaeeeaaafIKESG-TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEA  387
                         SG  +KP+V FIAGLTAPPGRRMGHAGAI+SGGKG A+DKI+ L+EA
Sbjct  242  AEERAAEYLLKYNSGPNKKPIVGFIAGLTAPPGRRMGHAGAIISGGKGGAEDKIKALEEA  301

Query  386  GVTVCESPAKLGTTMLDVF  330
            GVTV  SPA++GTT+  VF
Sbjct  302  GVTVTRSPAQMGTTLRTVF  320



>ref|XP_001007751.3| succinyl-CoA synthetase, alpha subunit family protein [Tetrahymena 
thermophila]
 gb|EAR87506.3| succinyl-CoA synthetase alpha subunit [Tetrahymena thermophila 
SB210]
Length=310

 Score =   172 bits (435),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 116/137 (85%), Gaps = 1/137 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT  GLGQST VGIGGDPFNGTNF+D LERFV DP+TEGI+LIGEIGG 
Sbjct  169  SGTLTYEAVDQTTKAGLGQSTVVGIGGDPFNGTNFIDVLERFVEDPETEGILLIGEIGGE  228

Query  557  aeeeaaafIKESG-TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEE+AAA++K +  T KPVV+FIAG+TAPP RRMGHAGAIVSGGKG+A +KI+ L+ AG+
Sbjct  229  AEEQAAAWLKANNKTNKPVVSFIAGVTAPPERRMGHAGAIVSGGKGSATEKIKALESAGI  288

Query  380  TVCESPAKLGTTMLDVF  330
             VC SPA LG  ML++ 
Sbjct  289  KVCRSPATLGQEMLNLM  305



>ref|WP_043950111.1| succinate--CoA ligase [Candidatus Phaeomarinobacter ectocarpi]
 emb|CDO59471.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Candidatus Phaeomarinobacter 
ectocarpi]
Length=291

 Score =   171 bits (433),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA GLGQ+TC+GIGGDP NGTNF+DCL+ F+ D +TE I++IGEIGG+
Sbjct  154  SGTLTYEAVGQTTAAGLGQTTCIGIGGDPVNGTNFIDCLDMFLGDDKTESIIMIGEIGGS  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA F+K+S T+KPVV FIAG+TAPPGRRMGHAGAI+SGGKG A  KI  +K AG+T
Sbjct  214  AEEDAAEFLKQSKTKKPVVGFIAGVTAPPGRRMGHAGAIISGGKGDAASKIEAMKSAGIT  273

Query  377  VCESPAKLGTTMLDVF  330
            V  SPA LG+T++DV 
Sbjct  274  VSPSPAALGSTLVDVL  289



>ref|XP_008608930.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Saprolegnia diclina VS20]
 gb|EQC37410.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Saprolegnia diclina VS20]
Length=312

 Score =   172 bits (435),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 121/142 (85%), Gaps = 1/142 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT+ GLGQST +GIGGDPFNGT+F+DCLERF  DP+TEGI++IGEIGGT
Sbjct  170  SGTLTYEAVHQTTSTGLGQSTVIGIGGDPFNGTDFIDCLERFTNDPETEGIIMIGEIGGT  229

Query  557  aeeeaaafIKESGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEEEAA ++KE G   KPVV+FIAG+TAPPGRRMGHAGAIVSGGKGTA+ K   L+ AGV
Sbjct  230  AEEEAAEWLKEFGNPNKPVVSFIAGITAPPGRRMGHAGAIVSGGKGTAEGKFAALEGAGV  289

Query  380  TVCESPAKLGTTMLDVFTKRGL  315
            TV  SP++LGTTML    +RGL
Sbjct  290  TVTRSPSRLGTTMLQQMARRGL  311



>ref|XP_003106288.1| hypothetical protein CRE_15309 [Caenorhabditis remanei]
 gb|EFO98230.1| hypothetical protein CRE_15309 [Caenorhabditis remanei]
Length=322

 Score =   172 bits (435),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 118/139 (85%), Gaps = 3/139 (2%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT VG GQ+ CVGIGGDPFNGTNF+DCL+ F+ DP+T+GI+LIGEIGG+
Sbjct  180  SGTLTYEAVHQTTQVGFGQTLCVGIGGDPFNGTNFIDCLQVFLEDPETKGIILIGEIGGS  239

Query  557  aeeeaaafIKESG---TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEA  387
            AEEEAA F+KE     T KPVV+FIAG+TAPPGRRMGHAGAI+SGGKGTA DKI  L+EA
Sbjct  240  AEEEAAQFLKEHNSGKTRKPVVSFIAGVTAPPGRRMGHAGAIISGGKGTAADKINALREA  299

Query  386  GVTVCESPAKLGTTMLDVF  330
            GV V +SPAKLGT+M   F
Sbjct  300  GVIVTDSPAKLGTSMATAF  318



>gb|KDO21510.1| succinyl-CoA ligase subunit alpha [Saprolegnia parasitica CBS 
223.65]
Length=312

 Score =   171 bits (434),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 121/142 (85%), Gaps = 1/142 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT+ GLGQST +GIGGDPFNGT+F+DCLERF  DP+TEGI++IGEIGGT
Sbjct  170  SGTLTYEAVHQTTSTGLGQSTVIGIGGDPFNGTDFIDCLERFTNDPETEGIIMIGEIGGT  229

Query  557  aeeeaaafIKESGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEEEAA ++KE G   KPVV+FIAG+TAPPGRRMGHAGAIVSGGKGTA+ K   L+ AGV
Sbjct  230  AEEEAAEWLKEFGNPNKPVVSFIAGITAPPGRRMGHAGAIVSGGKGTAEGKFAALEGAGV  289

Query  380  TVCESPAKLGTTMLDVFTKRGL  315
            TV  SP++LGTTML    +RGL
Sbjct  290  TVTRSPSRLGTTMLQQMARRGL  311



>emb|CAP27541.2| Protein CBR-SUCL-1 [Caenorhabditis briggsae]
Length=322

 Score =   172 bits (435),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 118/139 (85%), Gaps = 3/139 (2%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT VG GQ+ CVGIGGDPFNGTNF+DCL  F+ DP+T+GI+LIGEIGG+
Sbjct  180  SGTLTYEAVHQTTQVGFGQTLCVGIGGDPFNGTNFIDCLHVFLEDPETKGIILIGEIGGS  239

Query  557  aeeeaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEA  387
            AEEEAA F+K+  T   +KPVV+FIAG+TAPPGRRMGHAGAI+SGGKGTA DKI  L+EA
Sbjct  240  AEEEAAQFLKDHNTGVNKKPVVSFIAGVTAPPGRRMGHAGAIISGGKGTAADKINALREA  299

Query  386  GVTVCESPAKLGTTMLDVF  330
            GV V +SPAKLGT+M   F
Sbjct  300  GVVVTDSPAKLGTSMAKAF  318



>ref|WP_017972286.1| succinyl-CoA synthetase subsunit alpha [alpha proteobacterium 
SCGC AAA280-B11]
Length=291

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT +GLGQSTC+GIGGDP NGTNF+DCLE F+ D +T+ I++IGEIGG+
Sbjct  154  SGTLTYEAVAQTTVLGLGQSTCIGIGGDPINGTNFIDCLELFLKDDETKSIIMIGEIGGS  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA FIK S T+KPV+ FIAG+TAPPGRRMGHAGAI+SGGKG A+DKI T++  G+T
Sbjct  214  AEEEAAEFIKSSKTKKPVIGFIAGVTAPPGRRMGHAGAIISGGKGLAKDKIETMRSCGIT  273

Query  377  VCESPAKLGTTMLD  336
            V  SPA +G T+ D
Sbjct  274  VANSPADIGKTLFD  287



>ref|NP_510450.1| Protein SUCL-1 [Caenorhabditis elegans]
 sp|P53596.1|SUCA_CAEEL RecName: Full=Probable succinyl-CoA ligase [ADP/GDP-forming] 
subunit alpha, mitochondrial; AltName: Full=Succinyl-CoA synthetase 
subunit alpha; Short=SCS-alpha; Flags: Precursor [Caenorhabditis 
elegans]
 emb|CAA94107.1| SUCL-1 [Caenorhabditis elegans]
Length=322

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 118/139 (85%), Gaps = 3/139 (2%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT VG GQ+ CVGIGGDPFNGTNF+DCL  F+ DP+T+GI+LIGEIGG+
Sbjct  180  SGTLTYEAVHQTTQVGFGQTLCVGIGGDPFNGTNFIDCLNVFLEDPETKGIILIGEIGGS  239

Query  557  aeeeaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEA  387
            AEEEAAA++KE  +    KPVV+FIAG+TAPPGRRMGHAGAI+SGGKGTA DKI  L+EA
Sbjct  240  AEEEAAAYLKEHNSGANRKPVVSFIAGVTAPPGRRMGHAGAIISGGKGTAADKINALREA  299

Query  386  GVTVCESPAKLGTTMLDVF  330
            GV V +SPAKLGT+M   F
Sbjct  300  GVVVTDSPAKLGTSMATAF  318



>ref|WP_016916757.1| succinyl-CoA synthetase subsunit alpha [Rickettsia honei]
Length=292

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGVT
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVT  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  274  ITRSPADIGKTMLDLLNK  291



>ref|XP_002645849.1| Hypothetical protein CBG07585 [Caenorhabditis briggsae]
Length=344

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 118/139 (85%), Gaps = 3/139 (2%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT VG GQ+ CVGIGGDPFNGTNF+DCL  F+ DP+T+GI+LIGEIGG+
Sbjct  202  SGTLTYEAVHQTTQVGFGQTLCVGIGGDPFNGTNFIDCLHVFLEDPETKGIILIGEIGGS  261

