BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF024O09

Length=781
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009767492.1|  PREDICTED: uncharacterized protein At5g64816...    207   1e-63   Nicotiana sylvestris
ref|XP_009591420.1|  PREDICTED: uncharacterized protein At5g64816...    202   7e-62   Nicotiana tomentosiformis
ref|XP_007048139.1|  Uncharacterized protein isoform 1                  203   9e-62   
ref|XP_004237990.1|  PREDICTED: uncharacterized protein At5g64816...    199   2e-60   Solanum lycopersicum
ref|XP_007205868.1|  hypothetical protein PRUPE_ppa011208mg             201   5e-60   
ref|XP_007048140.1|  Uncharacterized protein isoform 2                  197   6e-60   Theobroma cacao [chocolate]
ref|XP_010942079.1|  PREDICTED: uncharacterized protein At5g64816       197   7e-60   
ref|XP_010683322.1|  PREDICTED: uncharacterized protein At5g64816       197   8e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006338066.1|  PREDICTED: uncharacterized protein At5g64816...    196   2e-59   Solanum tuberosum [potatoes]
ref|XP_008232454.1|  PREDICTED: uncharacterized protein At5g64816...    196   2e-59   Prunus mume [ume]
emb|CDP11499.1|  unnamed protein product                                195   4e-59   Coffea canephora [robusta coffee]
gb|KJB44296.1|  hypothetical protein B456_007G245000                    195   6e-59   Gossypium raimondii
ref|XP_008386230.1|  PREDICTED: uncharacterized protein At5g64816...    194   7e-59   Malus domestica [apple tree]
ref|XP_009340392.1|  PREDICTED: uncharacterized protein At5g64816...    194   8e-59   Pyrus x bretschneideri [bai li]
ref|XP_004141962.1|  PREDICTED: uncharacterized protein At5g64816...    194   9e-59   Cucumis sativus [cucumbers]
ref|XP_010444433.1|  PREDICTED: uncharacterized protein At5g64816...    196   9e-59   Camelina sativa [gold-of-pleasure]
ref|NP_001049198.1|  Os03g0185600                                       194   9e-59   
gb|EMT10150.1|  hypothetical protein F775_32746                         194   1e-58   
ref|XP_010229072.1|  PREDICTED: uncharacterized protein At5g64816       194   1e-58   
ref|XP_007144129.1|  hypothetical protein PHAVU_007G131000g             193   2e-58   Phaseolus vulgaris [French bean]
ref|XP_010520052.1|  PREDICTED: uncharacterized protein At5g64816       193   3e-58   Tarenaya hassleriana [spider flower]
ref|XP_004288556.1|  PREDICTED: uncharacterized protein At5g64816       192   5e-58   Fragaria vesca subsp. vesca
ref|XP_011016925.1|  PREDICTED: uncharacterized protein At5g64816       192   5e-58   Populus euphratica
ref|XP_002301092.1|  hypothetical protein POPTR_0002s10550g             192   5e-58   
ref|XP_008367751.1|  PREDICTED: uncharacterized protein At5g64816       192   6e-58   Malus domestica [apple tree]
ref|XP_008342839.1|  PREDICTED: uncharacterized protein At5g64816       191   1e-57   
ref|XP_008670736.1|  PREDICTED: uncharacterized protein LOC100276...    194   1e-57   
ref|XP_002307342.1|  hypothetical protein POPTR_0005s17880g             191   1e-57   Populus trichocarpa [western balsam poplar]
ref|XP_009340404.1|  PREDICTED: uncharacterized protein At5g64816...    191   1e-57   Pyrus x bretschneideri [bai li]
ref|XP_004985446.1|  PREDICTED: uncharacterized protein At5g64816...    191   1e-57   Setaria italica
ref|XP_011073753.1|  PREDICTED: uncharacterized protein At5g64816       191   2e-57   Sesamum indicum [beniseed]
ref|XP_004237465.1|  PREDICTED: uncharacterized protein At5g64816       191   2e-57   Solanum lycopersicum
ref|XP_002468374.1|  hypothetical protein SORBIDRAFT_01g044840          191   2e-57   Sorghum bicolor [broomcorn]
ref|XP_010484278.1|  PREDICTED: uncharacterized protein At5g64816...    191   2e-57   Camelina sativa [gold-of-pleasure]
gb|EYU23710.1|  hypothetical protein MIMGU_mgv1a016312mg                191   2e-57   Erythranthe guttata [common monkey flower]
ref|XP_010462676.1|  PREDICTED: uncharacterized protein At5g64816...    191   2e-57   Camelina sativa [gold-of-pleasure]
ref|NP_001143961.1|  uncharacterized protein LOC100276776               191   2e-57   
gb|KHG12632.1|  hypothetical protein F383_18594                         191   2e-57   Gossypium arboreum [tree cotton]
ref|XP_010444434.1|  PREDICTED: uncharacterized protein At5g64816...    191   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_009336364.1|  PREDICTED: uncharacterized protein At5g64816       190   3e-57   Pyrus x bretschneideri [bai li]
ref|XP_008795149.1|  PREDICTED: uncharacterized protein At5g64816...    190   3e-57   Phoenix dactylifera
gb|KJB71272.1|  hypothetical protein B456_011G114100                    190   3e-57   Gossypium raimondii
ref|XP_006281261.1|  hypothetical protein CARUB_v10027305mg             191   3e-57   
gb|ACG40459.1|  hypothetical protein                                    190   3e-57   Zea mays [maize]
ref|XP_009779352.1|  PREDICTED: uncharacterized protein At5g64816...    190   4e-57   Nicotiana sylvestris
ref|XP_009626114.1|  PREDICTED: uncharacterized protein At5g64816       190   4e-57   Nicotiana tomentosiformis
gb|KHN42620.1|  Hypothetical protein glysoja_018863                     190   4e-57   Glycine soja [wild soybean]
ref|XP_010108559.1|  hypothetical protein L484_008327                   190   4e-57   Morus notabilis
ref|XP_010272500.1|  PREDICTED: uncharacterized protein At5g64816...    190   4e-57   Nelumbo nucifera [Indian lotus]
ref|NP_001237023.1|  uncharacterized protein LOC100305811 precursor     190   5e-57   Glycine max [soybeans]
ref|XP_003517376.2|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    190   5e-57   
ref|XP_007212235.1|  hypothetical protein PRUPE_ppa013390mg             190   5e-57   Prunus persica
ref|XP_008353764.1|  PREDICTED: uncharacterized protein At5g64816       189   6e-57   
ref|XP_008440134.1|  PREDICTED: uncharacterized protein At5g64816       189   8e-57   Cucumis melo [Oriental melon]
ref|XP_009150562.1|  PREDICTED: uncharacterized protein At5g64816       189   2e-56   Brassica rapa
emb|CDY08847.1|  BnaA06g23770D                                          189   2e-56   Brassica napus [oilseed rape]
ref|XP_009406604.1|  PREDICTED: uncharacterized protein At5g64816...    188   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_568997.1|  uncharacterized protein                               188   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001144395.1|  uncharacterized protein LOC100277328               188   2e-56   
ref|XP_002864925.1|  hypothetical protein ARALYDRAFT_919807             188   2e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_010061522.1|  PREDICTED: uncharacterized protein At5g64816       188   3e-56   
ref|XP_002262994.1|  PREDICTED: uncharacterized protein At5g64816       187   3e-56   Vitis vinifera
ref|XP_004495297.1|  PREDICTED: uncharacterized protein At5g64816...    187   5e-56   Cicer arietinum [garbanzo]
ref|XP_009340410.1|  PREDICTED: uncharacterized protein At5g64816...    187   6e-56   Pyrus x bretschneideri [bai li]
ref|XP_002527373.1|  conserved hypothetical protein                     187   9e-56   Ricinus communis
ref|XP_006433833.1|  hypothetical protein CICLE_v10002841mg             186   1e-55   Citrus clementina [clementine]
ref|NP_001235178.1|  uncharacterized protein LOC100499983 precursor     186   1e-55   
ref|XP_011460768.1|  PREDICTED: uncharacterized protein At5g64816...    186   2e-55   Fragaria vesca subsp. vesca
gb|KEH42678.1|  Thionin-like protein                                    186   2e-55   Medicago truncatula
ref|XP_006394107.1|  hypothetical protein EUTSA_v10005124mg             186   3e-55   Eutrema salsugineum [saltwater cress]
ref|XP_008803701.1|  PREDICTED: uncharacterized protein At5g64816...    185   4e-55   Phoenix dactylifera
ref|XP_011013229.1|  PREDICTED: uncharacterized protein At5g64816...    185   5e-55   Populus euphratica
ref|XP_009403333.1|  PREDICTED: uncharacterized protein At5g64816...    185   6e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010254506.1|  PREDICTED: uncharacterized protein At5g64816...    183   2e-54   Nelumbo nucifera [Indian lotus]
gb|KDP35262.1|  hypothetical protein JCGZ_09421                         182   6e-54   Jatropha curcas
gb|KDP41477.1|  hypothetical protein JCGZ_15884                         182   6e-54   Jatropha curcas
ref|XP_010272499.1|  PREDICTED: uncharacterized protein At5g64816...    182   6e-54   Nelumbo nucifera [Indian lotus]
ref|XP_010272498.1|  PREDICTED: uncharacterized protein At5g64816...    181   1e-53   Nelumbo nucifera [Indian lotus]
emb|CBI19260.3|  unnamed protein product                                182   2e-53   Vitis vinifera
ref|XP_010272501.1|  PREDICTED: uncharacterized protein At5g64816...    180   2e-53   Nelumbo nucifera [Indian lotus]
dbj|BAA97293.1|  unnamed protein product                                193   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002283868.1|  PREDICTED: uncharacterized protein At5g64816       179   5e-53   Vitis vinifera
ref|XP_011460769.1|  PREDICTED: uncharacterized protein At5g64816...    179   6e-53   Fragaria vesca subsp. vesca
ref|XP_010547633.1|  PREDICTED: uncharacterized protein At5g64816...    179   1e-52   Tarenaya hassleriana [spider flower]
gb|KDP38898.1|  hypothetical protein JCGZ_05055                         179   1e-52   Jatropha curcas
gb|EPS70584.1|  hypothetical protein M569_04178                         176   8e-52   Genlisea aurea
ref|XP_009394932.1|  PREDICTED: uncharacterized protein At5g64816...    169   9e-49   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB40418.1|  hypothetical protein B456_007G062500                    164   3e-47   Gossypium raimondii
ref|XP_006833174.1|  hypothetical protein AMTR_s00072p00147740          161   6e-46   Amborella trichopoda
gb|EYU41415.1|  hypothetical protein MIMGU_mgv1a016144mg                158   2e-44   Erythranthe guttata [common monkey flower]
gb|ABK23825.1|  unknown                                                 151   5e-42   Picea sitchensis
ref|XP_008356963.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    148   7e-41   
gb|AFG43932.1|  hypothetical protein 0_7150_01                          147   9e-41   Pinus taeda
ref|XP_001778721.1|  predicted protein                                  144   1e-38   
ref|XP_010107682.1|  hypothetical protein L484_007700                   136   4e-36   
gb|KHN30720.1|  Hypothetical protein glysoja_034063                     122   1e-31   Glycine soja [wild soybean]
ref|XP_005649195.1|  hypothetical protein COCSUDRAFT_53027              122   6e-31   Coccomyxa subellipsoidea C-169
ref|XP_001774164.1|  predicted protein                                  119   1e-28   
ref|XP_007018217.1|  Uncharacterized protein TCM_034499                 117   3e-28   
ref|XP_011401016.1|  Calmodulin                                         114   2e-26   Auxenochlorella protothecoides
emb|CEG00360.1|  unnamed product                                        106   5e-25   Ostreococcus tauri
ref|XP_005843384.1|  hypothetical protein CHLNCDRAFT_28208              105   9e-25   Chlorella variabilis
ref|XP_007508590.1|  predicted protein                                  101   7e-23   Bathycoccus prasinos
ref|XP_002506359.1|  predicted protein                                  100   1e-22   Micromonas commoda
ref|XP_002954256.1|  hypothetical protein VOLCADRAFT_82678            99.8    1e-22   Volvox carteri f. nagariensis
ref|XP_001421737.1|  predicted protein                                95.1    1e-20   Ostreococcus lucimarinus CCE9901
ref|XP_001700967.1|  hypothetical protein CHLREDRAFT_134530           94.0    2e-20   Chlamydomonas reinhardtii
ref|XP_006847669.1|  hypothetical protein AMTR_s00149p00038820        87.4    8e-18   
ref|XP_003063470.1|  predicted protein                                75.9    3e-14   Micromonas pusilla CCMP1545
ref|XP_003083599.1|  unnamed protein product                          53.9    1e-05   



