BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF024N23

Length=705
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002517023.1|  Auxin-responsive protein IAA7, putative            280   4e-92   
gb|KDP40274.1|  hypothetical protein JCGZ_02272                         282   5e-92   Jatropha curcas
ref|XP_007034956.1|  Indole-3-acetic acid 7 isoform 1                   282   1e-91   
ref|NP_001266070.1|  IAA14                                              280   5e-91   Solanum lycopersicum
ref|XP_003591806.1|  Indoleacetic acid-induced-like protein             280   5e-91   Medicago truncatula
emb|CBI26357.3|  unnamed protein product                                280   6e-91   Vitis vinifera
ref|XP_002284133.1|  PREDICTED: auxin-responsive protein IAA14          280   7e-91   Vitis vinifera
emb|CDO99148.1|  unnamed protein product                                279   1e-90   Coffea canephora [robusta coffee]
ref|XP_011091113.1|  PREDICTED: auxin-responsive protein IAA14          279   1e-90   Sesamum indicum [beniseed]
ref|XP_006362195.1|  PREDICTED: auxin-responsive protein IAA14-like     278   2e-90   Solanum tuberosum [potatoes]
ref|XP_011030586.1|  PREDICTED: auxin-responsive protein IAA14-li...    278   2e-90   Populus euphratica
ref|XP_004172452.1|  PREDICTED: auxin-responsive protein IAA14-like     279   2e-90   
ref|XP_008465181.1|  PREDICTED: auxin-responsive protein IAA14-like     278   3e-90   Cucumis melo [Oriental melon]
ref|XP_004495392.1|  PREDICTED: auxin-responsive protein IAA14-li...    277   5e-90   Cicer arietinum [garbanzo]
ref|XP_002311658.1|  aux/IAA family protein                             277   6e-90   Populus trichocarpa [western balsam poplar]
ref|XP_009776553.1|  PREDICTED: auxin-responsive protein IAA14-like     277   8e-90   Nicotiana sylvestris
ref|XP_009611797.1|  PREDICTED: auxin-responsive protein IAA14          276   1e-89   Nicotiana tomentosiformis
ref|XP_009591035.1|  PREDICTED: auxin-responsive protein IAA7-like      276   1e-89   Nicotiana tomentosiformis
ref|XP_011027555.1|  PREDICTED: auxin-responsive protein IAA14 is...    276   1e-89   Populus euphratica
gb|AFZ78617.1|  hypothetical protein                                    276   2e-89   Populus tomentosa [Chinese white poplar]
gb|AFK37379.1|  unknown                                                 276   2e-89   Medicago truncatula
gb|AEE25653.1|  auxin-responsive protein                                274   2e-88   Gossypium hirsutum [American cotton]
ref|XP_011030585.1|  PREDICTED: auxin-responsive protein IAA14-li...    274   2e-88   Populus euphratica
gb|AFK44393.1|  unknown                                                 273   2e-88   Lotus japonicus
gb|KJB38278.1|  hypothetical protein B456_006G246000                    275   2e-88   Gossypium raimondii
gb|KJB38280.1|  hypothetical protein B456_006G246000                    274   2e-88   Gossypium raimondii
ref|XP_007143877.1|  hypothetical protein PHAVU_007G109500g             273   2e-88   Phaseolus vulgaris [French bean]
gb|EYU32514.1|  hypothetical protein MIMGU_mgv1a012542mg                273   3e-88   Erythranthe guttata [common monkey flower]
ref|XP_011073485.1|  PREDICTED: auxin-responsive protein IAA14          273   4e-88   Sesamum indicum [beniseed]
gb|KHN05057.1|  Auxin-responsive protein IAA14                          273   4e-88   Glycine soja [wild soybean]
gb|KHF98789.1|  Auxin-responsive IAA14 -like protein                    272   5e-88   Gossypium arboreum [tree cotton]