Query  557  aeeeaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEA  387
            AEEEAA F+K+  T   +KPVV+FIAG+TAPPGRRMGHAGAI+SGGKGTA DKI  L+EA
Sbjct  262  AEEEAAQFLKDHNTGVNKKPVVSFIAGVTAPPGRRMGHAGAIISGGKGTAADKINALREA  321

Query  386  GVTVCESPAKLGTTMLDVF  330
            GV V +SPAKLGT+M   F
Sbjct  322  GVVVTDSPAKLGTSMAKAF  340



>ref|XP_009524111.1| hypothetical protein PHYSODRAFT_557468 [Phytophthora sojae]
 gb|EGZ21394.1| hypothetical protein PHYSODRAFT_557468 [Phytophthora sojae]
Length=316

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 114/140 (81%), Gaps = 1/140 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA+GLGQST +GIGGDPFNGTNF+DCLERF  DP+TEGI+++GEIGG+
Sbjct  176  SGTLTYEAVAQTTALGLGQSTVIGIGGDPFNGTNFIDCLERFTNDPETEGIIMVGEIGGS  235

Query  557  aeeeaaafIKESGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEEEAA ++   G   KPVV+FIAG TAPPGRRMGHAGAIVSGGKGTA  K   L+ AGV
Sbjct  236  AEEEAAEWLMAHGDPNKPVVSFIAGTTAPPGRRMGHAGAIVSGGKGTAAGKFAALEAAGV  295

Query  380  TVCESPAKLGTTMLDVFTKR  321
             V  SPA+LG T+ +   KR
Sbjct  296  AVTRSPARLGATLFEEMKKR  315



>ref|XP_636263.1| succinate-CoA ligase [Dictyostelium discoideum AX4]
 sp|P36967.3|SUCA_DICDI RecName: Full=Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial; AltName: Full=Succinyl-CoA synthetase subunit 
alpha; Short=SCS-alpha; AltName: Full=p36; Flags: Precursor 
[Dictyostelium discoideum]
 gb|EAL62749.1| succinate-CoA ligase [Dictyostelium discoideum AX4]
Length=315

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTC+GIGGDPFNGTNF+DCL+ F  DPQTEGI+LIGEIGG 
Sbjct  174  SGTLTYEAVAQTTAVGLGQSTCIGIGGDPFNGTNFIDCLKMFTQDPQTEGIILIGEIGGE  233

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA ++ ++ T+KPVV+FIAGL+APPGRRMGHAGAI+SGGKG A  KI  LK AGVT
Sbjct  234  AEEEAAQWLIDNPTDKPVVSFIAGLSAPPGRRMGHAGAIISGGKGDANSKIEALKAAGVT  293

Query  377  VCESPAKLGTTMLDVFTKR  321
            V  SPAKLG T+L    ++
Sbjct  294  VTFSPAKLGETILQKMNEK  312



>ref|XP_006675876.1| hypothetical protein BATDEDRAFT_36456 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83302.1| hypothetical protein BATDEDRAFT_36456 [Batrachochytrium dendrobatidis 
JAM81]
Length=342

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 103/140 (74%), Gaps = 4/140 (3%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLi----ge  570
            SGTLTYEAV QTTA GLGQ+ CVGIGGDPFNGTNFVDCL+ F+ADP+TEGIVLI    G 
Sbjct  196  SGTLTYEAVAQTTAAGLGQTLCVGIGGDPFNGTNFVDCLKVFLADPETEGIVLIGEIGGS  255

Query  569  iggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKE  390
                A E            KPVV+FIAGL+APPGRRMGHAGAI+SGGKG A+DK+  L+ 
Sbjct  256  AEEDAAEYLMQHNMSRSNPKPVVSFIAGLSAPPGRRMGHAGAIISGGKGKAEDKVAALQR  315

Query  389  AGVTVCESPAKLGTTMLDVF  330
            AGV V +SPAKLG  M   F
Sbjct  316  AGVIVSQSPAKLGYYMKKAF  335



>gb|ETP44985.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica P10297]
Length=318

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 114/140 (81%), Gaps = 1/140 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA+GLGQST +GIGGDPFNGTNF+DCLERF  DP+TEGI+++GEIGG+
Sbjct  178  SGTLTYEAVAQTTALGLGQSTVIGIGGDPFNGTNFIDCLERFTNDPETEGIIMVGEIGGS  237

Query  557  aeeeaaafIKESGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEEEAA ++   G   KPVV+FIAG TAPPGRRMGHAGAIVSGGKGTA  K   L+ AGV
Sbjct  238  AEEEAAEWLMAHGDPNKPVVSFIAGTTAPPGRRMGHAGAIVSGGKGTAAGKFAALEAAGV  297

Query  380  TVCESPAKLGTTMLDVFTKR  321
             V  SPA+LG T+ +   KR
Sbjct  298  AVTRSPARLGVTLYEEMQKR  317



>ref|XP_008905429.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica INRA-310]
 gb|ETI47142.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica P1569]
 gb|ETK87077.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica]
 gb|ETL40492.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica]
 gb|ETL93622.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica]
 gb|ETM46890.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica]
 gb|ETN09596.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica INRA-310]
 gb|ETO75838.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica P1976]
 gb|ETP16936.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica CJ01A1]
Length=318

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 114/140 (81%), Gaps = 1/140 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA+GLGQST +GIGGDPFNGTNF+DCLERF  DP+TEGI+++GEIGG+
Sbjct  178  SGTLTYEAVAQTTALGLGQSTVIGIGGDPFNGTNFIDCLERFTNDPETEGIIMVGEIGGS  237

Query  557  aeeeaaafIKESGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEEEAA ++   G   KPVV+FIAG TAPPGRRMGHAGAIVSGGKGTA  K   L+ AGV
Sbjct  238  AEEEAAEWLMAHGDPNKPVVSFIAGTTAPPGRRMGHAGAIVSGGKGTAAGKFAALEAAGV  297

Query  380  TVCESPAKLGTTMLDVFTKR  321
             V  SPA+LG T+ +   KR
Sbjct  298  AVTRSPARLGVTLYEEMQKR  317



>ref|WP_017943586.1| MULTISPECIES: succinyl-CoA synthetase subsunit alpha [unclassified 
Alphaproteobacteria (miscellaneous)]
Length=291

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA+GLGQSTC+GIGGDP NGTNF+DCL+ F+ D +T+ I++IGEIGG+
Sbjct  154  SGTLTYEAVAQTTALGLGQSTCIGIGGDPINGTNFIDCLDLFLKDDETKSIIMIGEIGGS  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEE A FIK S  +KPVV FIAG+TAPPGRRMGHAGAI+SGGKG A+DKI T+K  G+T
Sbjct  214  AEEEGAEFIKSSKIKKPVVGFIAGVTAPPGRRMGHAGAIISGGKGLAKDKIETMKSCGIT  273

Query  377  VCESPAKLGTTMLD  336
            V  SPA +G T+ D
Sbjct  274  VANSPADIGKTLFD  287



>ref|WP_017970841.1| succinyl-CoA synthetase subsunit alpha [alpha proteobacterium 
SCGC AAA027-J10]
Length=291

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA+GLGQSTC+GIGGDP NGTNF+DCL+ F+ D +T+ I++IGEIGG+
Sbjct  154  SGTLTYEAVAQTTALGLGQSTCIGIGGDPINGTNFIDCLDLFLKDDETKSIIMIGEIGGS  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEE A FIK S  +KPVV FIAG+TAPPGRRMGHAGAI+SGGKG A+DKI T+K  G+T
Sbjct  214  AEEEGAEFIKSSKIKKPVVGFIAGVTAPPGRRMGHAGAIISGGKGLAKDKIETMKSCGIT  273

Query  377  VCESPAKLGTTMLD  336
            V  SPA +G T+ D
Sbjct  274  VANSPADIGKTLFD  287



>ref|WP_029167294.1| succinate--CoA ligase [alpha proteobacterium SCGC AAA028-C07]
Length=291

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA+GLGQSTC+GIGGDP NGTNF+DCL+ F+ D +T+ I++IGEIGG+
Sbjct  154  SGTLTYEAVAQTTALGLGQSTCIGIGGDPINGTNFIDCLDLFLKDDETKSIIMIGEIGGS  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEE A FIK S  +KPVV FIAG+TAPPGRRMGHAGAI+SGGKG A+DKI T+K  G+T
Sbjct  214  AEEEGAEFIKSSKIKKPVVGFIAGVTAPPGRRMGHAGAIISGGKGLAKDKIETMKSCGIT  273

Query  377  VCESPAKLGTTMLD  336
            V  SPA +G T+ D
Sbjct  274  VANSPADIGKTLFD  287



>gb|EGT40414.1| hypothetical protein CAEBREN_13872 [Caenorhabditis brenneri]
Length=322

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 121/142 (85%), Gaps = 3/142 (2%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVG GQ+ CVGIGGDPFNGTNF+DCL+ F+ D +T+GI+LIGEIGG+
Sbjct  180  SGTLTYEAVHQTTAVGFGQTLCVGIGGDPFNGTNFIDCLKVFLEDQETKGIILIGEIGGS  239

Query  557  aeeeaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEA  387
            AEEEAAAF+KE  +    KPVV+FIAG+TAPPGRRMGHAGAI+SGGKGTA DKI  L+EA
Sbjct  240  AEEEAAAFLKEHNSGKGRKPVVSFIAGVTAPPGRRMGHAGAIISGGKGTAADKINALREA  299