>ref|XP_009767492.1| PREDICTED: uncharacterized protein At5g64816-like [Nicotiana 
sylvestris]
 ref|XP_009767493.1| PREDICTED: uncharacterized protein At5g64816-like [Nicotiana 
sylvestris]
 ref|XP_009767494.1| PREDICTED: uncharacterized protein At5g64816-like [Nicotiana 
sylvestris]
Length=128

 Score =   207 bits (526),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/119 (95%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE WWSL+GAAVPAV+AGQAFRMKKRRD+E+RLKRARGREKNSDDIFVCERVCTSKRML
Sbjct  1    MVEWWWSLVGAAVPAVMAGQAFRMKKRRDEEERLKRARGREKNSDDIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP PDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR
Sbjct  61   KKVGAFSKDPTPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  119



>ref|XP_009591420.1| PREDICTED: uncharacterized protein At5g64816-like [Nicotiana 
tomentosiformis]
 ref|XP_009591421.1| PREDICTED: uncharacterized protein At5g64816-like [Nicotiana 
tomentosiformis]
Length=128

 Score =   202 bits (514),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 111/119 (93%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE WWSL+GAAVPAV+AGQAFR+KKRRD+E+RLKRA+GREKNSDDIFVCERVCTSKRML
Sbjct  1    MVEWWWSLVGAAVPAVVAGQAFRLKKRRDEEERLKRAKGREKNSDDIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP PDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR
Sbjct  61   KKVGAFSKDPTPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  119



>ref|XP_007048139.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX92296.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=165

 Score =   203 bits (517),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 3/136 (2%)
 Frame = -3

Query  542  INKEVQEFS---FQAAVMVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKN  372
            +NKEV+E         VMVE+WWSLLGAA+PAV+AGQAFRMKKRR +EQR+K ARGREK+
Sbjct  23   LNKEVREEERACLLQFVMVEVWWSLLGAAIPAVIAGQAFRMKKRRAEEQRIKSARGREKS  82

Query  371  SDDIFVCERVCTSKRMLKKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVP  192
            SDDIFVCERVCTSKRMLKKVGAFSKDP+ DTCVTVCGVSELDAC+DACARTVCVNQHQVP
Sbjct  83   SDDIFVCERVCTSKRMLKKVGAFSKDPIRDTCVTVCGVSELDACSDACARTVCVNQHQVP  142

Query  191  NWNDICLKRCQSECLR  144
            NWNDICL+RCQSECLR
Sbjct  143  NWNDICLRRCQSECLR  158



>ref|XP_004237990.1| PREDICTED: uncharacterized protein At5g64816-like [Solanum lycopersicum]
Length=128

 Score =   199 bits (505),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE WWS+LGAAVPAV+AGQAFR KKRRD+E+R  RARGREKNSDDIFVCERVCTS RML
Sbjct  1    MVEWWWSVLGAAVPAVMAGQAFRTKKRRDEEERSNRARGREKNSDDIFVCERVCTSNRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP PDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR
Sbjct  61   KKVGAFSKDPTPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  119



>ref|XP_007205868.1| hypothetical protein PRUPE_ppa011208mg [Prunus persica]
 gb|EMJ07067.1| hypothetical protein PRUPE_ppa011208mg [Prunus persica]
Length=219

 Score =   201 bits (510),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 108/122 (89%), Gaps = 1/122 (1%)
 Frame = -3

Query  509  AAVMVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSK  330
            A VMVE+WWSLL A    V     FR+KKRR +EQRLK ARGREKNSD+IFVCERVCTSK
Sbjct  92   ALVMVEVWWSLLAAIPALVAGQA-FRVKKRRAEEQRLKSARGREKNSDEIFVCERVCTSK  150

Query  329  RMLKKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSEC  150
            RMLKK+GAFSKDP+PDTCVTVCGVSELDACADACARTVCVNQHQVPNWND CL+RCQSEC
Sbjct  151  RMLKKLGAFSKDPIPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDKCLRRCQSEC  210

Query  149  LR  144
            L+
Sbjct  211  LK  212



>ref|XP_007048140.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX92297.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=126

 Score =   197 bits (501),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 107/119 (90%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLLGAA+PAV+AGQAFRMKKRR +EQR+K ARGREK+SDDIFVCERVCTSKRML
Sbjct  1    MVEVWWSLLGAAIPAVIAGQAFRMKKRRAEEQRIKSARGREKSSDDIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+ DTCVTVCGVSELDAC+DACARTVCVNQHQVPNWNDICL+RCQSECLR
Sbjct  61   KKVGAFSKDPIRDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLR  119



>ref|XP_010942079.1| PREDICTED: uncharacterized protein At5g64816 [Elaeis guineensis]
Length=126

 Score =   197 bits (501),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV++WWSLLGAA+PAV+AGQA R+K+RR +EQ+LK ARGREKNSDDIFVCERVCTSKRML
Sbjct  1    MVDIWWSLLGAAIPAVVAGQAIRVKRRRAEEQKLKSARGREKNSDDIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP PDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECL+
Sbjct  61   KKVGAFSKDPTPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLK  119



>ref|XP_010683322.1| PREDICTED: uncharacterized protein At5g64816 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010683323.1| PREDICTED: uncharacterized protein At5g64816 [Beta vulgaris subsp. 
vulgaris]
Length=126

 Score =   197 bits (500),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLLGAA+PAV+AGQAFR+K+RRD+EQR+K ARGREK+SDDIFVCERVCTSKRML
Sbjct  1    MVEVWWSLLGAAIPAVVAGQAFRIKRRRDEEQRIKTARGREKSSDDIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDAC DACARTVCVNQH VPNWND+CL+RCQSECL+
Sbjct  61   KKVGAFSKDPIPDTCVTVCGVSELDACTDACARTVCVNQHHVPNWNDVCLRRCQSECLK  119



>ref|XP_006338066.1| PREDICTED: uncharacterized protein At5g64816-like isoform X1 
[Solanum tuberosum]
 ref|XP_006338067.1| PREDICTED: uncharacterized protein At5g64816-like isoform X2 
[Solanum tuberosum]
Length=128

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE WWS+LGAAVPAV+AGQAFR KKRRD+E+RL RARGREKNSDDIFVCERVCTS RML
Sbjct  1    MVEWWWSVLGAAVPAVMAGQAFRTKKRRDEEERLNRARGREKNSDDIFVCERVCTSNRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP P TCVTVCGVSELDACADACAR VCVNQHQVPNWNDICLKRCQSECLR
Sbjct  61   KKVGAFSKDPTPFTCVTVCGVSELDACADACARIVCVNQHQVPNWNDICLKRCQSECLR  119



>ref|XP_008232454.1| PREDICTED: uncharacterized protein At5g64816-like [Prunus mume]
 ref|XP_008232462.1| PREDICTED: uncharacterized protein At5g64816-like [Prunus mume]
 ref|XP_008245580.1| PREDICTED: uncharacterized protein At5g64816-like [Prunus mume]
 ref|XP_008245581.1| PREDICTED: uncharacterized protein At5g64816-like [Prunus mume]
 ref|XP_008245582.1| PREDICTED: uncharacterized protein At5g64816-like [Prunus mume]
Length=125

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLL A    V     FR+KKRR +EQRLK ARGREKNSD+IFVCERVCTSKRML
Sbjct  1    MVEVWWSLLAAIPAVVAGQA-FRVKKRRAEEQRLKSARGREKNSDEIFVCERVCTSKRML  59

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KK+GAFSKDP+PDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICL+RCQSECL+
Sbjct  60   KKLGAFSKDPIPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLRRCQSECLK  118



>emb|CDP11499.1| unnamed protein product [Coffea canephora]
Length=128

 Score =   195 bits (496),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+ WWS++ AA+PAV+AGQAFRMK RR +EQRLK ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVDWWWSIVAAAIPAVVAGQAFRMKNRRAEEQRLKSARGREKSSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP PDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR
Sbjct  61   KKVGAFSKDPTPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  119



>gb|KJB44296.1| hypothetical protein B456_007G245000 [Gossypium raimondii]
 gb|KJB44297.1| hypothetical protein B456_007G245000 [Gossypium raimondii]
 gb|KJB44298.1| hypothetical protein B456_007G245000 [Gossypium raimondii]
 gb|KJB44299.1| hypothetical protein B456_007G245000 [Gossypium raimondii]
 gb|KJB44300.1| hypothetical protein B456_007G245000 [Gossypium raimondii]
 gb|KJB44301.1| hypothetical protein B456_007G245000 [Gossypium raimondii]
Length=126

 Score =   195 bits (495),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+ WWSLLGAA+PAV+AGQAFRMKK+  +E+R+K ARGREK+SDDIFVCERVCTSKRML
Sbjct  1    MVDAWWSLLGAAIPAVIAGQAFRMKKKHAEEERIKSARGREKSSDDIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDAC+DACARTVCVNQHQVPNWNDICL+RCQSECLR
Sbjct  61   KKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLR  119



>ref|XP_008386230.1| PREDICTED: uncharacterized protein At5g64816-like [Malus domestica]
Length=125

 Score =   194 bits (494),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLL A    V     FR+KKRR +EQRLK ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVEVWWSLLAAIPAVVAGQA-FRVKKRRGEEQRLKSARGREKSSDEIFVCERVCTSKRML  59

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICL+RCQSECL+
Sbjct  60   KKVGAFSKDPIPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLRRCQSECLK  118



>ref|XP_009340392.1| PREDICTED: uncharacterized protein At5g64816-like [Pyrus x bretschneideri]
Length=124

 Score =   194 bits (494),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLL A    V     FR+KKRR +EQRLK ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVEVWWSLLAAIPAVVAGQA-FRVKKRRGEEQRLKSARGREKSSDEIFVCERVCTSKRML  59

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICL+RCQSECL+
Sbjct  60   KKVGAFSKDPIPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLRRCQSECLK  118



>ref|XP_004141962.1| PREDICTED: uncharacterized protein At5g64816-like isoform 1 [Cucumis 
sativus]
 ref|XP_004141963.1| PREDICTED: uncharacterized protein At5g64816-like isoform 2 [Cucumis 
sativus]
 ref|XP_004157862.1| PREDICTED: uncharacterized protein At5g64816-like isoform 1 [Cucumis 
sativus]
 ref|XP_004157863.1| PREDICTED: uncharacterized protein At5g64816-like isoform 2 [Cucumis 
sativus]
 gb|KGN48427.1| hypothetical protein Csa_6G486990 [Cucumis sativus]
Length=126

 Score =   194 bits (494),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLLGAA+PAV+AGQ ++MK+R  +EQR+K ARGREKNSDDIFVCERVCTSKRML
Sbjct  1    MVEVWWSLLGAAIPAVVAGQVYKMKRRHSEEQRIKTARGREKNSDDIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVG+FSKDP+PDTCVTVCG+SELDAC DACARTVCVNQHQVPNWND+CL+RCQSECL+
Sbjct  61   KKVGSFSKDPIPDTCVTVCGLSELDACTDACARTVCVNQHQVPNWNDVCLRRCQSECLK  119



>ref|XP_010444433.1| PREDICTED: uncharacterized protein At5g64816 isoform X1 [Camelina 
sativa]
Length=172