ref|NP_001240213.1|  auxin-induced protein ali50                        272   6e-88   Glycine max [soybeans]
ref|XP_009777122.1|  PREDICTED: auxin-responsive protein IAA14-like     271   8e-88   Nicotiana sylvestris
ref|XP_004288427.1|  PREDICTED: auxin-responsive protein IAA14-like     271   1e-87   Fragaria vesca subsp. vesca
ref|XP_011027545.1|  PREDICTED: auxin-responsive protein IAA14 is...    271   1e-87   Populus euphratica
ref|XP_006298251.1|  hypothetical protein CARUB_v10014321mg             272   2e-87   
gb|KFK24541.1|  hypothetical protein AALP_AAs58011U000100               270   2e-87   Arabis alpina [alpine rockcress]
ref|XP_010024036.1|  PREDICTED: auxin-responsive protein IAA14-like     271   2e-87   Eucalyptus grandis [rose gum]
ref|XP_007223810.1|  hypothetical protein PRUPE_ppa010698mg             270   2e-87   
gb|AFS44507.1|  auxin repressor                                         270   4e-87   Fragaria x ananassa
gb|KJB28413.1|  hypothetical protein B456_005G046500                    270   6e-87   Gossypium raimondii
gb|ADJ68049.1|  auxin responsive protein                                269   1e-86   Catharanthus roseus [chatas]
ref|XP_010435110.1|  PREDICTED: auxin-responsive protein IAA14          268   1e-86   Camelina sativa [gold-of-pleasure]
ref|XP_002315736.1|  aux/IAA family protein                             270   1e-86   Populus trichocarpa [western balsam poplar]
ref|XP_003556389.2|  PREDICTED: auxin-responsive protein IAA14-like     271   1e-86   
gb|KHG01271.1|  Auxin-responsive IAA14 -like protein                    268   3e-86   Gossypium arboreum [tree cotton]
ref|XP_010552451.1|  PREDICTED: auxin-responsive protein IAA14-like     267   4e-86   Tarenaya hassleriana [spider flower]
ref|XP_006414696.1|  hypothetical protein EUTSA_v10026031mg             268   5e-86   
ref|XP_010440448.1|  PREDICTED: auxin-responsive protein IAA14-like     266   6e-86   Camelina sativa [gold-of-pleasure]
gb|KJB82525.1|  hypothetical protein B456_013G200700                    266   2e-85   Gossypium raimondii
gb|AEE25654.1|  auxin-responsive protein                                266   2e-85   Gossypium hirsutum [American cotton]
gb|AAC49055.1|  IAA14                                                   263   2e-85   Arabidopsis thaliana [mouse-ear cress]
gb|KFK39592.1|  hypothetical protein AALP_AA3G264300                    265   2e-85   Arabis alpina [alpine rockcress]
ref|XP_009135842.1|  PREDICTED: auxin-responsive protein IAA7-like      265   3e-85   Brassica rapa
ref|XP_008224185.1|  PREDICTED: auxin-responsive protein IAA14          265   3e-85   Prunus mume [ume]
ref|XP_008362015.1|  PREDICTED: auxin-responsive protein IAA14-like     265   4e-85   
ref|XP_011038568.1|  PREDICTED: auxin-responsive protein IAA16-like     265   5e-85   Populus euphratica
ref|XP_010450026.1|  PREDICTED: auxin-responsive protein IAA14-like     264   6e-85   Camelina sativa [gold-of-pleasure]
ref|XP_010551700.1|  PREDICTED: auxin-responsive protein IAA14          264   7e-85   Tarenaya hassleriana [spider flower]
ref|NP_193191.2|  auxin-responsive protein IAA14                        264   7e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009337294.1|  PREDICTED: auxin-responsive protein IAA14-like     264   8e-85   
ref|XP_010556884.1|  PREDICTED: auxin-responsive protein IAA17          264   8e-85   Tarenaya hassleriana [spider flower]
ref|XP_004134096.1|  PREDICTED: auxin-responsive protein IAA14-li...    264   1e-84   Cucumis sativus [cucumbers]