Query  386  GVTVCESPAKLGTTMLDVFTKR  321
            GV V +SPAKLGT+M   F ++
Sbjct  300  GVVVTDSPAKLGTSMATAFLEQ  321



>gb|AEV92218.1| Succinyl-CoA synthetase alpha chain [Rickettsia slovaca 13-B]
Length=258

 Score =   168 bits (426),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  120  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGN  179

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV 
Sbjct  180  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVI  239

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  240  ITRSPADIGKTMLDLLNK  257



>ref|XP_002908607.1| succinyl-CoA ligase subunit alpha, mitochondrial precursor [Phytophthora 
infestans T30-4]
 gb|EEY61690.1| succinyl-CoA ligase subunit alpha, mitochondrial precursor [Phytophthora 
infestans T30-4]
Length=339

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 114/140 (81%), Gaps = 1/140 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA+GLGQST +GIGGDPFNGTNF+DCLERF  DP+TEGI+++GEIGG+
Sbjct  199  SGTLTYEAVAQTTALGLGQSTVIGIGGDPFNGTNFIDCLERFTNDPETEGIIMVGEIGGS  258

Query  557  aeeeaaafIKESGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEEEAA ++   G   KPVV+FIAG TAPPGRRMGHAGAIVSGGKGTA  K   L+ AGV
Sbjct  259  AEEEAAEWLMAHGDPNKPVVSFIAGTTAPPGRRMGHAGAIVSGGKGTAAGKFAALEAAGV  318

Query  380  TVCESPAKLGTTMLDVFTKR  321
             V  SPA+LG T+ +   KR
Sbjct  319  AVTRSPARLGVTLYEEMQKR  338



>ref|XP_004029838.1| succinyl-CoA synthetase, alpha subunit, putative [Ichthyophthirius 
multifiliis]
 gb|EGR28602.1| succinyl-CoA synthetase, alpha subunit, putative [Ichthyophthirius 
multifiliis]
Length=311

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 115/142 (81%), Gaps = 1/142 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT  GLGQST VGIGGDPFNGTNF+D LERFV DP+T+GI++IGEIGG 
Sbjct  169  SGTLTYEAVDQTTKAGLGQSTVVGIGGDPFNGTNFIDVLERFVHDPETKGIMMIGEIGGE  228

Query  557  aeeeaaafIKESGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEE+AA ++KE  T+ KPVV+FIAG+TAPP RRMGHAGAIVSGGKG+A +KI+TL+  G+
Sbjct  229  AEEQAAYWLKEHNTQNKPVVSFIAGVTAPPERRMGHAGAIVSGGKGSAPEKIKTLESVGI  288

Query  380  TVCESPAKLGTTMLDVFTKRGL  315
             V  SPA LG  ML      GL
Sbjct  289  KVSRSPATLGEEMLKAMKAAGL  310



>ref|WP_014410679.1| succinyl-CoA synthetase subsunit alpha [Rickettsia parkeri]
 gb|AFC74794.1| succinyl-CoA synthetase subunit alpha [Rickettsia parkeri str. 
Portsmouth]
Length=292

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV 
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVI  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  274  ITRSPANIGKTMLDLLNK  291



>ref|WP_029374459.1| succinate--CoA ligase, partial [Rickettsia conorii]
Length=258

 Score =   168 bits (425),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTC+GIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  120  SGTLTYEAVAQTTAVGLGQSTCIGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGN  179

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV 
Sbjct  180  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVI  239

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  240  ITRSPADIGKTMLDLLNK  257



>gb|AAA85724.1| succinyl coenzyme A synthetase alpha subunit [Dictyostelium discoideum 
AX2]
Length=310

 Score =   169 bits (429),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTC+GIGGDPFNGTNF+DCL+ F  DPQTEGI+LIGEIGG 
Sbjct  174  SGTLTYEAVAQTTAVGLGQSTCIGIGGDPFNGTNFIDCLKMFTQDPQTEGIILIGEIGGE  233

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA ++ ++ T+KPVV+FIAGL+APPGRRMGHAGAI+SGGKG A  KI  LK AGVT
Sbjct  234  AEEEAAQWLIDNPTDKPVVSFIAGLSAPPGRRMGHAGAIISGGKGDANSKIEALKAAGVT  293

Query  377  VCESPAKLGTTML  339
            V  SPAKLG T+L
Sbjct  294  VTFSPAKLGETIL  306



>ref|WP_014419805.1| succinyl-CoA synthetase subsunit alpha [Rickettsia slovaca]
 gb|AFD19623.1| succinyl-CoA synthetase subunit alpha [Rickettsia slovaca str. 
D-CWPP]
Length=292

 Score =   169 bits (427),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV 
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVI  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  274  ITRSPADIGKTMLDLLNK  291



>ref|WP_014412789.1| succinyl-CoA synthetase subsunit alpha [Rickettsia australis]
 gb|AFC71264.1| succinyl-CoA synthetase subunit alpha [Rickettsia australis str. 
Cutlack]
Length=292

 Score =   169 bits (427),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC++ F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIDMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GG+G+A+DK+  L+ A VT
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGQGSAEDKLEALQSASVT  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G  M D+  K
Sbjct  274  ITRSPADIGKAMFDLLNK  291



>ref|WP_014746522.1| succinyl-CoA synthetase subsunit alpha [Tistrella mobilis]
 gb|AFK54845.1| Succinyl-CoA synthetase alpha chain [Tistrella mobilis KA081020-065]
Length=291

 Score =   169 bits (427),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA GLGQSTC+GIGGDP NGTNF+D L+ F+ DP+TE I++IGEIGG+
Sbjct  154  SGTLTYEAVAQTTAAGLGQSTCIGIGGDPINGTNFIDALDLFLKDPETEAIIMIGEIGGS  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA F+K+S  +KP V FIAG TAPPGRRMGHAGAI+SGGKG A DK+  ++ AG+ 
Sbjct  214  AEEDAAEFLKQSKVKKPTVGFIAGRTAPPGRRMGHAGAIISGGKGGADDKLEAMRSAGIV  273

Query  377  VCESPAKLGTTMLDVF  330
            + ESPA LG+TM+ V 
Sbjct  274  IAESPAALGSTMVQVL  289



>ref|WP_014364693.1| succinyl-CoA synthetase subsunit alpha [Rickettsia philipii]
 gb|AFB26233.1| succinyl-CoA synthetase subunit alpha [Rickettsia philipii str. 
364D]
Length=292

 Score =   169 bits (427),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV 
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVV  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  274  ITRSPADIGKTMLDLLNK  291



>ref|WP_016770141.1| succinyl-CoA synthetase subsunit alpha [Rickettsia sibirica]
Length=292

 Score =   169 bits (427),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV 
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVI  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  274  ITRSPADIGKTMLDLLNK  291



>ref|XP_002507022.1| succinate-coa ligase [Micromonas sp. RCC299]
 gb|ACO68280.1| succinate-coa ligase [Micromonas sp. RCC299]
Length=326

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTT VGLGQSTCVGIGGDPFNGT+FVDCLERFV D +TEGI++IGEIGG 
Sbjct  185  SGTLTYEAVFQTTQVGLGQSTCVGIGGDPFNGTDFVDCLERFVKDDETEGIIMIGEIGGN  244

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK SGT KPVV+FIAGLTAPPGRRMGHAGAI++GGKG AQDKI  L+ AGVT
Sbjct  245  AEEQAAEFIKASGTTKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAQDKINALESAGVT  304

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V +SPA++G  M D+F +R +L
Sbjct  305  VVKSPAQMGNVMYDIFKERNML  326



>ref|WP_004995747.1| succinyl-CoA synthetase subsunit alpha [Rickettsia sibirica]
 gb|EAA25376.1| succinyl-CoA synthetase alpha chain [Rickettsia sibirica 246]
Length=292

 Score =   169 bits (427),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV 
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVI  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  274  ITRSPADIGKTMLDLLNK  291



>ref|WP_016926237.1| succinyl-CoA synthetase subsunit alpha [Rickettsia conorii]
Length=292

 Score =   169 bits (427),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV 
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVI  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  274  ITRSPADIGKTMLDLLNK  291



>ref|WP_025896902.1| succinate--CoA ligase [Sneathiella glossodoripedis]
Length=291

 Score =   169 bits (427),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA GLGQSTC+GIGGDP NGTNF+DCL+ F+ D +TE I++IGEIGG+
Sbjct  154  SGTLTYEAVAQTTAAGLGQSTCIGIGGDPVNGTNFIDCLDMFLHDDETESIIMIGEIGGS  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA F+K+S  +KPVV FIAG+TAPPGRRMGHAGAI+SGGKG A DK+  ++ AG+T
Sbjct  214  AEEEAAEFLKQSKIKKPVVGFIAGVTAPPGRRMGHAGAIISGGKGGADDKMEAMRSAGIT  273

Query  377  VCESPAKLGTTMLDVF  330
            V +SP+ LG+T++ V 
Sbjct  274  VSDSPSALGSTLVRVL  289



>ref|WP_023507834.1| Succinyl-CoA ligase [ADP-forming] subunit alpha, partial [Rickettsia 
monacensis]
 emb|CDI29578.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Rickettsia monacensis 
IrR/Munich]
Length=256

 Score =   167 bits (424),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT VGLGQSTCVGIGGDP N TNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  120  SGTLTYEAVAQTTTVGLGQSTCVGIGGDPVNDTNFVDCIEMFLKDDETKAIIMIGEIGGN  179

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK+  L+ AGVT
Sbjct  180  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVT  239