 Score =   196 bits (498),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = -3

Query  542  INKEVQEFSFQAAVMVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDD  363
            + + V+  SF    MVE+WWSL+GAAVPA++AGQA+R+KKRR DE+R+K ARGREK+SD+
Sbjct  25   VMRSVKFKSFHKKKMVEVWWSLIGAAVPALVAGQAWRIKKRRGDEERIKSARGREKSSDE  84

Query  362  IFVCERVCTSKRMLKKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWN  183
            IFVCERVCTSKRMLKKVGAFSKDP+PDTCVTVCGVSELDAC+DACARTVCVNQHQV NWN
Sbjct  85   IFVCERVCTSKRMLKKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVANWN  144

Query  182  DICLKRCQSECLR  144
            DICL+RCQSECL+
Sbjct  145  DICLRRCQSECLK  157



>ref|NP_001049198.1| Os03g0185600 [Oryza sativa Japonica Group]
 ref|XP_006649520.1| PREDICTED: uncharacterized protein At5g64816-like [Oryza brachyantha]
 gb|ABF94356.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11112.1| Os03g0185600 [Oryza sativa Japonica Group]
 gb|EAY88822.1| hypothetical protein OsI_10295 [Oryza sativa Indica Group]
 gb|EAZ25854.1| hypothetical protein OsJ_09693 [Oryza sativa Japonica Group]
Length=125

 Score =   194 bits (493),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+ WW LL AA+PAV+AGQAFR+K+RRD+EQRLK ARGREK+SD++FVCERVCTSKRML
Sbjct  1    MVDAWWPLLAAAIPAVVAGQAFRVKRRRDEEQRLKAARGREKSSDEVFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+P+TCVTVCGVSELDACADACARTVCVNQHQVPNWND+CLKRCQSECL+
Sbjct  61   KKVGAFSKDPIPETCVTVCGVSELDACADACARTVCVNQHQVPNWNDVCLKRCQSECLK  119



>gb|EMT10150.1| hypothetical protein F775_32746 [Aegilops tauschii]
Length=125

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+ WW LL AAVPA++AGQA R+K+RRD+EQRLK ARGREK+SD++FVCERVCTSKRML
Sbjct  1    MVDAWWPLLAAAVPAIVAGQAIRVKRRRDEEQRLKAARGREKSSDEVFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDACADACARTVCVNQHQVPNWND+CLKRCQSECL+
Sbjct  61   KKVGAFSKDPIPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDVCLKRCQSECLK  119



>ref|XP_010229072.1| PREDICTED: uncharacterized protein At5g64816 [Brachypodium distachyon]
Length=125

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+ WW LL AAVPA++AGQA R+K+RRD+EQRLK ARGREK+SD++FVCERVCTSKRML
Sbjct  1    MVDAWWPLLAAAVPAIVAGQAIRVKRRRDEEQRLKAARGREKSSDEVFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDACADACARTVCVNQHQVPNWND+CLKRCQSECL+
Sbjct  61   KKVGAFSKDPIPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDVCLKRCQSECLK  119



>ref|XP_007144129.1| hypothetical protein PHAVU_007G131000g [Phaseolus vulgaris]
 gb|ESW16123.1| hypothetical protein PHAVU_007G131000g [Phaseolus vulgaris]
Length=125

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLLGAA+P V+AGQAFR+KKR  +EQRLK ARGRE++SD+IFVCERVCTSKRML
Sbjct  1    MVEIWWSLLGAAIPVVVAGQAFRVKKRHAEEQRLKSARGRERSSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVG+FSKDP+PDTCVTVCGVS+LDACADACARTVCVNQHQVPNWNDICL+RCQSECL+
Sbjct  61   KKVGSFSKDPIPDTCVTVCGVSDLDACADACARTVCVNQHQVPNWNDICLRRCQSECLK  119



>ref|XP_010520052.1| PREDICTED: uncharacterized protein At5g64816 [Tarenaya hassleriana]
 ref|XP_010520060.1| PREDICTED: uncharacterized protein At5g64816 [Tarenaya hassleriana]
 ref|XP_010520065.1| PREDICTED: uncharacterized protein At5g64816 [Tarenaya hassleriana]
Length=126

 Score =   193 bits (490),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLLGAAVPA++AGQA RMKKRR +E R+K ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVEVWWSLLGAAVPALVAGQAIRMKKRRAEEGRIKSARGREKSSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KK+GAFSKDP+PDTCVTVCGVSELDAC+DACARTVCVN HQVPNWNDICL+RCQSECLR
Sbjct  61   KKIGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNNHQVPNWNDICLRRCQSECLR  119



>ref|XP_004288556.1| PREDICTED: uncharacterized protein At5g64816 [Fragaria vesca 
subsp. vesca]
Length=125

 Score =   192 bits (488),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+ WWSLL A    V     +R+KKRR +EQRLK ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVDAWWSLLAAIPAVVAGQA-YRVKKRRTEEQRLKSARGREKSSDEIFVCERVCTSKRML  59

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICL+RCQSECL+
Sbjct  60   KKVGAFSKDPIPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLRRCQSECLK  118



>ref|XP_011016925.1| PREDICTED: uncharacterized protein At5g64816 [Populus euphratica]
 ref|XP_011016926.1| PREDICTED: uncharacterized protein At5g64816 [Populus euphratica]
 ref|XP_011016927.1| PREDICTED: uncharacterized protein At5g64816 [Populus euphratica]
 ref|XP_011016928.1| PREDICTED: uncharacterized protein At5g64816 [Populus euphratica]
Length=127

 Score =   192 bits (488),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+ WWSLLGAA+PA++AGQA RMKKRR DEQRLK ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVDPWWSLLGAAIPAIIAGQALRMKKRRADEQRLKSARGREKSSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGA SKDP  DTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICL+RCQSECLR
Sbjct  61   KKVGALSKDPTIDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLRRCQSECLR  119



>ref|XP_002301092.1| hypothetical protein POPTR_0002s10550g [Populus trichocarpa]
 gb|EEE80365.1| hypothetical protein POPTR_0002s10550g [Populus trichocarpa]
Length=127

 Score =   192 bits (488),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+ WWSLLGAA+PA++AGQA RMKKRR DEQRLK ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVDPWWSLLGAAIPAIIAGQALRMKKRRADEQRLKSARGREKSSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGA SKDP  DTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICL+RCQSECLR
Sbjct  61   KKVGALSKDPTIDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLRRCQSECLR  119



>ref|XP_008367751.1| PREDICTED: uncharacterized protein At5g64816 [Malus domestica]
 ref|XP_008367758.1| PREDICTED: uncharacterized protein At5g64816 [Malus domestica]
 ref|XP_009348413.1| PREDICTED: uncharacterized protein At5g64816 [Pyrus x bretschneideri]
 ref|XP_009348418.1| PREDICTED: uncharacterized protein At5g64816 [Pyrus x bretschneideri]
Length=125

 Score =   192 bits (488),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLL A    V     FR+KKR  +EQRLK ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVEVWWSLLAAIPAVVAGQA-FRVKKRHAEEQRLKSARGREKSSDEIFVCERVCTSKRML  59

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICL+RCQSECL+
Sbjct  60   KKVGAFSKDPIPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLRRCQSECLK  118



>ref|XP_008342839.1| PREDICTED: uncharacterized protein At5g64816 [Malus domestica]
Length=124

 Score =   191 bits (486),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLL A    V     FR+KKRR +EQRL  ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVEVWWSLLAAIPAVVAGQA-FRVKKRRAEEQRLMSARGREKSSDEIFVCERVCTSKRML  59

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PD+CVTVCGVSELDACADACARTVCVNQHQVPNWNDICL+RCQSECL+
Sbjct  60   KKVGAFSKDPIPDSCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLRRCQSECLK  118



>ref|XP_008670736.1| PREDICTED: uncharacterized protein LOC100276776 isoform X1 [Zea 
mays]
 tpg|DAA43754.1| TPA: hypothetical protein ZEAMMB73_736527 [Zea mays]
Length=205

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  503  VMVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRM  324
             MV+ WW LLGAA+PA++AGQ  R+K+RRD+EQRLK ARGREK+SD++FVCERVCTSKRM
Sbjct  80   AMVDAWWPLLGAAIPALVAGQFVRIKRRRDEEQRLKAARGREKSSDEVFVCERVCTSKRM  139

Query  323  LKKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            LKKVGAFSKDP+P+TCVTVCGVSELDACADACARTVCVNQHQVPNWND+CLKRCQSECL+
Sbjct  140  LKKVGAFSKDPIPETCVTVCGVSELDACADACARTVCVNQHQVPNWNDVCLKRCQSECLK  199



>ref|XP_002307342.1| hypothetical protein POPTR_0005s17880g [Populus trichocarpa]
 gb|EEE94338.1| hypothetical protein POPTR_0005s17880g [Populus trichocarpa]
Length=127

 Score =   191 bits (486),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+ WWSLLGAA+PA++AGQA RMKKRR DEQRLK ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVDPWWSLLGAAIPAIIAGQALRMKKRRADEQRLKSARGREKSSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGA SKDP  DTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICL+RCQSECLR
Sbjct  61   KKVGALSKDPTIDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLRRCQSECLR  119



>ref|XP_009340404.1| PREDICTED: uncharacterized protein At5g64816-like [Pyrus x bretschneideri]
Length=125

 Score =   191 bits (486),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+ WSLL A    V     FR+KKRR +EQRLK ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVEVLWSLLAAIPAVVAGQA-FRVKKRRGEEQRLKSARGREKSSDEIFVCERVCTSKRML  59

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICL+RCQSECL+
Sbjct  60   KKVGAFSKDPIPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLRRCQSECLK  118



>ref|XP_004985446.1| PREDICTED: uncharacterized protein At5g64816-like isoform X1 
[Setaria italica]
 ref|XP_004985447.1| PREDICTED: uncharacterized protein At5g64816-like isoform X2 
[Setaria italica]
Length=125

 Score =   191 bits (486),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+ WW LLGAA+PA++AGQ  R+K+RRD+EQRLK ARGREK+SD++FVCERVCTSKRML
Sbjct  1    MVDAWWPLLGAAIPALVAGQFIRIKRRRDEEQRLKAARGREKSSDEVFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+P+TCVTVCGVSELDACADACARTVCVNQHQVPNWND+CLKRCQSECL+
Sbjct  61   KKVGAFSKDPIPETCVTVCGVSELDACADACARTVCVNQHQVPNWNDVCLKRCQSECLK  119



>ref|XP_011073753.1| PREDICTED: uncharacterized protein At5g64816 [Sesamum indicum]
 ref|XP_011073754.1| PREDICTED: uncharacterized protein At5g64816 [Sesamum indicum]
 ref|XP_011073755.1| PREDICTED: uncharacterized protein At5g64816 [Sesamum indicum]
 ref|XP_011073757.1| PREDICTED: uncharacterized protein At5g64816 [Sesamum indicum]
 ref|XP_011073758.1| PREDICTED: uncharacterized protein At5g64816 [Sesamum indicum]
Length=126

 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WW+LLGAAVP  +AGQAFRMK R  +EQR+K ARG+E+++DDIFVCERVCTSKRML
Sbjct  1    MVEVWWTLLGAAVPVFIAGQAFRMKARHAEEQRIKSARGKERSADDIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PD+CVTVCGVSELDACADACARTVCVNQHQVPNWND+CL+RCQSECL+
Sbjct  61   KKVGAFSKDPIPDSCVTVCGVSELDACADACARTVCVNQHQVPNWNDVCLRRCQSECLK  119



>ref|XP_004237465.1| PREDICTED: uncharacterized protein At5g64816 [Solanum lycopersicum]
 ref|XP_010319787.1| PREDICTED: uncharacterized protein At5g64816 [Solanum lycopersicum]
 ref|XP_010319788.1| PREDICTED: uncharacterized protein At5g64816 [Solanum lycopersicum]
Length=126