ref|XP_002319075.1|  hypothetical protein POPTR_0013s03870g             264   1e-84   Populus trichocarpa [western balsam poplar]
ref|NP_001280875.1|  auxin-responsive protein IAA14-like                263   2e-84   Malus domestica [apple tree]
ref|XP_010532600.1|  PREDICTED: auxin-responsive protein IAA14          262   3e-84   Tarenaya hassleriana [spider flower]
ref|XP_008438588.1|  PREDICTED: auxin-responsive protein IAA14-like     262   3e-84   Cucumis melo [Oriental melon]
emb|CDY47148.1|  BnaA08g05350D                                          262   3e-84   Brassica napus [oilseed rape]
ref|XP_006284476.1|  hypothetical protein CARUB_v10005662mg             262   3e-84   Capsella rubella
ref|NP_001275031.1|  auxin-responsive protein IAA14-like                261   4e-84   Solanum tuberosum [potatoes]
ref|XP_002868277.1|  hypothetical protein ARALYDRAFT_493451             261   5e-84   
ref|XP_010274203.1|  PREDICTED: auxin-responsive protein IAA16-like     262   6e-84   Nelumbo nucifera [Indian lotus]
ref|XP_010466604.1|  PREDICTED: auxin-responsive protein IAA7-like      261   8e-84   Camelina sativa [gold-of-pleasure]
ref|XP_010488346.1|  PREDICTED: auxin-responsive protein IAA7-like      261   9e-84   Camelina sativa [gold-of-pleasure]
ref|XP_009107777.1|  PREDICTED: auxin-responsive protein IAA14          261   9e-84   Brassica rapa
ref|XP_010512022.1|  PREDICTED: auxin-responsive protein IAA7           261   1e-83   Camelina sativa [gold-of-pleasure]
gb|AAM65301.1|  indoleacetic acid (IAA)-inducible gene (IAA7)           261   1e-83   Arabidopsis thaliana [mouse-ear cress]
gb|KHG19190.1|  Auxin-responsive IAA16 -like protein                    261   1e-83   Gossypium arboreum [tree cotton]
emb|CAC84710.1|  aux/IAA protein                                        262   1e-83   Populus tremula x Populus tremuloides
ref|XP_004493739.1|  PREDICTED: auxin-induced protein AUX28-like        261   2e-83   Cicer arietinum [garbanzo]
dbj|BAH15071.1|  indole-3-acetic acid 14 transcription factor like      261   2e-83   Malus prunifolia
ref|NP_188945.1|  auxin-responsive protein IAA7                         261   2e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007034957.1|  Indole-3-acetic acid inducible 14 isoform 2        259   3e-83   
emb|CDY62130.1|  BnaC08g47390D                                          259   4e-83   Brassica napus [oilseed rape]
gb|KEH42778.1|  auxin-responsive AUX/IAA family protein                 259   4e-83   Medicago truncatula
ref|XP_011032399.1|  PREDICTED: auxin-responsive protein IAA16-like     259   5e-83   Populus euphratica
ref|XP_004289900.1|  PREDICTED: auxin-induced protein AUX28-like        259   5e-83   Fragaria vesca subsp. vesca
ref|XP_007030567.1|  Indoleacetic acid-induced protein 16               259   8e-83   
gb|AAM21317.1|AF373100_1  auxin-regulated protein                       259   8e-83   Populus tremula x Populus tremuloides
ref|XP_006382798.1|  hypothetical protein POPTR_0005s05560g             259   9e-83   Populus trichocarpa [western balsam poplar]
gb|ABM53874.1|  IAA6                                                    255   1e-82   Cestrum elegans
ref|XP_006443921.1|  hypothetical protein CICLE_v10022032mg             258   1e-82   Citrus clementina [clementine]
ref|XP_004495391.1|  PREDICTED: auxin-responsive protein IAA14-li...    258   1e-82   
dbj|BAI94494.1|  Aux/IAA protein                                        258   2e-82   Dianthus caryophyllus [carnation]