Query  377  VCESPAKLGTTMLD  336
            +  SPA +G TML+
Sbjct  240  ITRSPADIGKTMLE  253



>ref|XP_009831202.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Aphanomyces astaci]
 gb|ETV79361.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Aphanomyces astaci]
Length=312

 Score =   169 bits (428),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 119/140 (85%), Gaps = 1/140 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT+ GLGQST +GIGGDPFNGTNF+DCLERF  DP+TEGI++IGEIGGT
Sbjct  170  SGTLTYEAVHQTTSTGLGQSTVIGIGGDPFNGTNFIDCLERFTNDPETEGIIMIGEIGGT  229

Query  557  aeeeaaafIKESGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEEEAA ++ E G   KPVV+FIAG+TAPPGRRMGHAGAIVSGGKGTA+ K   L++AGV
Sbjct  230  AEEEAAEWLAEYGDPNKPVVSFIAGITAPPGRRMGHAGAIVSGGKGTAEGKFAALEKAGV  289

Query  380  TVCESPAKLGTTMLDVFTKR  321
             V  SPA+LGTTML  F KR
Sbjct  290  AVTRSPARLGTTMLQQFAKR  309



>ref|XP_003294260.1| succinyl coenzyme A synthetase alpha subunit [Dictyostelium purpureum]
 gb|EGC29214.1| succinyl coenzyme A synthetase alpha subunit [Dictyostelium purpureum]
Length=312

 Score =   169 bits (428),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTC+GIGGDPFNGTNFVDCL+ F  DPQTEGI+LIGEIGG 
Sbjct  171  SGTLTYEAVAQTTAVGLGQSTCIGIGGDPFNGTNFVDCLKMFTKDPQTEGIILIGEIGGE  230

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA ++ ++ T+KPVV+FIAG +APPGRRMGHAGAI+SGGKG A  KI  LK AGVT
Sbjct  231  AEEEAAQWLIDNPTDKPVVSFIAGTSAPPGRRMGHAGAIISGGKGDANSKINALKAAGVT  290

Query  377  VCESPAKLGTTMLD  336
            +  SPAKLG  ML+
Sbjct  291  ISPSPAKLGEAMLE  304



>ref|WP_011190880.1| succinyl-CoA synthetase subsunit alpha [Rickettsia typhi]
 sp|Q9AKE1.1|SUCD_RICTY RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha; 
AltName: Full=Succinyl-CoA synthetase subunit alpha; Short=SCS-alpha 
[Rickettsia typhi str. Wilmington]
 emb|CAC33725.1| Succinyl-CoA synthetase alpha subunit [Rickettsia typhi]
 gb|AAU03896.1| Succinate thiokinase [Rickettsia typhi str. Wilmington]
 gb|AFE54277.1| succinyl-CoA synthetase subunit alpha [Rickettsia typhi str. 
TH1527]
 gb|AFE55117.1| succinyl-CoA synthetase subunit alpha [Rickettsia typhi str. 
B9991CWPP]
Length=292

 Score =   168 bits (426),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTC+GIGGDP NGT+FV+C+E F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCIGIGGDPVNGTSFVECIEMFLQDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAP  +RMGHAGAI+SGGKG+A+DK+  L+ AGVT
Sbjct  214  AEEDAADFIKQSKIKKPIVSFIAGITAPSDKRMGHAGAIISGGKGSAKDKLEALQSAGVT  273

Query  377  VCESPAKLGTTMLDVFTK  324
            + +SPA +G TMLD+  K
Sbjct  274  ITKSPADIGKTMLDLLNK  291



>ref|WP_010977229.1| succinyl-CoA synthetase subsunit alpha [Rickettsia conorii]
 sp|Q92I22.1|SUCD_RICCN RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha; 
AltName: Full=Succinyl-CoA synthetase subunit alpha; Short=SCS-alpha 
[Rickettsia conorii str. Malish 7]
 gb|AAL03136.1| succinyl-CoA synthetase alpha chain [Rickettsia conorii str. 
Malish 7]
Length=292

 Score =   168 bits (426),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTC+GIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCIGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV 
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVI  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  274  ITRSPADIGKTMLDLLNK  291



>ref|WP_015508452.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-2, partial [Rickettsia 
prowazekii]
 gb|AGJ01924.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-2 [Rickettsia 
prowazekii str. NMRC Madrid E]
Length=258

 Score =   167 bits (423),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA GLGQSTCVGIGGDP NGT+FVDC+E F+ D +T+ I++IGEIGG+
Sbjct  120  SGTLTYEAVAQTTAAGLGQSTCVGIGGDPVNGTSFVDCIEMFLQDDETKAIIMIGEIGGS  179

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAP  +RMGHAGAI+SGGKG+A+DK+  L+ AGV 
Sbjct  180  AEEDAADFIKQSKIKKPIVSFIAGITAPADKRMGHAGAIISGGKGSAEDKVEVLQSAGVI  239

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  240  ITRSPADIGKTMLDLLNK  257



>ref|WP_012736402.1| succinyl-CoA synthetase subsunit alpha [Rickettsia peacockii]
 ref|YP_002916151.1| succinyl-CoA synthetase subunit alpha [Rickettsia peacockii str. 
Rustic]
 gb|ACR47103.1| succinyl-CoA synthetase subunit alpha [Rickettsia peacockii str. 
Rustic]
Length=292

 Score =   168 bits (426),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV 
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVI  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLDV  K
Sbjct  274  ITRSPADIGKTMLDVEVK  291



>ref|WP_027300105.1| succinate--CoA ligase [Rhodospirillales bacterium URHD0088]
Length=292

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA GLGQSTC+GIGGDP NGTNF+DCLE ++AD QT+GIV+IGEIGG+
Sbjct  154  SGTLTYEAVAQTTAAGLGQSTCIGIGGDPVNGTNFIDCLEMYLADEQTKGIVMIGEIGGS  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AAAF++   T+KPVV FIAG TAPPGRRMGHAGAI+SGG G A+ K+  ++ AG+T
Sbjct  214  AEEDAAAFLRAHKTKKPVVGFIAGTTAPPGRRMGHAGAIISGGTGGAEHKLEAMRGAGIT  273

Query  377  VCESPAKLGTTML  339
            + +SPA LG+TML
Sbjct  274  IADSPASLGSTML  286



>ref|WP_012150789.1| succinyl-CoA synthetase subsunit alpha [Rickettsia rickettsii]
 ref|YP_001649976.1| succinyl-CoA synthetase subunit alpha [Rickettsia rickettsii 
str. Iowa]
 emb|CAC33660.1| Succinyl-CoA synthetase alpha subunit [Rickettsia rickettsii]
 gb|ABV76203.1| succinyl-CoA synthetase subunit alpha [Rickettsia rickettsii 
str. 'Sheila Smith']
 gb|ABY72570.1| succinyl-CoA synthetase alpha chain [Rickettsia rickettsii str. 
Iowa]
 gb|AFB22216.1| succinyl-CoA synthetase subunit alpha [Rickettsia rickettsii 
str. Brazil]
 gb|AFB23550.1| succinyl-CoA synthetase subunit alpha [Rickettsia rickettsii 
str. Colombia]
 gb|AFB24900.1| succinyl-CoA synthetase subunit alpha [Rickettsia rickettsii 
str. Arizona]
 gb|AFB27584.1| succinyl-CoA synthetase subunit alpha [Rickettsia rickettsii 
str. Hino]
 gb|AFB28875.1| succinyl-CoA synthetase subunit alpha [Rickettsia rickettsii 
str. Hlp#2]
 gb|AFB30241.1| succinyl-CoA synthetase subunit alpha [Rickettsia rickettsii 
str. Hauke]
 gb|AJG33050.1| succinyl-CoA synthetase subsunit alpha [Rickettsia rickettsii 
str. R]
 gb|AJG34386.1| succinyl-CoA synthetase subsunit alpha [Rickettsia rickettsii 
str. Morgan]
Length=292

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ +++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAVIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV 
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVV  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  274  ITRSPADIGKTMLDLLNK  291



>emb|CDJ51788.1| succinyl-CoA ligase alpha subunit, putative [Eimeria brunetti]
Length=252

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 116/150 (77%), Gaps = 9/150 (6%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTE---------GI  585
            SGTLTYEAV QTT VGLGQS CVGIGGDPFNGTNF+DCLERFVADP+T+         GI
Sbjct  102  SGTLTYEAVNQTTQVGLGQSICVGIGGDPFNGTNFIDCLERFVADPETKGRPACMQRSGI  161

Query  584  VLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI  405
            VLIGEIGG+AEEEAA ++K+    KPVV+FIAG +APPGRRMGHAGAIVSG  GTA  K+
Sbjct  162  VLIGEIGGSAEEEAAEWLKKHNCGKPVVSFIAGSSAPPGRRMGHAGAIVSGNTGTAAGKV  221

Query  404  RTLKEAGVTVCESPAKLGTTMLDVFTKRGL  315
            + L+ AGV V  +PAK+G  M     ++GL
Sbjct  222  KALEAAGVVVVNNPAKIGEAMYAAMKEKGL  251



>ref|WP_013181525.1| succinyl-CoA synthetase subunit alpha [Waddlia chondrophila]
 gb|ADI37797.1| Succinyl-CoA synthetase, alpha subunit [Waddlia chondrophila 
WSU 86-1044]
 emb|CCB91956.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Waddlia chondrophila 
2032/99]
Length=297