 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLLGAA+PA++AGQA+R+K+   +EQR+K ARGREK++DDIFVCERVCTSKRML
Sbjct  1    MVEVWWSLLGAAIPAIVAGQAYRIKRNHAEEQRIKSARGREKSTDDIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTC+TVCGVSELDAC+DACARTVCVNQHQVPNWND+CL+RCQSECL+
Sbjct  61   KKVGAFSKDPIPDTCITVCGVSELDACSDACARTVCVNQHQVPNWNDVCLRRCQSECLK  119



>ref|XP_002468374.1| hypothetical protein SORBIDRAFT_01g044840 [Sorghum bicolor]
 gb|EER95372.1| hypothetical protein SORBIDRAFT_01g044840 [Sorghum bicolor]
Length=125

 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+ WW LLGAA+PA++AGQ  R+K+RRD+EQRLK ARGREK+SD++FVCERVCTSKRML
Sbjct  1    MVDAWWPLLGAAIPALVAGQFVRIKRRRDEEQRLKAARGREKSSDEVFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+P+TCVTVCGVSELDACADACARTVCVNQHQVPNWND+CLKRCQSECL+
Sbjct  61   KKVGAFSKDPIPETCVTVCGVSELDACADACARTVCVNQHQVPNWNDVCLKRCQSECLK  119



>ref|XP_010484278.1| PREDICTED: uncharacterized protein At5g64816-like [Camelina sativa]
Length=131

 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSL+GAAVPA++AGQA+R+KKRR DE+R+K ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVEVWWSLIGAAVPALVAGQAWRIKKRRGDEERIKSARGREKSSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDAC+DACARTVCVNQHQV NWNDICL+RCQSECL+
Sbjct  61   KKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVANWNDICLRRCQSECLK  119



>gb|EYU23710.1| hypothetical protein MIMGU_mgv1a016312mg [Erythranthe guttata]
Length=126

 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WW+LL AAVP   AGQA R+K +  +EQR+K ARGREKN+D+IFVCERVCTSKRML
Sbjct  1    MVEVWWTLLAAAVPVFAAGQAIRIKAKNAEEQRIKTARGREKNADEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDACADACARTVCVNQHQVPNWND+CL+RCQSECL+
Sbjct  61   KKVGAFSKDPIPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDVCLRRCQSECLK  119



>ref|XP_010462676.1| PREDICTED: uncharacterized protein At5g64816-like [Camelina sativa]
Length=132

 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSL+GAAVPA++AGQA+R+KKRR DE+R+K ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVEVWWSLIGAAVPALVAGQAWRIKKRRGDEERIKSARGREKSSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDAC+DACARTVCVNQHQV NWNDICL+RCQSECL+
Sbjct  61   KKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVANWNDICLRRCQSECLK  119



>ref|NP_001143961.1| uncharacterized protein LOC100276776 [Zea mays]
 gb|ACG25767.1| hypothetical protein [Zea mays]
 gb|ACG36754.1| hypothetical protein [Zea mays]
 gb|ACR37576.1| unknown [Zea mays]
 tpg|DAA43755.1| TPA: hypothetical protein ZEAMMB73_736527 [Zea mays]
Length=125

 Score =   191 bits (484),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+ WW LLGAA+PA++AGQ  R+K+RRD+EQRLK ARGREK+SD++FVCERVCTSKRML
Sbjct  1    MVDAWWPLLGAAIPALVAGQFVRIKRRRDEEQRLKAARGREKSSDEVFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+P+TCVTVCGVSELDACADACARTVCVNQHQVPNWND+CLKRCQSECL+
Sbjct  61   KKVGAFSKDPIPETCVTVCGVSELDACADACARTVCVNQHQVPNWNDVCLKRCQSECLK  119



>gb|KHG12632.1| hypothetical protein F383_18594 [Gossypium arboreum]
Length=125

 Score =   191 bits (484),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLLGAA+PAV+AGQAFRMKKR  ++Q++K ARGREK +DD+FVCERVCTSKRML
Sbjct  1    MVEVWWSLLGAAIPAVIAGQAFRMKKRHAEDQKIKSARGREKTADDVFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+ DTCVTVCGVSELDAC+DACARTVCVNQHQVPNWNDICL+RCQSECLR
Sbjct  61   KKVGAFSKDPIRDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLR  119



>ref|XP_010444434.1| PREDICTED: uncharacterized protein At5g64816 isoform X2 [Camelina 
sativa]
 ref|XP_010444435.1| PREDICTED: uncharacterized protein At5g64816 isoform X2 [Camelina 
sativa]
Length=134

 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSL+GAAVPA++AGQA+R+KKRR DE+R+K ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVEVWWSLIGAAVPALVAGQAWRIKKRRGDEERIKSARGREKSSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDAC+DACARTVCVNQHQV NWNDICL+RCQSECL+
Sbjct  61   KKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVANWNDICLRRCQSECLK  119



>ref|XP_009336364.1| PREDICTED: uncharacterized protein At5g64816 [Pyrus x bretschneideri]
Length=125

 Score =   190 bits (483),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLL A    V     FR+KKRR +EQRL  ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVEVWWSLLAAIPAVVAGQA-FRVKKRRAEEQRLMSARGREKSSDEIFVCERVCTSKRML  59

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PD+CVTVCGVSELDACADACARTVCVNQHQVPNWNDICL+RCQSECL+
Sbjct  60   KKVGAFSKDPIPDSCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLRRCQSECLK  118



>ref|XP_008795149.1| PREDICTED: uncharacterized protein At5g64816-like [Phoenix dactylifera]
 ref|XP_008795150.1| PREDICTED: uncharacterized protein At5g64816-like [Phoenix dactylifera]
 ref|XP_008795151.1| PREDICTED: uncharacterized protein At5g64816-like [Phoenix dactylifera]
 ref|XP_008795152.1| PREDICTED: uncharacterized protein At5g64816-like [Phoenix dactylifera]
Length=126

 Score =   190 bits (483),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+L W LLG A+PA+L GQA R+K+RR +EQRLK  RGREKNSD+IFVCERVCTSKRML
Sbjct  1    MVDLLWPLLGFAIPAILTGQAIRVKRRRSEEQRLKGIRGREKNSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECL+
Sbjct  61   KKVGAFSKDPIPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLK  119



>gb|KJB71272.1| hypothetical protein B456_011G114100 [Gossypium raimondii]
 gb|KJB71273.1| hypothetical protein B456_011G114100 [Gossypium raimondii]
 gb|KJB71274.1| hypothetical protein B456_011G114100 [Gossypium raimondii]
Length=125

 Score =   190 bits (483),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLLGAA+PAV+AGQAFRMKKR  ++Q++K ARGREK +DD+FVCERVCTSKRML
Sbjct  1    MVEVWWSLLGAAIPAVIAGQAFRMKKRHAEDQKVKSARGREKTADDVFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+ DTCVTVCGVSELDAC+DACARTVCVNQHQVPNWNDICL+RCQSECLR
Sbjct  61   KKVGAFSKDPIRDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLR  119



>ref|XP_006281261.1| hypothetical protein CARUB_v10027305mg, partial [Capsella rubella]
 gb|EOA14159.1| hypothetical protein CARUB_v10027305mg, partial [Capsella rubella]
Length=151

 Score =   191 bits (485),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSL+GAAVPA++AGQA+R+KKRR +E+R+K ARGREK+SD+IFVCERVCTSKRML
Sbjct  25   MVEVWWSLIGAAVPALVAGQAWRIKKRRGEEERIKSARGREKSSDEIFVCERVCTSKRML  84

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDAC+DACARTVCVNQHQV NWNDICL+RCQSECL+
Sbjct  85   KKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVANWNDICLRRCQSECLK  143



>gb|ACG40459.1| hypothetical protein [Zea mays]
 gb|AFW89436.1| hypothetical protein ZEAMMB73_836678 [Zea mays]
Length=125

 Score =   190 bits (483),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+ WWSLLGAA PA++AGQ  R K+RRD+EQRLK ARGREK+SD++FVCERVCTSKRML
Sbjct  1    MVDAWWSLLGAAFPALVAGQFIRTKRRRDEEQRLKAARGREKSSDEVFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
             KVGAFSKDP+P+TCVTVCGVSELDACADACARTVCVNQHQVPNWND+CLKRCQSECL+
Sbjct  61   NKVGAFSKDPIPETCVTVCGVSELDACADACARTVCVNQHQVPNWNDVCLKRCQSECLK  119



>ref|XP_009779352.1| PREDICTED: uncharacterized protein At5g64816-like [Nicotiana 
sylvestris]
Length=126

 Score =   190 bits (483),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLLGAA+PA++AGQA+R+++   +EQR+K ARGREK++DDIFVCERVCTSKRML
Sbjct  1    MVEVWWSLLGAAIPAIVAGQAYRIRRNHAEEQRIKSARGREKSTDDIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDAC+DACARTVCVNQHQVPNWND+CL+RCQSECL+
Sbjct  61   KKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDVCLRRCQSECLK  119



>ref|XP_009626114.1| PREDICTED: uncharacterized protein At5g64816 [Nicotiana tomentosiformis]
 ref|XP_009626115.1| PREDICTED: uncharacterized protein At5g64816 [Nicotiana tomentosiformis]
Length=126

 Score =   190 bits (483),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLLGAA+PA++AGQA+R+++   +EQR+K ARGREK++DDIFVCERVCTSKRML
Sbjct  1    MVEVWWSLLGAAIPAIVAGQAYRIRRNHAEEQRIKSARGREKSTDDIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDAC+DACARTVCVNQHQVPNWND+CL+RCQSECL+
Sbjct  61   KKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDVCLRRCQSECLK  119



>gb|KHN42620.1| Hypothetical protein glysoja_018863 [Glycine soja]
Length=127

 Score =   190 bits (483),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            M E+WWSLLGAA+P V+AGQAFR+KKRR +EQRL+ ARGRE++SD+IFVCERVCTSKRML
Sbjct  1    MGEIWWSLLGAAIPVVVAGQAFRVKKRRAEEQRLQSARGRERSSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVG+FSKDP+PDTCVTVCGVS+LDACADACARTVC+NQHQVPNWNDICL+RCQSECL+
Sbjct  61   KKVGSFSKDPIPDTCVTVCGVSDLDACADACARTVCINQHQVPNWNDICLRRCQSECLK  119



>ref|XP_010108559.1| hypothetical protein L484_008327 [Morus notabilis]
 gb|EXC19702.1| hypothetical protein L484_008327 [Morus notabilis]
Length=125

 Score =   190 bits (482),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 105/119 (88%), Gaps = 1/119 (1%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLL A    V     FRMKK+  +EQRL+ ARGREK +D+IFVCERVCTSKRML
Sbjct  1    MVEVWWSLLAAIPAVVAGQA-FRMKKKHAEEQRLQSARGREKTADEIFVCERVCTSKRML  59

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            K+VGAFSKDP+PDTCVTVCG+SELDACADACARTVCVNQHQVPNWNDICL+RCQSECL+
Sbjct  60   KRVGAFSKDPIPDTCVTVCGISELDACADACARTVCVNQHQVPNWNDICLRRCQSECLK  118



>ref|XP_010272500.1| PREDICTED: uncharacterized protein At5g64816 isoform X3 [Nelumbo 
nucifera]
Length=125

 Score =   190 bits (482),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+LW +LLGAA+PAV+AGQA RM+KRR +EQRLK ARGREK+SDDIFVCERVCTSKRML
Sbjct  1    MVDLWVTLLGAAIPAVVAGQALRMRKRRAEEQRLKSARGREKSSDDIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP PDTCVTVCGVS LDAC DACARTVCVNQHQVPNWNDICL+RCQSECL+
Sbjct  61   KKVGAFSKDPTPDTCVTVCGVSALDACTDACARTVCVNQHQVPNWNDICLRRCQSECLK  119



>ref|NP_001237023.1| uncharacterized protein LOC100305811 precursor [Glycine max]
 gb|ACU13682.1| unknown [Glycine max]
 gb|KHN01035.1| Hypothetical protein glysoja_000703 [Glycine soja]
Length=127