ref|NP_001288823.1|  auxin-responsive protein IAA7                      258   2e-82   Brassica rapa
ref|XP_010674855.1|  PREDICTED: auxin-induced protein AUX28             259   2e-82   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002281771.1|  PREDICTED: auxin-responsive protein IAA16-like     258   3e-82   Vitis vinifera
emb|CAN63268.1|  hypothetical protein VITISV_013635                     257   3e-82   Vitis vinifera
emb|CDY10349.1|  BnaC05g29300D                                          257   4e-82   Brassica napus [oilseed rape]
ref|XP_010457463.1|  PREDICTED: auxin-responsive protein IAA17          257   4e-82   Camelina sativa [gold-of-pleasure]
ref|XP_010483317.1|  PREDICTED: auxin-responsive protein IAA17-like     256   4e-82   Camelina sativa [gold-of-pleasure]
gb|KJB11141.1|  hypothetical protein B456_001G242900                    257   5e-82   Gossypium raimondii
ref|XP_006406100.1|  hypothetical protein EUTSA_v10021428mg             256   7e-82   Eutrema salsugineum [saltwater cress]
gb|KHN18836.1|  Auxin-induced protein AUX28                             256   7e-82   Glycine soja [wild soybean]
ref|XP_010679165.1|  PREDICTED: auxin-responsive protein IAA14-like     258   8e-82   
ref|XP_006304183.1|  hypothetical protein CARUB_v10010236mg             256   8e-82   Capsella rubella
ref|XP_002883395.1|  hypothetical protein ARALYDRAFT_319024             256   8e-82   Arabidopsis lyrata subsp. lyrata
ref|NP_001241599.1|  uncharacterized protein LOC100803065               256   1e-81   Glycine max [soybeans]
gb|ABH01143.1|  auxin-regulated protein                                 256   1e-81   Populus tomentosa [Chinese white poplar]
gb|KDO68557.1|  hypothetical protein CISIN_1g026823mg                   256   1e-81   Citrus sinensis [apfelsine]
ref|XP_011082603.1|  PREDICTED: auxin-responsive protein IAA14-like     255   1e-81   Sesamum indicum [beniseed]
gb|EYU33008.1|  hypothetical protein MIMGU_mgv1a012321mg                256   2e-81   Erythranthe guttata [common monkey flower]
ref|XP_006420094.1|  hypothetical protein CICLE_v10005789mg             255   2e-81   Citrus clementina [clementine]
ref|XP_010475075.1|  PREDICTED: auxin-responsive protein IAA17-like     255   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_011042427.1|  PREDICTED: auxin-induced protein AUX28-like        255   3e-81   Populus euphratica
ref|NP_001266049.1|  IAA9 protein                                       255   3e-81   Solanum lycopersicum
ref|XP_006383686.1|  auxin-induced protein aux28                        255   3e-81   Populus trichocarpa [western balsam poplar]
gb|KDP23667.1|  hypothetical protein JCGZ_23500                         255   3e-81   Jatropha curcas
ref|XP_010278165.1|  PREDICTED: auxin-responsive protein IAA16-like     255   3e-81   Nelumbo nucifera [Indian lotus]
ref|NP_171921.1|  auxin-responsive protein IAA17                        254   3e-81   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64837.1|  putative auxin-induced protein, IAA17/AXR3-1            254   3e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011079949.1|  PREDICTED: auxin-induced protein AUX28-like        255   4e-81   Sesamum indicum [beniseed]
ref|XP_010936171.1|  PREDICTED: auxin-responsive protein IAA30-like     255   4e-81   Elaeis guineensis
ref|XP_010087762.1|  Auxin-responsive protein IAA7                      256   4e-81   
ref|XP_007050421.1|  Indole-3-acetic acid inducible 14 isoform 1        256   5e-81   
gb|ACJ83896.1|  unknown                                                 254   6e-81   Medicago truncatula