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 113/139 (81%), Gaps = 1/139 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV+QTT + LGQS+CVGIGGDP NGTNF+D LE F  DP+TEGI+LIGEIGG 
Sbjct  155  SGTLTYEAVWQTTQLELGQSSCVGIGGDPLNGTNFIDVLELFENDPETEGILLIGEIGGD  214

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA +I+E    KPV AF+AG TAPPGRRMGHAGAI+SG +GTAQ+KI  LK AGVT
Sbjct  215  AEEQAAEWIRER-CSKPVAAFVAGQTAPPGRRMGHAGAIISGNQGTAQNKIEALKHAGVT  273

Query  377  VCESPAKLGTTMLDVFTKR  321
            V E+PA LG  ML  F ++
Sbjct  274  VAETPADLGKAMLSAFNEK  292



>emb|CEO17419.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Rickettsia monacensis]
Length=290

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT VGLGQSTCVGIGGDP N TNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTTVGLGQSTCVGIGGDPVNDTNFVDCIEMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK+  L+ AGVT
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVT  273

Query  377  VCESPAKLGTTMLD  336
            +  SPA +G TML+
Sbjct  274  ITRSPADIGKTMLE  287



>emb|CCW71008.1| unnamed protein product [Phytomonas sp. isolate Hart1]
Length=302

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT VGLGQS CVGIGGDPFNGTN +DCL  F  DP+TEG++LIGEIGGT
Sbjct  161  SGTLTYEAVAQTTEVGLGQSLCVGIGGDPFNGTNMIDCLRFFFNDPETEGVILIGEIGGT  220

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA FIK S  +KPVV+FIAG TAPPGRRMGHAGA+VSGG GTA  K+  LK AGVT
Sbjct  221  AEEEAAEFIKNSPVKKPVVSFIAGATAPPGRRMGHAGAVVSGGMGTANGKMEALKAAGVT  280

Query  377  VCESPAKLGTTMLDVFTKR  321
            +  SP  LG  + DV   +
Sbjct  281  ISHSPTLLGRHIFDVLNNK  299



>ref|WP_026071683.1| succinate--CoA ligase [Rickettsiaceae bacterium Os18]
Length=291

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT VGLGQSTC+GIGGDP NGT+FVDCLE  +AD  T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTEVGLGQSTCIGIGGDPINGTSFVDCLELLLADKDTKAIIMIGEIGGV  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA F+K S  +KPVV+FIAG+TAPPG+RMGHAGAI+ GGKG+A DK+  LK AGV 
Sbjct  214  AEEEAAEFMKLSKIKKPVVSFIAGITAPPGKRMGHAGAIIDGGKGSAADKLEALKSAGVH  273

Query  377  VCESPAKLGTTMLDVFTK  324
            + +SPA++G TM ++  K
Sbjct  274  IAKSPAEIGVTMYNILNK  291



>gb|KHN81599.1| putative succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Toxocara canis]
Length=377

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 113/135 (84%), Gaps = 3/135 (2%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QT+ VGLGQ+ C+GIGGDPFNGTNF+DCL  F+ DP+T GIVLIGEIGG 
Sbjct  174  SGTLTYEAVQQTSDVGLGQTLCIGIGGDPFNGTNFIDCLHIFLNDPETHGIVLIGEIGGQ  233

Query  557  aeeeaaafIKE--SGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEA  387
             EE+AA F+KE   G+E KPVVAFIAG TAPPGRRMGHAGAI+SGGKGTAQ+KI  LKEA
Sbjct  234  DEEDAAEFLKEFNCGSESKPVVAFIAGRTAPPGRRMGHAGAIISGGKGTAQNKIEALKEA  293

Query  386  GVTVCESPAKLGTTM  342
            GV V +SPA +G  M
Sbjct  294  GVVVSKSPAHMGALM  308



>gb|ETN68207.1| CoA-ligase [Necator americanus]
Length=160

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 115/139 (83%), Gaps = 3/139 (2%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT  GLGQ+ CVGIGGDPFNGTNF+DCL+ F+ DP T+GI+LIGEIGG 
Sbjct  17   SGTLTYEAVHQTTLAGLGQTLCVGIGGDPFNGTNFIDCLDIFMKDPNTKGIILIGEIGGV  76

Query  557  aeeeaaafIKESGTE---KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEA  387
            AEE+AA FIK+  ++   KPVVAFIAGLTAPPGRRMGHAGAI++GGKGTA DKI  L+ A
Sbjct  77   AEEQAAQFIKDHNSKGQGKPVVAFIAGLTAPPGRRMGHAGAIIAGGKGTATDKIEALRAA  136

Query  386  GVTVCESPAKLGTTMLDVF  330
            GV V +SPA LG+TM  V 
Sbjct  137  GVHVTDSPATLGSTMAQVL  155



>ref|WP_014952624.1| succinyl-CoA synthetase subsunit alpha [alpha proteobacterium 
HIMB5]
 gb|AFS46791.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [alpha proteobacterium 
HIMB5]
Length=291

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT  GLGQSTC+GIGGDP NGTNF+DCL+ F+ DP+T+ I++IGEIGGT
Sbjct  154  SGTLTYEAVAQTTVNGLGQSTCIGIGGDPINGTNFIDCLDLFLNDPETQSILMIGEIGGT  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA FIK    +KP+V FIAG+TAPPGRRMGHAGAI+SGGKG AQDKI+ ++E G+T
Sbjct  214  AEEEAAEFIKNHKIKKPIVGFIAGITAPPGRRMGHAGAIISGGKGGAQDKIKKMEECGIT  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SP+K+G T+ +  + 
Sbjct  274  MSNSPSKIGETLFNKLSN  291



>ref|WP_028879580.1| succinate--CoA ligase [Terasakiella pusilla]
Length=290

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA G+GQSTC+GIGGDP NGTNF+DCLE F+AD +TE IV+IGEIGGT
Sbjct  154  SGTLTYEAVAQTTAAGMGQSTCIGIGGDPVNGTNFIDCLEMFLADDETESIVMIGEIGGT  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEA  F+K+S  +KPVV FIAG+TAPPG+RMGHAGAI+SGG+GTA  K+  ++ AG+ 
Sbjct  214  AEEEACEFLKQSKVKKPVVGFIAGVTAPPGKRMGHAGAIISGGQGTADAKMEAMRSAGIA  273

Query  377  VCESPAKLGTTMLDVF  330
            V +SPA +G+TM+ + 
Sbjct  274  VADSPASIGSTMVKLL  289



>ref|WP_004597642.1| succinyl-CoA synthetase subsunit alpha [Rickettsia prowazekii]
 ref|NP_220813.1| succinyl-CoA synthetase subunit alpha [Rickettsia prowazekii 
str. Madrid E]
 sp|O08371.1|SUCD_RICPR RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha; 
AltName: Full=Succinyl-CoA synthetase subunit alpha; Short=SCS-alpha 
[Rickettsia prowazekii str. Madrid E]
 emb|CAA72446.1| succinyl-CoA synthetase alpha-subunit [Rickettsia prowazekii 
str. Madrid E]
 emb|CAA14889.1| SUCCINYL-COA LIGASE (sucD) [Rickettsia prowazekii str. Madrid 
E]
 gb|AFE52868.1| succinyl-CoA synthetase subunit alpha [Rickettsia prowazekii 
str. GvV257]
 gb|AFE53439.1| succinyl-CoA synthetase subunit alpha [Rickettsia prowazekii 
str. RpGvF24]
 gb|AFE49245.1| succinyl-CoA synthetase subunit alpha [Rickettsia prowazekii 
str. Chernikova]
 gb|AFE50091.1| succinyl-CoA synthetase subunit alpha [Rickettsia prowazekii 
str. Katsinyian]
 gb|AFE50936.1| succinyl-CoA synthetase subunit alpha [Rickettsia prowazekii 
str. BuV67-CWPP]
 gb|AFE51772.1| succinyl-CoA synthetase subunit alpha [Rickettsia prowazekii 
str. Dachau]
 gb|AGJ02403.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-2 [Rickettsia 
prowazekii str. Breinl]
 gb|EOB09799.1| Thiol:disulfide interchange protein dsbA [Rickettsia prowazekii 
str. GvF12]
Length=292

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA GLGQSTCVGIGGDP NGT+FVDC+E F+ D +T+ I++IGEIGG+
Sbjct  154  SGTLTYEAVAQTTAAGLGQSTCVGIGGDPVNGTSFVDCIEMFLQDDETKAIIMIGEIGGS  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAP  +RMGHAGAI+SGGKG+A+DK+  L+ AGV 
Sbjct  214  AEEDAADFIKQSKIKKPIVSFIAGITAPADKRMGHAGAIISGGKGSAEDKVEVLQSAGVI  273

Query  377  VCESPAKLGTTMLDVFTK  324
            +  SPA +G TMLD+  K
Sbjct  274  ITRSPADIGKTMLDLLNK  291



>ref|XP_005717393.1| succinyl-CoA synthetase alpha chain [Chondrus crispus]
 emb|CDF37522.1| succinyl-CoA synthetase alpha chain [Chondrus crispus]
Length=311

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQS CVGIGGDPFNGT+F+DCL+ F+ D +T+GIV+IGEIGG 
Sbjct  170  SGTLTYEAVHQTTAVGLGQSMCVGIGGDPFNGTDFIDCLDYFLQDEETKGIVMIGEIGGQ  229

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA F++    +KPVV+FIAG+TAPPGRRMGHAGAI++GGKGTA DKI  L+ AG T
Sbjct  230  AEEQAADFLQGHPVKKPVVSFIAGITAPPGRRMGHAGAIIAGGKGTAADKIAALEAAGAT  289

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            V +SPA +G TM       GL
Sbjct  290  VVQSPATMGVTMFAELQIAGL  310