 Score =   190 bits (482),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            M E+WWSLLG+A+P V+AGQAFR+KKRR +EQRL+  RGRE+NSD+IFVCERVCTSKRML
Sbjct  1    MGEIWWSLLGSAIPVVVAGQAFRLKKRRAEEQRLQSGRGRERNSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KK+G+FSKDP+PDTCVTVCGVS++DACADACARTVC+NQHQVPNWNDICL+RCQSECL+
Sbjct  61   KKLGSFSKDPIPDTCVTVCGVSDVDACADACARTVCINQHQVPNWNDICLRRCQSECLK  119



>ref|XP_003517376.2| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At5g64816-like 
[Glycine max]
Length=133

 Score =   190 bits (483),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            M E+WWSLLGAA+P V+AGQAFR+KKRR +EQRL+ ARGRE++SD+IFVCERVCTSKRML
Sbjct  1    MGEIWWSLLGAAIPVVVAGQAFRVKKRRAEEQRLQSARGRERSSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVG+FSKDP+PDTCVTVCGVS+LDACADACARTVC+NQHQVPNWNDICL+RCQSECL+
Sbjct  61   KKVGSFSKDPIPDTCVTVCGVSDLDACADACARTVCINQHQVPNWNDICLRRCQSECLK  119



>ref|XP_007212235.1| hypothetical protein PRUPE_ppa013390mg [Prunus persica]
 ref|XP_008226452.1| PREDICTED: uncharacterized protein At5g64816 [Prunus mume]
 gb|EMJ13434.1| hypothetical protein PRUPE_ppa013390mg [Prunus persica]
Length=125

 Score =   190 bits (482),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLL A    V      R+KKRR +E+R+K ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVEVWWSLLAAIPAVVAGQA-IRVKKRRAEEERIKSARGREKSSDEIFVCERVCTSKRML  59

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICL+RCQSECL+
Sbjct  60   KKVGAFSKDPIPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLRRCQSECLK  118



>ref|XP_008353764.1| PREDICTED: uncharacterized protein At5g64816 [Malus domestica]
Length=124

 Score =   189 bits (481),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 105/119 (88%), Gaps = 1/119 (1%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLL A    V     FR+KKR  +EQRL  ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVEVWWSLLAAIPAVVAGQA-FRVKKRXAEEQRLMSARGREKSSDEIFVCERVCTSKRML  59

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PD+CVTVCGVSELDACADACARTVCVNQHQVPNWNDICL+RCQSECL+
Sbjct  60   KKVGAFSKDPIPDSCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLRRCQSECLK  118



>ref|XP_008440134.1| PREDICTED: uncharacterized protein At5g64816 [Cucumis melo]
 ref|XP_008440135.1| PREDICTED: uncharacterized protein At5g64816 [Cucumis melo]
Length=126

 Score =   189 bits (481),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLLGAA+PAV+AGQ +RMK+R  +EQR+K A GREKN DDIFVCERVCTSKRML
Sbjct  1    MVEVWWSLLGAAIPAVVAGQVYRMKRRHSEEQRIKIAWGREKNPDDIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVG+FSKDP+PDTCVTVCG+SELDAC DACARTVCVNQHQVPNWND+CL+RCQSECL+
Sbjct  61   KKVGSFSKDPIPDTCVTVCGLSELDACTDACARTVCVNQHQVPNWNDVCLRRCQSECLK  119



>ref|XP_009150562.1| PREDICTED: uncharacterized protein At5g64816 [Brassica rapa]
 ref|XP_009150563.1| PREDICTED: uncharacterized protein At5g64816 [Brassica rapa]
 emb|CDY14514.1| BnaC03g49450D [Brassica napus]
Length=128

 Score =   189 bits (479),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WW LL AAVPA++ GQA R+KKRR +E+R+K ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVEVWWPLLAAAVPALIGGQALRIKKRRGEEERIKSARGREKSSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDAC+DACARTVCVNQHQV NWNDICL+RCQSECL+
Sbjct  61   KKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVANWNDICLRRCQSECLK  119



>emb|CDY08847.1| BnaA06g23770D [Brassica napus]
Length=129

 Score =   189 bits (479),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WW LL AAVPA++ GQA R+KKRR +E+R+K ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVEVWWPLLAAAVPALIGGQALRIKKRRGEEERIKSARGREKSSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDAC+DACARTVCVNQHQV NWNDICL+RCQSECL+
Sbjct  61   KKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVANWNDICLRRCQSECLK  119



>ref|XP_009406604.1| PREDICTED: uncharacterized protein At5g64816-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406605.1| PREDICTED: uncharacterized protein At5g64816-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406606.1| PREDICTED: uncharacterized protein At5g64816-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406607.1| PREDICTED: uncharacterized protein At5g64816-like [Musa acuminata 
subsp. malaccensis]
Length=125

 Score =   188 bits (478),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            M ++WWSLLGAAVPA++A    R+K+RR +EQRLK ARGREK+SD+IFVC RVCTSKRML
Sbjct  1    MEDIWWSLLGAAVPAIIAAHTIRVKRRRAEEQRLKSARGREKHSDEIFVCMRVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+ DTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR
Sbjct  61   KKVGAFSKDPILDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  119



>ref|NP_568997.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974994.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8L8Q8.1|Y5486_ARATH RecName: Full=Uncharacterized protein At5g64816; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM67176.1| unknown [Arabidopsis thaliana]
 dbj|BAD94919.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABF59017.1| At5g64816 [Arabidopsis thaliana]
 dbj|BAH20033.1| AT5G64816 [Arabidopsis thaliana]
 gb|AED97955.1| uncharacterized protein AT5G64816 [Arabidopsis thaliana]
 gb|AED97956.1| uncharacterized protein AT5G64816 [Arabidopsis thaliana]
Length=130

 Score =   188 bits (478),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSL+GAAVPA++AGQA+R+KKR  +E+R+K ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVEVWWSLIGAAVPALIAGQAWRIKKRHGEEERIKSARGREKSSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDAC+DACARTVCVNQHQV NWNDICL+RCQSECL+
Sbjct  61   KKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVANWNDICLRRCQSECLK  119



>ref|NP_001144395.1| uncharacterized protein LOC100277328 [Zea mays]
 gb|ACG40232.1| hypothetical protein [Zea mays]
Length=125

 Score =   188 bits (478),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+ WW LLGAA PA++AGQ  R K+RRD+EQRLK ARGREK+SD++FVCERVCTSKRML
Sbjct  1    MVDAWWPLLGAAFPALVAGQFIRTKRRRDEEQRLKAARGREKSSDEVFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
             KVGAFSKDP+P+TCVTVCGVSELDACADACARTVCVNQHQVPNWND+CLKRCQSECL+
Sbjct  61   NKVGAFSKDPIPETCVTVCGVSELDACADACARTVCVNQHQVPNWNDVCLKRCQSECLK  119



>ref|XP_002864925.1| hypothetical protein ARALYDRAFT_919807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41184.1| hypothetical protein ARALYDRAFT_919807 [Arabidopsis lyrata subsp. 
lyrata]
Length=128

 Score =   188 bits (477),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSL+GAAVPA++AGQA+R+KKR  +E+R+K ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVEVWWSLIGAAVPALIAGQAWRIKKRHGEEERIKSARGREKSSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDAC+DACARTVCVNQHQV NWNDICL+RCQSECL+
Sbjct  61   KKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVANWNDICLRRCQSECLK  119



>ref|XP_010061522.1| PREDICTED: uncharacterized protein At5g64816 [Eucalyptus grandis]
 ref|XP_010061523.1| PREDICTED: uncharacterized protein At5g64816 [Eucalyptus grandis]
 ref|XP_010061524.1| PREDICTED: uncharacterized protein At5g64816 [Eucalyptus grandis]
 ref|XP_010061525.1| PREDICTED: uncharacterized protein At5g64816 [Eucalyptus grandis]
 ref|XP_010061526.1| PREDICTED: uncharacterized protein At5g64816 [Eucalyptus grandis]
 gb|KCW68489.1| hypothetical protein EUGRSUZ_F02140 [Eucalyptus grandis]
 gb|KCW68490.1| hypothetical protein EUGRSUZ_F02140 [Eucalyptus grandis]
 gb|KCW68491.1| hypothetical protein EUGRSUZ_F02140 [Eucalyptus grandis]
 gb|KCW68492.1| hypothetical protein EUGRSUZ_F02140 [Eucalyptus grandis]
Length=127

 Score =   188 bits (477),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WW LLGA +PA++ GQA+R++KRR +EQRLK  RGREK+S++IFVCERVCTSKRML
Sbjct  1    MVEVWWPLLGAVIPAIVGGQAWRIRKRRAEEQRLKSVRGREKSSEEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVG+FSKDP PDTCVTVCGVS+LDACADACARTVCVNQHQVPNWNDICL+RCQSECLR
Sbjct  61   KKVGSFSKDPTPDTCVTVCGVSQLDACADACARTVCVNQHQVPNWNDICLRRCQSECLR  119



>ref|XP_002262994.1| PREDICTED: uncharacterized protein At5g64816 [Vitis vinifera]
 ref|XP_010648859.1| PREDICTED: uncharacterized protein At5g64816 [Vitis vinifera]
Length=126

 Score =   187 bits (476),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLLGAA+PA++AGQA RMK+R  +EQR+K ARGREK SD+IFVCERVCTSKRML
Sbjct  1    MVEVWWSLLGAAIPAIVAGQALRMKRRHAEEQRIKSARGREKTSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVG FSKDP  DTCVTVCGVSELDAC+DACARTVCVNQHQVPNWNDICL+RCQSECL+
Sbjct  61   KKVGTFSKDPSHDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLK  119



>ref|XP_004495297.1| PREDICTED: uncharacterized protein At5g64816-like isoform X1 
[Cicer arietinum]
 ref|XP_004495298.1| PREDICTED: uncharacterized protein At5g64816-like isoform X2 
[Cicer arietinum]
 ref|XP_004495299.1| PREDICTED: uncharacterized protein At5g64816-like isoform X3 
[Cicer arietinum]
Length=125

 Score =   187 bits (475),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            M E+WWSLLGAA+P V+AGQAFR+KK+  +EQ+LK ARGRE++SD+IFVCERVCTSKRML
Sbjct  1    MGEIWWSLLGAAIPVVVAGQAFRLKKKHAEEQKLKSARGRERSSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVG+FSKDP+PDTCVTVCGVS++DACADACARTVCVNQHQVPNWNDICL+RCQ+ECL+
Sbjct  61   KKVGSFSKDPIPDTCVTVCGVSDVDACADACARTVCVNQHQVPNWNDICLRRCQAECLK  119



>ref|XP_009340410.1| PREDICTED: uncharacterized protein At5g64816-like [Pyrus x bretschneideri]
Length=125

 Score =   187 bits (475),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 104/119 (87%), Gaps = 1/119 (1%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWS L A    V     FR+KKRR +E+RLK AR REK+SD+IFVCERVCTSKRML
Sbjct  1    MVEVWWSFLAAIPAVVAGQA-FRVKKRRGEERRLKSARRREKSSDEIFVCERVCTSKRML  59

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDACAD CARTVCVNQHQVPNWNDICL+RCQSECL+
Sbjct  60   KKVGAFSKDPIPDTCVTVCGVSELDACADTCARTVCVNQHQVPNWNDICLRRCQSECLK  118



>ref|XP_002527373.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35045.1| conserved hypothetical protein [Ricinus communis]
Length=127

 Score =   187 bits (474),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+ WWSLLGAA+PAV+AGQA RMKK+R +EQRLK ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVDPWWSLLGAAIPAVIAGQAIRMKKKRAEEQRLKSARGREKSSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGA SKDP  DTCVTVCGVSELDAC DACARTVCVNQHQVPNWND+CL+RCQSECLR
Sbjct  61   KKVGALSKDPTIDTCVTVCGVSELDACTDACARTVCVNQHQVPNWNDVCLRRCQSECLR  119