gb|AEE25650.1|  auxin-responsive protein                                254   6e-81   Gossypium hirsutum [American cotton]
gb|ACU18407.1|  unknown                                                 254   7e-81   Glycine max [soybeans]
gb|EYU46510.1|  hypothetical protein MIMGU_mgv1a013084mg                253   8e-81   Erythranthe guttata [common monkey flower]
ref|NP_001275398.1|  auxin/indole-3-acetic acid 3                       254   8e-81   Solanum tuberosum [potatoes]
gb|EPS64756.1|  hypothetical protein M569_10024                         253   8e-81   Genlisea aurea
ref|NP_001266039.1|  IAA7 protein                                       253   9e-81   Solanum lycopersicum
emb|CAH59413.1|  auxin resistance protein                               253   9e-81   Plantago major [cart-track plant]
ref|XP_002889499.1|  hypothetical protein ARALYDRAFT_470401             253   1e-80   
gb|AAM96891.1|  auxin-responsive protein IAA1                           251   1e-80   Mirabilis jalapa
gb|KJB42200.1|  hypothetical protein B456_007G141900                    253   2e-80   Gossypium raimondii
gb|AAD32146.1|AF123508_1  Nt-iaa28 deduced protein                      253   2e-80   Nicotiana tabacum [American tobacco]
ref|XP_008382962.1|  PREDICTED: auxin-induced protein AUX28-like        253   2e-80   Malus domestica [apple tree]
gb|ACL81167.1|  auxin-responsive protein IAA1                           253   2e-80   Mirabilis jalapa
ref|XP_006432923.1|  hypothetical protein CICLE_v10002290mg             253   2e-80   Citrus clementina [clementine]
ref|XP_002531288.1|  Auxin-responsive protein IAA16, putative           253   2e-80   Ricinus communis
ref|XP_006418149.1|  hypothetical protein EUTSA_v10008679mg             252   3e-80   Eutrema salsugineum [saltwater cress]
ref|XP_009761467.1|  PREDICTED: auxin-responsive protein IAA16          252   3e-80   Nicotiana sylvestris
ref|XP_010025014.1|  PREDICTED: auxin-responsive protein IAA16-like     253   4e-80   Eucalyptus grandis [rose gum]
ref|XP_009354870.1|  PREDICTED: auxin-induced protein AUX28-like        252   5e-80   Pyrus x bretschneideri [bai li]
ref|XP_009610435.1|  PREDICTED: auxin-responsive protein IAA16          251   6e-80   Nicotiana tomentosiformis
gb|KDO48905.1|  hypothetical protein CISIN_1g026005mg                   251   7e-80   Citrus sinensis [apfelsine]
ref|XP_002302075.1|  auxin-induced protein aux28                        251   8e-80   Populus trichocarpa [western balsam poplar]
gb|AAC39440.1|  IAA17/AXR3-1 protein                                    251   1e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008372303.1|  PREDICTED: auxin-induced protein AUX28-like        251   1e-79   
gb|AFK42876.1|  unknown                                                 251   1e-79   Medicago truncatula
emb|CDY63910.1|  BnaC01g43640D                                          251   1e-79   Brassica napus [oilseed rape]
ref|XP_009420668.1|  PREDICTED: auxin-responsive protein IAA30-like     250   2e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008788131.1|  PREDICTED: auxin-responsive protein IAA30-like     250   2e-79   Phoenix dactylifera
emb|CDY15493.1|  BnaA08g27770D                                          250   2e-79   Brassica napus [oilseed rape]
ref|XP_009111119.1|  PREDICTED: auxin-responsive protein IAA17          249   2e-79   Brassica rapa
ref|NP_001288939.1|  auxin-responsive protein IAA16                     249   3e-79   Brassica rapa