>ref|WP_029016458.1| succinate--CoA ligase [alpha proteobacterium SCGC AAA028-D10]
Length=291

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA+GLGQSTC+GIGGDP NGTNF+DCL+ F+ D +T+ I++IGEIGG+
Sbjct  154  SGTLTYEAVAQTTALGLGQSTCIGIGGDPINGTNFIDCLDLFLKDNETKSIIMIGEIGGS  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEE A FIK S  +KP+V FIAG+TAPPGRRMGHAGAI+SGGKG A+DKI  +K  G+T
Sbjct  214  AEEEGAEFIKSSKIKKPIVGFIAGVTAPPGRRMGHAGAIISGGKGLAKDKIEIMKSCGIT  273

Query  377  VCESPAKLGTTMLD  336
            V  SPA +G T+ D
Sbjct  274  VANSPADIGKTLFD  287



>ref|WP_029167879.1| succinate--CoA ligase [alpha proteobacterium SCGC AAA023-L09]
Length=291

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA+GLGQSTC+GIGGDP NGTNF+DCL+ F+ D +T+ I++IGEIGG+
Sbjct  154  SGTLTYEAVAQTTALGLGQSTCIGIGGDPINGTNFIDCLDLFLKDDETKSIIMIGEIGGS  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEE A FIK S  +KP+V FIAG+TAPPGRRMGHAGAI+SGGKG A+DKI  +K  G+T
Sbjct  214  AEEEGAEFIKSSKIKKPIVGFIAGVTAPPGRRMGHAGAIISGGKGLAKDKIEIMKSCGIT  273

Query  377  VCESPAKLGTTMLD  336
            V  SPA +G T+ D
Sbjct  274  VANSPADIGKTLFD  287



>gb|ACO12801.1| Succinyl-CoA ligase subunit alpha, mitochondrial precursor [Lepeophtheirus 
salmonis]
 gb|ADD38307.1| Succinyl-CoA ligase subunit alpha, mitochondrial [Lepeophtheirus 
salmonis]
Length=327

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 121/144 (84%), Gaps = 3/144 (2%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT VGLGQ+ C+GIGGDPFNGTNF+DCL+ F+ DP+T+GI++IGEIGG 
Sbjct  183  SGTLTYEAVHQTTQVGLGQTLCIGIGGDPFNGTNFIDCLDIFLKDPKTKGIIMIGEIGGA  242

Query  557  aeeeaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEA  387
            AEE+AA +++E  +   +KPVV+FIAG+TAPPGRRMGHAGAI+SGGKGTAQ KI  L+ A
Sbjct  243  AEEKAADYLQEHNSGANQKPVVSFIAGVTAPPGRRMGHAGAIISGGKGTAQTKIAALEAA  302

Query  386  GVTVCESPAKLGTTMLDVFTKRGL  315
            GV V  SPAK+GTT++ +  + GL
Sbjct  303  GVAVTSSPAKMGTTLVQLMKESGL  326



>ref|XP_002772148.1| Succinyl-CoA ligase, putative [Perkinsus marinus ATCC 50983]
 gb|EER03964.1| Succinyl-CoA ligase, putative [Perkinsus marinus ATCC 50983]
Length=332

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 117/140 (84%), Gaps = 1/140 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT VGLGQST VGIGGDPFNGTNF+DCLERFV DPQTEGI+LIGEIGG 
Sbjct  187  SGTLTYEAVNQTTEVGLGQSTVVGIGGDPFNGTNFIDCLERFVQDPQTEGIILIGEIGGA  246

Query  557  aeeeaaafIKESGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEEEAA ++KE+  + KPVV+FIAG+TAPPGRRMGHAGAI+SGGKGTA  KI  L+  G 
Sbjct  247  AEEEAAEWLKENNKDNKPVVSFIAGVTAPPGRRMGHAGAIISGGKGTAATKIAALEACGA  306

Query  380  TVCESPAKLGTTMLDVFTKR  321
             V  SPA LG  ML+++ +R
Sbjct  307  NVVRSPADLGIKMLEMYKQR  326



>ref|XP_009038265.1| hypothetical protein AURANDRAFT_28269 [Aureococcus anophagefferens]
 gb|EGB07028.1| hypothetical protein AURANDRAFT_28269 [Aureococcus anophagefferens]
Length=310

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT  GLGQSTCVGIGGDPFNGTNF+DCLERF  DP+TEGI++IGEIGG+
Sbjct  163  SGTLTYEAVHQTTVTGLGQSTCVGIGGDPFNGTNFIDCLERFTNDPETEGIIMIGEIGGS  222

Query  557  aeeeaaafIKESGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEEEAA ++K  G  +KPVV FIAG TAPPGRRMGHAGAIVSGGKGTA  K    ++AGV
Sbjct  223  AEEEAAEWLKAHGDPDKPVVGFIAGTTAPPGRRMGHAGAIVSGGKGTAAAKFAAFEDAGV  282

Query  380  TVCESPAKLGTTMLDVFTKRG  318
             +  SPA+LG+TM+  F + G
Sbjct  283  FISRSPAQLGSTMIQAFKEHG  303



>ref|WP_012719686.1| succinyl-CoA synthetase subsunit alpha [Rickettsia africae]
 gb|ACP53468.1| Succinyl-CoA synthetase alpha chain [Rickettsia africae ESF-5]
Length=291

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG 
Sbjct  154  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGN  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV 
Sbjct  214  AEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVI  273

Query  377  VCESPAKLGTTMLDVFT  327
            +  SPA +G TMLD+  
Sbjct  274  ITRSPADIGKTMLDLLN  290



>ref|XP_002779820.1| Succinyl-CoA ligase, putative [Perkinsus marinus ATCC 50983]
 gb|EER11615.1| Succinyl-CoA ligase, putative [Perkinsus marinus ATCC 50983]
Length=333

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 117/140 (84%), Gaps = 1/140 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT VGLGQST VGIGGDPFNGTNF+DCLERFV DPQTEGI+LIGEIGG 
Sbjct  188  SGTLTYEAVNQTTEVGLGQSTVVGIGGDPFNGTNFIDCLERFVQDPQTEGIILIGEIGGA  247

Query  557  aeeeaaafIKESG-TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEEEAA ++KE+    KPVV+FIAG+TAPPGRRMGHAGAI+SGGKGTA  KI  L+  G 
Sbjct  248  AEEEAAEWLKENNKNNKPVVSFIAGVTAPPGRRMGHAGAIISGGKGTAATKIAALEGCGA  307

Query  380  TVCESPAKLGTTMLDVFTKR  321
            +V  SPA LG  ML+++ +R
Sbjct  308  SVVRSPADLGVRMLEMYKQR  327



>ref|XP_004831195.1| succinyl-CoA ligase, putative [Babesia equi]
 gb|AFZ81529.1| succinyl-CoA ligase, putative [Babesia equi strain WA]
Length=330

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT VGLGQS C+GIGGDPF+G  F D +++FV DPQT+GI++IGEIGGT
Sbjct  191  SGTLTYEAVSQTTNVGLGQSVCIGIGGDPFSGITFTDAIKKFVKDPQTKGILVIGEIGGT  250

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+ A +IKE+ TEKP+VA IAG+ APPGRRMGHAGAI+SG KGTAQ KI+ L+EAGV 
Sbjct  251  AEEDLADWIKENPTEKPIVALIAGIAAPPGRRMGHAGAIISGNKGTAQGKIKALREAGVI  310

Query  377  VCESPAKLGTTMLDVFTKR  321
            V ++PA++G TM +   ++
Sbjct  311  VPDTPAEMGITMFNALKRQ  329



>ref|WP_027839641.1| succinate--CoA ligase [Mastigocoleus testarum]
Length=291

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA GLGQSTC+GIGGDP NGTNF+DCLE F+AD +TE I++IGEIGG+
Sbjct  154  SGTLTYEAVGQTTAAGLGQSTCIGIGGDPVNGTNFIDCLEMFLADDKTESIIMIGEIGGS  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA FIK+S  +KP+V FIAG+TAPPGRRMGHAGAI+SGGKG A  KI  ++ AG+ 
Sbjct  214  AEEDAAEFIKQSKVKKPMVGFIAGVTAPPGRRMGHAGAIISGGKGGADSKIEAMESAGIK  273

Query  377  VCESPAKLGTTMLDVF  330
            V  SPA LG+T+ +V 
Sbjct  274  VSPSPAALGSTLAEVL  289



>ref|WP_022735557.1| succinyl-CoA synthetase subsunit alpha [Candidatus Pelagibacter 
ubique]
Length=291

 Score =   166 bits (421),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QT+A G+GQSTC+GIGGDP NGTNF+DCLE F+ D  T+ IV+IGEIGG+
Sbjct  154  SGTLTYEAVAQTSANGMGQSTCIGIGGDPINGTNFIDCLELFLKDEDTKSIVMIGEIGGS  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA F+K+   +KP+V FIAGLTAPPGRRMGHAGAI+SGGKG A+DKI T+K AG+T
Sbjct  214  AEEEAAEFLKKEKIKKPMVGFIAGLTAPPGRRMGHAGAIISGGKGGAEDKIETMKSAGIT  273

Query  377  VCESPAKLGTTM  342
            + +SPA +G T+
Sbjct  274  ISKSPADIGKTL  285



>gb|EWM26381.1| succinyl- ligase subunit mitochondrial precursor [Nannochloropsis 
gaditana]
Length=338

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 117/138 (85%), Gaps = 1/138 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDPFNGTNF+DCLERF  DP+T+GI++IGEIGG+
Sbjct  198  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPFNGTNFIDCLERFTKDPETKGIIMIGEIGGS  257