>ref|XP_006433833.1| hypothetical protein CICLE_v10002841mg [Citrus clementina]
 ref|XP_006472473.1| PREDICTED: uncharacterized protein At5g64816-like isoform X1 
[Citrus sinensis]
 ref|XP_006472474.1| PREDICTED: uncharacterized protein At5g64816-like isoform X2 
[Citrus sinensis]
 ref|XP_006472475.1| PREDICTED: uncharacterized protein At5g64816-like isoform X3 
[Citrus sinensis]
 ref|XP_006472476.1| PREDICTED: uncharacterized protein At5g64816-like isoform X4 
[Citrus sinensis]
 gb|ESR47073.1| hypothetical protein CICLE_v10002841mg [Citrus clementina]
 gb|KDO81164.1| hypothetical protein CISIN_1g033089mg [Citrus sinensis]
Length=127

 Score =   186 bits (473),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+ WWSLLGAA+PAV+ GQA RMKKRR +EQRLK ARGREK+SDDIFVCERVCTSKRML
Sbjct  1    MVDPWWSLLGAAIPAVIMGQALRMKKRRAEEQRLKSARGREKSSDDIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVG+ SK+P  DTCVTVCGVS++DACADACARTVCVNQHQVPNWNDICL++CQSECLR
Sbjct  61   KKVGSLSKEPTIDTCVTVCGVSQIDACADACARTVCVNQHQVPNWNDICLRKCQSECLR  119



>ref|NP_001235178.1| uncharacterized protein LOC100499983 precursor [Glycine max]
 gb|ACU14499.1| unknown [Glycine max]
Length=131

 Score =   186 bits (473),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            M E+WWSLLGAA+P V+AGQAFR+KKRR +EQRL+ ARGRE++SD+IFVCERVCTSKRML
Sbjct  1    MGEIWWSLLGAAIPVVVAGQAFRVKKRRAEEQRLQSARGRERSSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSEC  150
            KKVG+FSKDP+PDTCVTVCG S+LDACADACARTVCVNQHQVPNWNDICL+RCQSEC
Sbjct  61   KKVGSFSKDPIPDTCVTVCGASDLDACADACARTVCVNQHQVPNWNDICLRRCQSEC  117



>ref|XP_011460768.1| PREDICTED: uncharacterized protein At5g64816-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=125

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 105/119 (88%), Gaps = 1/119 (1%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLL A   AV     F +K R D++Q+LK ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVEVWWSLLAAIPAAVAGYA-FGVKTRCDEQQKLKSARGREKSSDEIFVCERVCTSKRML  59

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDACADACARTVCVNQHQVPNWND CL+RCQSECL+
Sbjct  60   KKVGAFSKDPIPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDTCLQRCQSECLK  118



>gb|KEH42678.1| Thionin-like protein [Medicago truncatula]
Length=126

 Score =   186 bits (471),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            M ++WWSLLGAAVP V+AGQAFR+KKR  +EQRLK ARGRE++SD+IFVCERVCTSKRML
Sbjct  1    MGDIWWSLLGAAVPVVVAGQAFRVKKRNAEEQRLKSARGRERSSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVG+FSKDP+PDTCVTVCGVS+LDACA+ACARTVCVNQHQVPNWND CL+RCQSECL+
Sbjct  61   KKVGSFSKDPIPDTCVTVCGVSDLDACAEACARTVCVNQHQVPNWNDTCLRRCQSECLK  119



>ref|XP_006394107.1| hypothetical protein EUTSA_v10005124mg [Eutrema salsugineum]
 ref|XP_006394108.1| hypothetical protein EUTSA_v10005124mg [Eutrema salsugineum]
 gb|ESQ31393.1| hypothetical protein EUTSA_v10005124mg [Eutrema salsugineum]
 gb|ESQ31394.1| hypothetical protein EUTSA_v10005124mg [Eutrema salsugineum]
Length=127

 Score =   186 bits (471),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE WW LL AAVPA++AGQA R+KKR  +E+R+K ARGREK+SD+IFVCERVC SKRML
Sbjct  1    MVEAWWPLLAAAVPALIAGQALRIKKRHGEEERIKSARGREKSSDEIFVCERVCVSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDAC+DACARTVCVNQHQV NWNDICL+RCQSECL+
Sbjct  61   KKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVANWNDICLRRCQSECLK  119



>ref|XP_008803701.1| PREDICTED: uncharacterized protein At5g64816-like [Phoenix dactylifera]
Length=126

 Score =   185 bits (469),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV++WWSL GAA+PAV+ GQA R+K+RR +EQRLK AR REKNSDDIFVCERVCTSKRML
Sbjct  1    MVDIWWSLFGAAIPAVVFGQAIRVKRRRAEEQRLKSARRREKNSDDIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
             KVGAFSKDP PD CVTVCGVSELDACADACA+TVCV+QHQVPNWNDICLK+CQSECL+
Sbjct  61   NKVGAFSKDPTPDACVTVCGVSELDACADACAQTVCVHQHQVPNWNDICLKQCQSECLK  119



>ref|XP_011013229.1| PREDICTED: uncharacterized protein At5g64816-like [Populus euphratica]
Length=127

 Score =   185 bits (469),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+ WWSLLGAA+PA++AGQA RMKKRR DEQ LK ARGREK+ D+IFVCERVCTSKRML
Sbjct  1    MVDPWWSLLGAAIPAIIAGQALRMKKRRADEQSLKSARGREKSPDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGA  KDP  DTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICL+RCQSECLR
Sbjct  61   KKVGALCKDPTIDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLRRCQSECLR  119



>ref|XP_009403333.1| PREDICTED: uncharacterized protein At5g64816-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403334.1| PREDICTED: uncharacterized protein At5g64816-like [Musa acuminata 
subsp. malaccensis]
Length=131

 Score =   185 bits (469),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV++WWSLLGAAVP ++AG   R+K R  +EQRL+ A+GREKNSD+IFVCERVCTSKRML
Sbjct  1    MVDMWWSLLGAAVPVIIAGHRIRVKGRHAEEQRLRSAQGREKNSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
             KVGAFSKDP+ DTCVTVCGVSELDAC DACARTVCVNQHQVPNWNDICLKRCQSECLR
Sbjct  61   NKVGAFSKDPILDTCVTVCGVSELDACTDACARTVCVNQHQVPNWNDICLKRCQSECLR  119



>ref|XP_010254506.1| PREDICTED: uncharacterized protein At5g64816-like [Nelumbo nucifera]
Length=131

 Score =   183 bits (465),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+LW +LLGAA+PAV+AGQA RMKKRR +EQRL   RGREK+SDDIFVCERVC SKRML
Sbjct  1    MVDLWVTLLGAAIPAVVAGQALRMKKRRSEEQRLNGTRGREKSSDDIFVCERVCMSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP PDTCVTVCG+S LDAC DACARTVCVNQHQVPNWNDICL+RCQSECL+
Sbjct  61   KKVGAFSKDPTPDTCVTVCGLSALDACTDACARTVCVNQHQVPNWNDICLRRCQSECLK  119



>gb|KDP35262.1| hypothetical protein JCGZ_09421 [Jatropha curcas]
Length=125

 Score =   182 bits (461),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 106/120 (88%), Gaps = 1/120 (1%)
 Frame = -3

Query  500  MVELWWSllgaav-pavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRM  324
            MVE+WWSLLGAAV   +       MKK+R +EQR+K  RGREK+SDD+FVCERVCTSKRM
Sbjct  1    MVEVWWSLLGAAVPAVIAGQAIIVMKKKRAEEQRMKSIRGREKSSDDVFVCERVCTSKRM  60

Query  323  LKKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            LKKVGAFSKDP+PD C+TVCGVSELDAC+DACARTVCVNQHQVP+WNDICL+RCQSECL+
Sbjct  61   LKKVGAFSKDPIPDNCLTVCGVSELDACSDACARTVCVNQHQVPDWNDICLRRCQSECLK  120



>gb|KDP41477.1| hypothetical protein JCGZ_15884 [Jatropha curcas]
Length=128

 Score =   182 bits (462),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+ WW +LGAA+PAV+ GQA R KK+R +E+RLK ARGREKNSD+IFVCE+VCTSKRML
Sbjct  1    MVDPWWIVLGAAIPAVITGQAIRKKKKRAEEERLKSARGREKNSDEIFVCEKVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECL  147
            KKVGAFSKDP+ DTCVTVCGVSE+DACADACARTVCVNQHQVPNWND+CL+RCQSECL
Sbjct  61   KKVGAFSKDPIIDTCVTVCGVSEIDACADACARTVCVNQHQVPNWNDVCLRRCQSECL  118



>ref|XP_010272499.1| PREDICTED: uncharacterized protein At5g64816 isoform X2 [Nelumbo 
nucifera]
Length=129

 Score =   182 bits (462),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+LW +LLGAA+PAV+AGQA RM+KRR +EQRLK ARGREK+SDDIFVCERVCTSKRML
Sbjct  1    MVDLWVTLLGAAIPAVVAGQALRMRKRRAEEQRLKSARGREKSSDDIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSE  153
            KKVGAFSKDP PDTCVTVCGVS LDAC DACARTVCVNQHQVPNWNDICL+RCQ+ 
Sbjct  61   KKVGAFSKDPTPDTCVTVCGVSALDACTDACARTVCVNQHQVPNWNDICLRRCQTS  116



>ref|XP_010272498.1| PREDICTED: uncharacterized protein At5g64816 isoform X1 [Nelumbo 
nucifera]
Length=130

 Score =   181 bits (459),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+LW +LLGAA+PAV+AGQA RM+KRR +EQRLK ARGREK+SDDIFVCERVCTSKRML
Sbjct  1    MVDLWVTLLGAAIPAVVAGQALRMRKRRAEEQRLKSARGREKSSDDIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQ  159
            KKVGAFSKDP PDTCVTVCGVS LDAC DACARTVCVNQHQVPNWNDICL+RCQ
Sbjct  61   KKVGAFSKDPTPDTCVTVCGVSALDACTDACARTVCVNQHQVPNWNDICLRRCQ  114



>emb|CBI19260.3| unnamed protein product [Vitis vinifera]
Length=184

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -3

Query  506  AVMVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKR  327
            +VMV++WWSLLGAA+PAV+AGQA RMK+RR +EQ L  + GREK SDD FVCERVCTSKR
Sbjct  54   SVMVDIWWSLLGAAIPAVVAGQALRMKRRRAEEQSLTSSGGREKRSDDNFVCERVCTSKR  113

Query  326  MLKKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECL  147
            MLKKV A SKDP PDTCVTVCGVSE+DAC DACARTVCVNQHQVPNWNDICL+RCQSECL
Sbjct  114  MLKKVSALSKDPTPDTCVTVCGVSEIDACTDACARTVCVNQHQVPNWNDICLRRCQSECL  173

Query  146  R  144
            +
Sbjct  174  K  174



>ref|XP_010272501.1| PREDICTED: uncharacterized protein At5g64816 isoform X4 [Nelumbo 
nucifera]
Length=122

 Score =   180 bits (457),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+LW +LLGAA+PAV+AGQA RM+KRR +EQRLK ARGREK+SDDIFVCERVCTSKRML
Sbjct  1    MVDLWVTLLGAAIPAVVAGQALRMRKRRAEEQRLKSARGREKSSDDIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQ  159
            KKVGAFSKDP PDTCVTVCGVS LDAC DACARTVCVNQHQVPNWNDICL+RCQ
Sbjct  61   KKVGAFSKDPTPDTCVTVCGVSALDACTDACARTVCVNQHQVPNWNDICLRRCQ  114



>dbj|BAA97293.1| unnamed protein product [Arabidopsis thaliana]
Length=651

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSL+GAAVPA++AGQA+R+KKR  +E+R+K ARGREK+SD+IFVCERVCTSKRML
Sbjct  522  MVEVWWSLIGAAVPALIAGQAWRIKKRHGEEERIKSARGREKSSDEIFVCERVCTSKRML  581

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDAC+DACARTVCVNQHQV NWNDICL+RCQSECL+
Sbjct  582  KKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVANWNDICLRRCQSECLK  640



>ref|XP_002283868.1| PREDICTED: uncharacterized protein At5g64816 [Vitis vinifera]
 ref|XP_010664402.1| PREDICTED: uncharacterized protein At5g64816 [Vitis vinifera]
 emb|CAN74019.1| hypothetical protein VITISV_003556 [Vitis vinifera]
Length=129

 Score =   179 bits (455),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV++WWSLLGAA+PAV+AGQA RMK+RR +EQ L  + GREK SDD FVCERVCTSKRML
Sbjct  1    MVDIWWSLLGAAIPAVVAGQALRMKRRRAEEQSLTSSGGREKRSDDNFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKV A SKDP PDTCVTVCGVSE+DAC DACARTVCVNQHQVPNWNDICL+RCQSECL+
Sbjct  61   KKVSALSKDPTPDTCVTVCGVSEIDACTDACARTVCVNQHQVPNWNDICLRRCQSECLK  119



>ref|XP_011460769.1| PREDICTED: uncharacterized protein At5g64816-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=118

 Score =   179 bits (454),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 103/119 (87%), Gaps = 1/119 (1%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLL A   AV     F +K R D++Q+LK ARGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVEVWWSLLAAIPAAVAGYA-FGVKTRCDEQQKLKSARGREKSSDEIFVCERVCTSKRML  59

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDACADACARTVCVNQHQVPNWND CL+RCQ+ C R
Sbjct  60   KKVGAFSKDPIPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDTCLQRCQNLCSR  118



>ref|XP_010547633.1| PREDICTED: uncharacterized protein At5g64816-like [Tarenaya hassleriana]
Length=128

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+WWSLLGAAVPA++AGQA R K+RR  EQR+   RGREK+SD+IFVCERVC SKRML
Sbjct  1    MVEVWWSLLGAAVPAIIAGQAIRTKRRRAAEQRINSVRGREKSSDEIFVCERVCISKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSEC  150
            KKVGAFSKDP+PDTCVTVCGVSELDAC+DACARTVCVN HQV NWNDICL+RCQSEC
Sbjct  61   KKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNHHQVANWNDICLRRCQSEC  117



>gb|KDP38898.1| hypothetical protein JCGZ_05055 [Jatropha curcas]
Length=127

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+ WWS+LGAA+PA++A QA R+KK+R +EQRLK  RGREK+SD+IFVCERVCTSKRML
Sbjct  1    MVDPWWSVLGAAIPAIIAAQALRIKKKRGEEQRLKSVRGREKSSDEIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGA SKDP  D+CVTVCG SELDAC DACARTVCVNQHQVPNWND+CL+RCQSECLR
Sbjct  61   KKVGALSKDPTVDSCVTVCGASELDACVDACARTVCVNQHQVPNWNDVCLRRCQSECLR  119



>gb|EPS70584.1| hypothetical protein M569_04178, partial [Genlisea aurea]
Length=125

 Score =   176 bits (447),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE W ++LGAA+P ++AGQAFR++ R  +EQR+K AR +EK+SDDIFVCERVCTSKRML
Sbjct  1    MVEAWLTVLGAAIPVIVAGQAFRIRARYTEEQRIKAARSKEKSSDDIFVCERVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVG+FSKDP+ DTCVTVCGVSELDAC+DACARTVCVNQH VPNWN++CL+RCQSECL+
Sbjct  61   KKVGSFSKDPIADTCVTVCGVSELDACSDACARTVCVNQHPVPNWNEVCLRRCQSECLK  119



>ref|XP_009394932.1| PREDICTED: uncharacterized protein At5g64816-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394933.1| PREDICTED: uncharacterized protein At5g64816-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394934.1| PREDICTED: uncharacterized protein At5g64816-like [Musa acuminata 
subsp. malaccensis]
Length=126

 Score =   169 bits (427),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV++WWSLLGAAVPA++ GQA R K++  +EQR K A+G E+NSD+IFVC+RVCTSKRML
Sbjct  1    MVDIWWSLLGAAVPALVVGQAIRAKRKNGEEQRFKSAQGHERNSDEIFVCDRVCTSKRML  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGA S++P  DTC +VCGVSELDACADACAR+VCV QHQVPNWND+CLKRCQ+ECLR
Sbjct  61   KKVGALSENPPQDTCASVCGVSELDACADACARSVCVIQHQVPNWNDVCLKRCQTECLR  119



>gb|KJB40418.1| hypothetical protein B456_007G062500 [Gossypium raimondii]
Length=115

 Score =   164 bits (415),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 102/119 (86%), Gaps = 11/119 (9%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            M ++WW+LLG A+PAV+AGQ FR++K+  +EQRLK ARGRE           VCTSKRML
Sbjct  1    MADVWWTLLGTAIPAVIAGQVFRLRKKHAEEQRLKSARGRE-----------VCTSKRML  49

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            KKVGAFSKDP+PDTCVTVCGVSELDAC+DACARTVCVNQHQVPNWNDICL+RCQSECLR
Sbjct  50   KKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLR  108



>ref|XP_006833174.1| hypothetical protein AMTR_s00072p00147740 [Amborella trichopoda]
 gb|ERM98452.1| hypothetical protein AMTR_s00072p00147740 [Amborella trichopoda]
Length=128

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 107/125 (86%), Gaps = 6/125 (5%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFR-MKKRRDDEQRLK-----RARGREKNSDDIFVCERVC  339
            MVE WWS++ AA+PAV+AGQA R + K++ +E R+K        GREK+S+++F CERVC
Sbjct  1    MVEWWWSVVAAAIPAVVAGQAVRRVGKKKAEELRIKAVASGSGVGREKSSEEVFFCERVC  60

Query  338  TSKRMLKKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQ  159
            TSKRMLK+VGAFSKDP PDTCVTVCGVSELDACA+ACARTVCVNQH VPNWNDICL+RCQ
Sbjct  61   TSKRMLKRVGAFSKDPTPDTCVTVCGVSELDACAEACARTVCVNQHHVPNWNDICLRRCQ  120

Query  158  SECLR  144
            SECL+
Sbjct  121  SECLK  125



>gb|EYU41415.1| hypothetical protein MIMGU_mgv1a016144mg [Erythranthe guttata]
Length=133

 Score =   158 bits (399),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 86/101 (85%), Gaps = 5/101 (5%)
 Frame = -3

Query  431  MKKRRDDEQRLKR-----ARGREKNSDDIFVCERVCTSKRMLKKVGAFSKDPMPDTCVTV  267
             + R  DEQR+K+        RE N+ DIFVCERVCTSKRMLKKVGAFSKDP+ DTCVTV
Sbjct  25   FRNRGADEQRVKKNPLGGGGQRENNTGDIFVCERVCTSKRMLKKVGAFSKDPIKDTCVTV  84

Query  266  CGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            CGVSELDACADACARTVCV+QHQVPNWND+CL+RCQSECL+
Sbjct  85   CGVSELDACADACARTVCVDQHQVPNWNDVCLRRCQSECLK  125



>gb|ABK23825.1| unknown [Picea sitchensis]
Length=124

 Score =   151 bits (381),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 97/119 (82%), Gaps = 2/119 (2%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MV+ WW+++GAA+PAV   Q  +  +R+ +E+ LK     EK+ +DIFVCERVCTSKRML
Sbjct  1    MVDWWWTVIGAAIPAVAVQQVVKATRRKSEEEPLKAEP--EKSPNDIFVCERVCTSKRML  58

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
             KVG FSKD  P+TCVTVCGVSELDAC DACARTVCVNQH +PNWNDICL+RCQ++CLR
Sbjct  59   NKVGDFSKDSTPNTCVTVCGVSELDACTDACARTVCVNQHHLPNWNDICLRRCQNQCLR  117



>ref|XP_008356963.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At5g64816-like 
[Malus domestica]
Length=120

 Score =   148 bits (373),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 90/117 (77%), Gaps = 6/117 (5%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            MVE+W SLL A    V     F +KKRR +E+RL  ARGRE+  D+ FVCERVCTSKRML
Sbjct  1    MVEVWXSLLAAIPVVVAGQA-FXVKKRRAEEERLMSARGREEXLDEFFVCERVCTSKRML  59

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSEC  150
            KKVGAFSK P+PD+CVTVCGVS      DACAR VCVNQHQVPNWNDICL RCQ+EC
Sbjct  60   KKVGAFSKXPIPDSCVTVCGVS-----XDACARIVCVNQHQVPNWNDICLWRCQNEC  111



>gb|AFG43932.1| hypothetical protein 0_7150_01, partial [Pinus taeda]
 gb|AFG43933.1| hypothetical protein 0_7150_01, partial [Pinus taeda]
 gb|AFG43934.1| hypothetical protein 0_7150_01, partial [Pinus taeda]
 gb|AFG43935.1| hypothetical protein 0_7150_01, partial [Pinus taeda]
 gb|AFG43936.1| hypothetical protein 0_7150_01, partial [Pinus taeda]
 gb|AFG43937.1| hypothetical protein 0_7150_01, partial [Pinus taeda]
 gb|AFG43938.1| hypothetical protein 0_7150_01, partial [Pinus taeda]
 gb|AFG43939.1| hypothetical protein 0_7150_01, partial [Pinus taeda]
 gb|AFG43940.1| hypothetical protein 0_7150_01, partial [Pinus taeda]
 gb|AFG43941.1| hypothetical protein 0_7150_01, partial [Pinus taeda]
 gb|AFG43942.1| hypothetical protein 0_7150_01, partial [Pinus taeda]
Length=107

 Score =   147 bits (372),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = -3

Query  434  RMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRMLKKVGAFSKDPMPDTCVTVCGVS  255
            +  +R+ +EQRLK   G EK+ +D+FVCERVCTSKRML KVG FSKDP P+TCVTVCGVS
Sbjct  6    KATRRKSEEQRLKA--GSEKSPNDVFVCERVCTSKRMLNKVGDFSKDPTPNTCVTVCGVS  63

Query  254  ELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            ELDAC DAC R+VC NQH +PNWNDIC +RCQ +CLR
Sbjct  64   ELDACTDACTRSVCANQHHLPNWNDICFRRCQKQCLR  100



>ref|XP_001778721.1| predicted protein [Physcomitrella patens]
 gb|EDQ56419.1| predicted protein [Physcomitrella patens]
Length=167

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 94/120 (78%), Gaps = 5/120 (4%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGRE-KNSDDIFVCERVCTSKRM  324
            MVE WW ++G  VPA++  QA +  + R++ Q     +GR+ K S D FVCERVCTSKRM
Sbjct  1    MVEWWWGVVGTVVPALVVRQAIKTSRNREEAQ----LQGRDNKGSTDQFVCERVCTSKRM  56

Query  323  LKKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            L +VGAFSKDP PDTCVTVCGVSE+DAC++AC R+VC N H VPNWNDICL+RCQ++C++
Sbjct  57   LSRVGAFSKDPTPDTCVTVCGVSEVDACSEACVRSVCANAHHVPNWNDICLRRCQTQCIK  116



>ref|XP_010107682.1| hypothetical protein L484_007700 [Morus notabilis]
 gb|EXC16655.1| hypothetical protein L484_007700 [Morus notabilis]
Length=130

 Score =   136 bits (342),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 95/120 (79%), Gaps = 2/120 (2%)
 Frame = -3

Query  497  VELWWSllgaavpavlagqAFRMKKRRDDEQRLKRA--RGREKNSDDIFVCERVCTSKRM  324
            +E+WW LLGA +P V+AGQA ++K++R+D +R K     G+   +  +FVCERVC+SKR+
Sbjct  1    MEVWWFLLGAVIPVVVAGQALKVKEKRNDHERAKTVGRSGKGSFNGGVFVCERVCSSKRL  60