Query  557  aeeeaaafIKESG-TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEEEAA +++  G   KPVV+FIAG TAPPGRRMGHAGAI+SGGKGTA  K   L++AGV
Sbjct  258  AEEEAAEWLEAHGDASKPVVSFIAGSTAPPGRRMGHAGAIISGGKGTAAGKFEALEKAGV  317

Query  380  TVCESPAKLGTTMLDVFT  327
             V  SPA+LGTTML   +
Sbjct  318  HVTRSPAQLGTTMLKAIS  335



>gb|EJW73256.1| succinyl-CoA ligase subunit alpha [Wuchereria bancrofti]
Length=159

 Score =   162 bits (409),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 113/142 (80%), Gaps = 3/142 (2%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT  GLGQ+ CVGIGGDPFNGTNF+DCL+ F+ DPQT+GI+LIGEIGG 
Sbjct  17   SGTLTYEAVHQTTICGLGQTLCVGIGGDPFNGTNFIDCLDIFLKDPQTKGIILIGEIGGQ  76

Query  557  aeeeaaafIKE--SGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEA  387
             EE+AA F+KE  SGT  KPVV+FIAG TAPPGRRMGHAGAI++GGKGTA DKI  LK  
Sbjct  77   DEEKAAEFLKENNSGTNAKPVVSFIAGQTAPPGRRMGHAGAIIAGGKGTAADKIEALKSV  136

Query  386  GVTVCESPAKLGTTMLDVFTKR  321
            GV V  SPA++G  M     K+
Sbjct  137  GVLVSASPAQMGAMMAKALMKK  158



>ref|WP_020401362.1| succinyl-CoA synthetase subsunit alpha [Kordiimonas gwangyangensis]
Length=291

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA GLGQSTC+GIGGDP NGTNF+DCL+ F+ D +T+ I++IGEIGG+
Sbjct  154  SGTLTYEAVAQTTAAGLGQSTCIGIGGDPVNGTNFIDCLDMFLGDDETQAIIMIGEIGGS  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA F+K S  +KP+  FIAG TAPPGR MGHAGAIVSGGKG A+DKI  +K AG+ 
Sbjct  214  AEEEAAEFLKHSKVKKPIAGFIAGRTAPPGRTMGHAGAIVSGGKGGAEDKIEAMKSAGIV  273

Query  377  VCESPAKLGTTML  339
            V +SPA LGTT+L
Sbjct  274  VSDSPAALGTTLL  286



>ref|XP_002781462.1| Succinyl-CoA ligase, putative [Perkinsus marinus ATCC 50983]
 gb|EER13257.1| Succinyl-CoA ligase, putative [Perkinsus marinus ATCC 50983]
Length=334

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 116/140 (83%), Gaps = 1/140 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT VGLGQST VGIGGDPFNGTNF+DCLERFV DPQTEGI+LIGEIGG 
Sbjct  189  SGTLTYEAVNQTTEVGLGQSTVVGIGGDPFNGTNFIDCLERFVQDPQTEGIILIGEIGGA  248

Query  557  aeeeaaafIKESG-TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEEEAA ++KE     KPVV+FIAG+TAPPGRRMGHAGAI+SGGKGTA  KI  L+  G 
Sbjct  249  AEEEAAEWLKEHNKNNKPVVSFIAGVTAPPGRRMGHAGAIISGGKGTAATKIAALEGCGA  308

Query  380  TVCESPAKLGTTMLDVFTKR  321
            +V  SPA LG  ML+++ +R
Sbjct  309  SVVRSPADLGVRMLEMYKQR  328



>gb|ADI19715.1| hypothetical protein [uncultured bacterium EB000_36F02]
Length=291

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT  GLGQSTC+GIGGDP NGTNF+DCL+ F+ D +TE I++IGEIGGT
Sbjct  154  SGTLTYEAVAQTTETGLGQSTCIGIGGDPINGTNFIDCLDLFLNDEETESILMIGEIGGT  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA F+K    +KPVV FIAG+TAPPGRRMGHAGAI+SGGKG A+DKI+ ++E G+ 
Sbjct  214  AEEEAAEFVKNHKIKKPVVGFIAGITAPPGRRMGHAGAIISGGKGGAKDKIKKMEECGII  273

Query  377  VCESPAKLGTTMLDVFT  327
            + +SP+++G T+L+  +
Sbjct  274  IAQSPSEIGKTLLNKLS  290



>ref|XP_002117441.1| hypothetical protein TRIADDRAFT_61514 [Trichoplax adhaerens]
 gb|EDV20057.1| hypothetical protein TRIADDRAFT_61514 [Trichoplax adhaerens]
Length=327

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 120/145 (83%), Gaps = 3/145 (2%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQTT VGLGQ+ CVGIGGDPFNGT+F+DCL+ F+ D +TEGIVLIGEIGG 
Sbjct  183  SGTLTYEAVFQTTNVGLGQTLCVGIGGDPFNGTDFIDCLDIFLKDDKTEGIVLIGEIGGE  242

Query  557  aeeeaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEA  387
            AEE+AA F+ +  +    KPVV+FIAG+TAPPGRRMGHAGAI+SGGKG A++KI TL+ A
Sbjct  243  AEEKAAEFLAKHNSGPNAKPVVSFIAGITAPPGRRMGHAGAIISGGKGGAEEKIATLEGA  302

Query  386  GVTVCESPAKLGTTMLDVFTKRGLL  312
            GV V +SPA++G+T+ +   K G L
Sbjct  303  GVVVTKSPARIGSTIKEAMQKAGKL  327



>gb|AEI89159.1| succinyl-CoA synthetase, alpha subunit [Candidatus Midichloria 
mitochondrii IricVA]
Length=259

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTAVGLGQSTCVGIGGDP NGTNFVD +E F  DP+TE +V+IGEIGG 
Sbjct  120  SGTLTYEAVAQTTAVGLGQSTCVGIGGDPINGTNFVDTIEMFFNDPETEAVVMIGEIGGN  179

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AE +AA FIK S  +KPVV FIAG TAPPG+RMGHAGAI+SGG  +A+ KI  LK AGV 
Sbjct  180  AEADAAHFIKNSKVKKPVVGFIAGRTAPPGKRMGHAGAIISGGGDSAESKIEILKSAGVV  239

Query  377  VCESPAKLGTTMLDVFTKR  321
            + ESP  +G T+L +   +
Sbjct  240  ISESPGLIGKTLLQIIQNK  258



>ref|WP_026871163.1| hypothetical protein, partial [Inquilinus limosus]
Length=155

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 109/136 (80%), Gaps = 0/136 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA GLGQ+TC+GIGGDP NGT+FVD LE F+ DP+TEGI++IGEIGG 
Sbjct  11   SGTLTYEAVAQTTAAGLGQTTCIGIGGDPVNGTSFVDALELFLGDPETEGIIMIGEIGGD  70

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AE   A FIK SGT KPVV FIAG TAPPGRRMGHAGA++SGG  TA  KI  LK AG+ 
Sbjct  71   AEVMGAEFIKASGTTKPVVGFIAGRTAPPGRRMGHAGAVISGGHDTADHKIEALKAAGIA  130

Query  377  VCESPAKLGTTMLDVF  330
            V +SPA LG+TM+ V 
Sbjct  131  VADSPAALGSTMIRVL  146



>emb|CDZ80070.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Chlamydia sp. 
'Rubis']
Length=293

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV+QTT +GLGQSTCVGIGGDP NGTNF+D LE F  D QTE I++IGEIGG 
Sbjct  155  SGTLTYEAVWQTTLLGLGQSTCVGIGGDPLNGTNFIDILELFEKDDQTEAILMIGEIGGE  214

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE  A +IK++   KPV AFIAG+TAPPGRRMGHAGAI+SGGKG+A DKI  LK A V 
Sbjct  215  AEELTAEWIKKN-CSKPVAAFIAGITAPPGRRMGHAGAIISGGKGSAIDKINALKNAKVL  273

Query  377  VCESPAKLGTTMLDVFTKR  321
            V +SPAKLG T+ +   KR
Sbjct  274  VTDSPAKLGLTVQEALQKR  292



>emb|CCG84081.1| protein of unknown function [Taphrina deformans PYCC 5710]
Length=318

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT VGLGQS  +GIGGDPF+GTNF+D L  F+ D +TEGI+LIGEIGG+
Sbjct  177  SGTLTYEAVNQTTNVGLGQSLVIGIGGDPFSGTNFIDALNLFLNDAETEGIILIGEIGGS  236

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA  IKESGT KPVV+FIAG+TAPPGRRMGHAGAI SGG GTA+ K   L+ AGV 
Sbjct  237  AEEDAARLIKESGTTKPVVSFIAGMTAPPGRRMGHAGAITSGGTGTAKGKQDALRAAGVI  296

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V ESPAKLG+ MLD FT+R ++
Sbjct  297  VSESPAKLGSFMLDEFTRRDMI  318



>gb|AEE62179.1| unknown [Dendroctonus ponderosae]
Length=322

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 103/139 (74%), Gaps = 3/139 (2%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLige---i  567
            SGTLTYEAV QTT  GLGQ+ CVGIGGDPFNGTNF+DCLE F+ D  TEGIVLIGE   +
Sbjct  182  SGTLTYEAVHQTTQSGLGQTLCVGIGGDPFNGTNFIDCLEVFLNDTDTEGIVLIGEIGGM  241

Query  566  ggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEA  387
                  E  A   +    KPVVAFIAG+TAPPGRRMGHAGAI+SGGKG A+DK++ L+  
Sbjct  242  DEENAAEYLAQHNKGSKSKPVVAFIAGMTAPPGRRMGHAGAIISGGKGKAEDKVKALEAV  301

Query  386  GVTVCESPAKLGTTMLDVF  330
            GV V  SPAK+G T+L+  
Sbjct  302  GVKVTRSPAKIGETLLEAM  320



>ref|WP_014415904.1| succinyl-CoA synthetase subsunit alpha [Rhodospirillum photometricum]
 emb|CCG09274.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Rhodospirillum 
photometricum DSM 122]
Length=291

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA GLGQSTC+GIGGDP NGTNF+DCLE F+ DP+TEGI++IGEIGG+
Sbjct  154  SGTLTYEAVAQTTAAGLGQSTCIGIGGDPVNGTNFIDCLEMFLGDPETEGIIMIGEIGGS  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA F+K+S   KP+  FIAG+TAPPGRRMGHAGAI++GGKGTA+DK+  ++ AG+ 
Sbjct  214  AEEEAAEFLKQSKIRKPMCGFIAGVTAPPGRRMGHAGAIIAGGKGTAEDKMEAMRSAGIL  273

Query  377  VCESPAKLGTTMLDVF  330
            V +SP+ LG+TML   
Sbjct  274  VADSPSALGSTMLQAL  289



>ref|XP_003383961.1| PREDICTED: succinyl-CoA ligase subunit alpha, mitochondrial-like 
[Amphimedon queenslandica]
Length=348

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 116/145 (80%), Gaps = 3/145 (2%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV+QT+ VGLGQS CVGIGGDPFNGTNFVDCL+ F+ DP T+ IVLIGEIGG+
Sbjct  204  SGTLTYEAVWQTSNVGLGQSLCVGIGGDPFNGTNFVDCLDVFLKDPDTDAIVLIGEIGGS  263

Query  557  aeeeaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEA  387
            AEE AA +++E  +    KPV AFIAGLTAPPGRRMGHAGAI+S GKG AQ+KI++L+ A
Sbjct  264  AEENAAEYLQEHNSGPNAKPVAAFIAGLTAPPGRRMGHAGAIISQGKGGAQEKIKSLEAA  323

Query  386  GVTVCESPAKLGTTMLDVFTKRGLL  312
            GV + +SPA +G T+     + G L
Sbjct  324  GVHIAKSPALMGETIRKAMAEAGKL  348



>ref|WP_042311149.1| succinate--CoA ligase [Burkholderia terrae]
Length=291

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA GLGQ+TC+GIGGDP NGTNF+DCLE F+AD  T+GI++IGEIGG+
Sbjct  154  SGTLTYEAVAQTTAAGLGQTTCIGIGGDPVNGTNFIDCLEMFLADDDTQGIIMIGEIGGS  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEE+AA F+K+SG++KPVV FIAG +APPGRRMGHAGAI+SGGKGTA  KI  ++ AG+ 
Sbjct  214  AEEDAAQFLKDSGSKKPVVGFIAGTSAPPGRRMGHAGAIISGGKGTAGAKIDAMRSAGIH  273

Query  377  VCESPAKLGTTML  339
            V +SPA LG TML
Sbjct  274  VAQSPAALGETML  286



>emb|CCI47060.1| unnamed protein product [Albugo candida]
Length=301

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 117/140 (84%), Gaps = 1/140 (1%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTT+ GLGQST +GIGGDPFNGTNF+DCLERF  DP+TEGI++IGEIGG+
Sbjct  159  SGTLTYEAVAQTTSTGLGQSTVIGIGGDPFNGTNFIDCLERFTNDPETEGIIMIGEIGGS  218

Query  557  aeeeaaafIKESG-TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            AEEEAA ++++ G   KPVV+FIAG+TAPPGRRMGHAGAIVSGGKGTA+ K R L+ AGV
Sbjct  219  AEEEAADWLQQYGDRNKPVVSFIAGMTAPPGRRMGHAGAIVSGGKGTAEGKFRALEAAGV  278

Query  380  TVCESPAKLGTTMLDVFTKR  321
             V  SPA+LG  M ++   R
Sbjct  279  AVTRSPARLGELMAELMKDR  298



>gb|ENN72632.1| hypothetical protein YQE_10730, partial [Dendroctonus ponderosae]
 gb|ERL85050.1| hypothetical protein D910_02473 [Dendroctonus ponderosae]
Length=322

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 103/139 (74%), Gaps = 3/139 (2%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLige---i  567
            SGTLTYEAV QTT  GLGQ+ CVGIGGDPFNGTNF+DCLE F+ D  TEGIVLIGE   +
Sbjct  182  SGTLTYEAVHQTTQSGLGQTLCVGIGGDPFNGTNFIDCLEVFLNDTDTEGIVLIGEIGGM  241

Query  566  ggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEA  387
                  E  A   +    KPVVAFIAG+TAPPGRRMGHAGAI+SGGKG A+DK++ L+  
Sbjct  242  DEENAAEYLAQHNKGSKSKPVVAFIAGMTAPPGRRMGHAGAIISGGKGKAEDKVKALEAV  301

Query  386  GVTVCESPAKLGTTMLDVF  330
            GV +  SPAK+G T+L+  
Sbjct  302  GVKITRSPAKIGETLLEAM  320



>ref|WP_011388967.1| succinyl-CoA synthetase subsunit alpha [Rhodospirillum rubrum]
 ref|YP_426300.1| succinyl-CoA synthetase subunit alpha [Rhodospirillum rubrum 
ATCC 11170]
 gb|ABC22013.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Rhodospirillum 
rubrum ATCC 11170]
 gb|AEO47725.1| succinyl-CoA synthetase subunit alpha [Rhodospirillum rubrum 
F11]
Length=292

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV QTTA GLGQSTC+GIGGDP NGTNF+DCLE F+ADP+T+GI++IGEIGG+
Sbjct  154  SGTLTYEAVAQTTAAGLGQSTCIGIGGDPVNGTNFIDCLEMFLADPETQGIIMIGEIGGS  213

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            AEEEAA F+K S  +KP+  FIAG+TAPPG+RMGHAGAI+SGGKGTA DK+  ++ AG+ 
Sbjct  214  AEEEAAEFLKHSKIKKPMCGFIAGVTAPPGKRMGHAGAIISGGKGTAGDKMDAMRSAGIL  273

Query  377  VCESPAKLGTTMLDVF  330
            V +SP+ LG+TM++  
Sbjct  274  VADSPSALGSTMVEAM  289



>gb|KFM62410.1| Succinyl-CoA ligase subunit alpha, mitochondrial, partial [Stegodyphus 
mimosarum]
Length=324

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 118/144 (82%), Gaps = 3/144 (2%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAV+QTT  GLGQS C+GIGGDPF GTNFVDCLE F+ DP T+GI+LIGEIGG 
Sbjct  180  SGTLTYEAVYQTTQAGLGQSLCIGIGGDPFCGTNFVDCLEVFLNDPMTKGIILIGEIGGE  239

Query  557  aeeeaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEA  387
             EE+AA ++KE+      KPVV+FIAGLTAPPGRRMGHAGAI++GGKG A+ KI  LK A
Sbjct  240  EEEKAAVYLKENNQGYRSKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGNARVKIEALKAA  299

Query  386  GVTVCESPAKLGTTMLDVFTKRGL  315
            GV + +SPA++G+T+L V  ++G+
Sbjct  300  GVVITKSPAQMGSTILQVMQQKGM  323



>dbj|GAA49470.1| succinyl-CoA synthetase alpha subunit [Clonorchis sinensis]
Length=342

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 113/135 (84%), Gaps = 3/135 (2%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQT+  G GQS C+GIGGDPFNGTNF+DCLE F+ DPQTEGI+L+GEIGG 
Sbjct  200  SGTLTYEAVFQTSQEGHGQSLCIGIGGDPFNGTNFIDCLEVFLKDPQTEGILLLGEIGGE  259

Query  557  aeeeaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEA  387
            AEE+AAA++KE  +    KPV AFIAGLTAPPGRRMGHAGAI+S GKG A++K+  L++A
Sbjct  260  AEEKAAAYLKEHNSGPNRKPVAAFIAGLTAPPGRRMGHAGAIISMGKGGAKEKMACLEDA  319

Query  386  GVTVCESPAKLGTTM  342
            GV V  SPA+LG TM
Sbjct  320  GVWVTASPAQLGATM  334



>ref|XP_009162469.1| hypothetical protein T265_00432 [Opisthorchis viverrini]
 gb|KER33751.1| hypothetical protein T265_00432 [Opisthorchis viverrini]
Length=326

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 113/135 (84%), Gaps = 3/135 (2%)
 Frame = -3

Query  737  SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  558
            SGTLTYEAVFQT+  G GQS C+GIGGDPFNGTNF+DCLE F+ DPQTEGI+L+GEIGG 
Sbjct  184  SGTLTYEAVFQTSQEGHGQSLCIGIGGDPFNGTNFIDCLEVFLKDPQTEGILLLGEIGGE  243

Query  557  aeeeaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEA  387
            AEE+AAA++KE  +    KPV AFIAGLTAPPGRRMGHAGAI+S GKG A++K+  L++A
Sbjct  244  AEEKAAAYLKEHNSGPNRKPVAAFIAGLTAPPGRRMGHAGAIISMGKGGAKEKMACLEDA  303

Query  386  GVTVCESPAKLGTTM  342
            GV V  SPA+LG TM
Sbjct  304  GVCVTASPAQLGATM  318



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515