Query  323  LKKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            L KV A SKDP+ D CVTVCG  ELDACA+ACA+TVCVNQH+VP+WN +CL RCQSECL+
Sbjct  61   LNKVAASSKDPIMDACVTVCGAYELDACAEACAKTVCVNQHKVPDWNGVCLARCQSECLK  120



>gb|KHN30720.1| Hypothetical protein glysoja_034063 [Glycine soja]
Length=69

 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = -3

Query  326  MLKKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECL  147
            MLKKVG+FSKDP+PDTCVTVCG S+LDACADACARTVCVNQHQVPNWNDICL+RCQSECL
Sbjct  1    MLKKVGSFSKDPIPDTCVTVCGASDLDACADACARTVCVNQHQVPNWNDICLRRCQSECL  60

Query  146  R  144
            +
Sbjct  61   K  61



>ref|XP_005649195.1| hypothetical protein COCSUDRAFT_53027 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24651.1| hypothetical protein COCSUDRAFT_53027 [Coccomyxa subellipsoidea 
C-169]
Length=121

 Score =   122 bits (306),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 78/119 (66%), Gaps = 5/119 (4%)
 Frame = -3

Query  497  VELWWSllgaavpavlag-qAFRMKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRML  321
            V  WW+   A    ++ G    R K R+++E R +     E+ +D  FVCERVCTS R+L
Sbjct  3    VPAWWAAGLAVPAVIVKGFVGGRSKSRKEEEARTRP----EEGTDPSFVCERVCTSDRLL  58

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            +++G  SKDP P+TCVTVCGVS  DAC +AC R VC N HQVP WND CLKRC +EC R
Sbjct  59   RRMGGLSKDPTPNTCVTVCGVSATDACTEACQRGVCTNMHQVPAWNDACLKRCTTECTR  117



>ref|XP_001774164.1| predicted protein [Physcomitrella patens]
 gb|EDQ61078.1| predicted protein [Physcomitrella patens]
Length=232

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 87/120 (73%), Gaps = 5/120 (4%)
 Frame = -3

Query  500  MVELWWSllgaavpavlagqAFRMKKRRDDEQRLKRARGRE-KNSDDIFVCERVCTSKRM  324
            MVE WW ++G  VPA++  Q  +  + R+ +      +G++ K+  + FVCERVCTSKRM
Sbjct  114  MVEWWWGVVGTVVPALVVRQVIQKTRNRERDP----LQGKDTKDLTNQFVCERVCTSKRM  169

Query  323  LKKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            L +VGAFS     DTCVTVCGVSE+DAC++AC R+VC N H VPNWND+C +RCQ++C++
Sbjct  170  LSRVGAFSNGTTSDTCVTVCGVSEVDACSEACIRSVCANAHHVPNWNDVCSRRCQTQCIK  229



>ref|XP_007018217.1| Uncharacterized protein TCM_034499 [Theobroma cacao]
 gb|EOY15442.1| Uncharacterized protein TCM_034499 [Theobroma cacao]
Length=216

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 5/81 (6%)
 Frame = -3

Query  422  RRDDEQRLKRARGREKNSD-----DIFVCERVCTSKRMLKKVGAFSKDPMPDTCVTVCGV  258
            +R +EQ LK  +G +K+SD     DIFVCERVCTSKRML+KVG+ SKDP  D+CVTVCGV
Sbjct  23   KRTEEQTLKMEKGGDKSSDNNINTDIFVCERVCTSKRMLQKVGSVSKDPTTDSCVTVCGV  82

Query  257  SELDACADACARTVCVNQHQV  195
            SE+DACAD CARTVCVNQHQ+
Sbjct  83   SEVDACADVCARTVCVNQHQL  103



>ref|XP_011401016.1| Calmodulin [Auxenochlorella protothecoides]
 gb|KFM22510.1| Calmodulin [Auxenochlorella protothecoides]
Length=235

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = -3

Query  404  RLKRARGREKNSDDIFVCERVCTSKRMLKKVGAFSKDPMPDTCVTVCGVSELDACADACA  225
            ++  A+     SD  FVCERVCTS R+++++G  +KD  P+TCVTVCG S  DACA AC 
Sbjct  145  KMMLAKLDSTGSDPSFVCERVCTSDRLMRRLGGLAKDATPNTCVTVCGTSSQDACASACT  204

Query  224  RTVCVNQHQVPNWNDICLKRCQSECLR  144
            R+VC N HQVP WND C++RC SEC+R
Sbjct  205  RSVCTNLHQVPAWNDTCIERCSSECVR  231



>emb|CEG00360.1| unnamed product [Ostreococcus tauri]
Length=123

 Score =   106 bits (265),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -3

Query  389  RGREKNSDDIFVCERVCTSKRMLKKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCV  210
            RG    ++ +F CERVC S R++ K+G   K  MP TCVTVCG+S  DAC DACAR VC 
Sbjct  36   RGTVDENETMFACERVCASDRLMSKLGGLGKSEMPHTCVTVCGMSGTDACVDACARVVCT  95

Query  209  NQHQVPNWNDICLKRCQSECLR  144
             QH VP WN+ CLKRC +EC R
Sbjct  96   AQHGVPGWNEKCLKRCATECTR  117



>ref|XP_005843384.1| hypothetical protein CHLNCDRAFT_28208, partial [Chlorella variabilis]
 gb|EFN51282.1| hypothetical protein CHLNCDRAFT_28208 [Chlorella variabilis]
Length=82

 Score =   105 bits (261),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = -3

Query  380  EKNSDDIFVCERVCTSKRMLKKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQH  201
            +  +D  FVCERVCTS R+++++G+ +KD  P+TCVTVCG S +DAC DAC R VC   H
Sbjct  1    DAAADPSFVCERVCTSPRLMRRMGSLAKDATPNTCVTVCGTSSVDACTDACQRAVCTTVH  60

Query  200  QVPNWNDICLKRCQSECLR  144
            QVP WND CL RC +EC R
Sbjct  61   QVPAWNDNCLSRCSTECQR  79



>ref|XP_007508590.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20207.1| predicted protein [Bathycoccus prasinos]
Length=127

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -3

Query  389  RGREKNSDDIFVCERVCTSKRMLKKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCV  210
            RG   + +  F CERVC S R+LK++G  +K+P  + CVTVCG+S  D+CA+AC R +C 
Sbjct  42   RGTVTDDEASFACERVCASDRLLKRMGGLAKEPTSNACVTVCGMSATDSCAEACERVICA  101

Query  209  NQHQVPNWNDICLKRCQSECLR  144
            N H VP WND C  RC+SECLR
Sbjct  102  NPHSVPAWNDQCSNRCKSECLR  123



>ref|XP_002506359.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67617.1| predicted protein [Micromonas sp. RCC299]
Length=119

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = -3

Query  422  RRDDEQRLKRARGREKNSDDI-FVCERVCTSKRMLKKVGAFSKDPMPDTCVTVCGVSELD  246
            RR    R +  R RE   D+  F CERVC S R++K++G  SKDP P++CVTVCG S +D
Sbjct  23   RRKKGAREEDGRRREGEGDETSFACERVCASDRLIKRLGYLSKDPTPNSCVTVCGSSGID  82

Query  245  ACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            AC +AC R VC   H VP W D C KRC  ECLR
Sbjct  83   ACTEACQRCVCSLPHTVPAWQDQCNKRCTQECLR  116



>ref|XP_002954256.1| hypothetical protein VOLCADRAFT_82678 [Volvox carteri f. nagariensis]
 gb|EFJ44680.1| hypothetical protein VOLCADRAFT_82678 [Volvox carteri f. nagariensis]
Length=104

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 4/94 (4%)
 Frame = -3

Query  413  DEQRLKRARGREKNSDD----IFVCERVCTSKRMLKKVGAFSKDPMPDTCVTVCGVSELD  246
              Q +K   G  +  DD     FVCERVC S+++++ VGA  KD  P  CVTVCGVS +D
Sbjct  2    SSQVIKNVPGSTQLEDDWSTSTFVCERVCVSEKLMRTVGAAGKDATPGNCVTVCGVSAVD  61

Query  245  ACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            AC +AC R VCV    VP WN+ CL+RC +EC+R
Sbjct  62   ACTEACQRAVCVTPSTVPAWNEACLRRCTAECIR  95



>ref|XP_001421737.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00031.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=124

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = -3

Query  431  MKKRRDDEQRLKRARGREKNSDDIFVCERVCTSKRMLKKVGAFSKDPMPDTCVTVCGVSE  252
            +  R++ ++ L+R  G    ++  F CERVC S R++ K+G   K  +  TCVT CG+S 
Sbjct  25   LNTRQNSQKELRR--GVVDENEVSFACERVCASDRLMAKLGGLGKAELMHTCVTTCGMSA  82

Query  251  LDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
             DAC DACAR  C   H VP WN+ CL+RC SEC R
Sbjct  83   TDACVDACARVACTAGHGVPGWNEKCLRRCASECAR  118



>ref|XP_001700967.1| hypothetical protein CHLREDRAFT_134530 [Chlamydomonas reinhardtii]
 gb|EDP07221.1| predicted protein [Chlamydomonas reinhardtii]
Length=110

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -3

Query  359  FVCERVCTSKRMLKKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWND  180
            F CERVC + +++ KVG  +KD     CVTVCGVS  DAC DACAR VCV+   VP WND
Sbjct  25   FCCERVCVTDKLVAKVGGAAKDATKGNCVTVCGVSAQDACTDACARAVCVSASHVPAWND  84

Query  179  ICLKRCQSECLR  144
             C++RC +ECLR
Sbjct  85   ACIRRCTAECLR  96



>ref|XP_006847669.1| hypothetical protein AMTR_s00149p00038820 [Amborella trichopoda]
 gb|ERN09250.1| hypothetical protein AMTR_s00149p00038820 [Amborella trichopoda]
Length=124

 Score = 87.4 bits (215),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 70/121 (58%), Gaps = 7/121 (6%)
 Frame = -3

Query  497  VELWWSllgaavpavlagqAFRMKKRRDDEQRLKRAR-GREKNSDDIFVCERVCTSKRML  321
            ++ WW+L+  A+  V AG  F   ++       +  R G        FVCERVC SKR+L
Sbjct  1    MDWWWALIPPALAVVTAGIRFTGHQKTAKTAAPETLRNGGGLTHKKPFVCERVCASKRIL  60

Query  320  KKVGAFSKDPMPDTCVTVCGVSELDACADACARTVCVNQHQ--VPNWNDICLKRCQSECL  147
             KV    K    DTC+TVCGVS LD C +AC  ++C   H   +PNW D+C+KRCQ++CL
Sbjct  61   NKV----KGSPSDTCLTVCGVSGLDCCVNACTSSICAEDHHPPIPNWGDVCVKRCQNQCL  116

Query  146  R  144
            +
Sbjct  117  K  117



>ref|XP_003063470.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52606.1| predicted protein [Micromonas pusilla CCMP1545]
Length=81

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -3

Query  302  SKDPMPDTCVTVCGVSELDACADACARTVCVNQHQVPNWNDICLKRCQSECLR  144
            ++DP P+TCVTVCG S +DAC +AC R+VC   H VP+WND C KRC  ECLR
Sbjct  26   AQDPTPNTCVTVCGSSGIDACTEACQRSVCSAPHSVPSWNDQCNKRCTQECLR  78



>ref|XP_003083599.1| unnamed protein product, partial [Ostreococcus tauri]
Length=154

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 35/73 (48%), Gaps = 0/73 (0%)
 Frame = +1

Query  151  HSL*HLFRQMSFQLGT*CWLTHTVRAHASAQASSSETPQTVTQVSGIGSLENAPTFFNIL  330
            HS+ H F+  SF  GT C   HT RAHAS  AS    P TVT V GI      P+     
Sbjct  26   HSVAHRFKHFSFHPGTPCCAVHTTRAHASTHASVPLIPHTVTHVCGISLFPKPPSLLIRR  85

Query  331  FEVQTLSHTNISS  369
                T SH N+ S
Sbjct  86   SLAHTRSHANMVS  98



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1521097577940