ref|XP_006408159.1|  hypothetical protein EUTSA_v10021441mg             249   3e-79   Eutrema salsugineum [saltwater cress]
ref|XP_009367750.1|  PREDICTED: auxin-induced protein AUX28-like        250   3e-79   Pyrus x bretschneideri [bai li]
dbj|BAJ34138.1|  unnamed protein product                                249   3e-79   Eutrema halophilum
gb|KHG04941.1|  Auxin-induced AUX28                                     249   3e-79   Gossypium arboreum [tree cotton]
ref|XP_010102292.1|  Auxin-responsive protein IAA16                     250   3e-79   Morus notabilis
gb|KJB44873.1|  hypothetical protein B456_007G276900                    250   4e-79   Gossypium raimondii
emb|CAB46059.1|  IAA7 like protein                                      249   4e-79   Arabidopsis thaliana [mouse-ear cress]
gb|KJB11145.1|  hypothetical protein B456_001G242900                    250   5e-79   Gossypium raimondii
ref|NP_001268036.1|  uncharacterized protein LOC100250231               249   6e-79   Vitis vinifera
emb|CBI35213.3|  unnamed protein product                                246   7e-79   Vitis vinifera
ref|XP_009418923.1|  PREDICTED: auxin-responsive protein IAA30-like     249   8e-79   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY50750.1|  BnaAnng10570D                                          250   1e-78   Brassica napus [oilseed rape]
gb|KHN30563.1|  Auxin-responsive protein IAA14                          248   1e-78   Glycine soja [wild soybean]
ref|XP_004302055.1|  PREDICTED: auxin-responsive protein IAA16          249   1e-78   Fragaria vesca subsp. vesca
gb|EYU30526.1|  hypothetical protein MIMGU_mgv1a012831mg                248   1e-78   Erythranthe guttata [common monkey flower]
ref|XP_011026048.1|  PREDICTED: auxin-induced protein AUX28-like        248   1e-78   Populus euphratica
gb|ACJ84642.1|  unknown                                                 248   2e-78   Medicago truncatula
ref|XP_010917602.1|  PREDICTED: auxin-responsive protein IAA30 is...    248   2e-78   Elaeis guineensis
emb|CDY18214.1|  BnaC05g02370D                                          247   2e-78   Brassica napus [oilseed rape]
ref|XP_006418150.1|  hypothetical protein EUTSA_v10008679mg             247   3e-78   Eutrema salsugineum [saltwater cress]
gb|KFK37887.1|  hypothetical protein AALP_AA3G042100                    247   3e-78   Arabis alpina [alpine rockcress]
ref|XP_008810170.1|  PREDICTED: auxin-responsive protein IAA30-like     247   5e-78   Phoenix dactylifera
ref|NP_187124.1|  auxin-responsive protein IAA16                        246   5e-78   Arabidopsis thaliana [mouse-ear cress]
gb|AFK36086.1|  unknown                                                 247   7e-78   Lotus japonicus
ref|XP_007147174.1|  hypothetical protein PHAVU_006G102100g             247   9e-78   Phaseolus vulgaris [French bean]
ref|XP_008218270.1|  PREDICTED: auxin-responsive protein IAA16          246   1e-77   Prunus mume [ume]
ref|NP_001280973.1|  auxin-responsive protein IAA16                     246   1e-77   Malus domestica [apple tree]
emb|CDX89832.1|  BnaA10g02500D                                          245   1e-77   
emb|CDY32537.1|  BnaA09g50590D                                          244   2e-77   Brassica napus [oilseed rape]
ref|XP_009398568.1|  PREDICTED: auxin-responsive protein IAA30-like     245   2e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001239753.1|  uncharacterized protein LOC100781847               244   2e-77   Glycine max [soybeans]
ref|XP_009118658.1|  PREDICTED: auxin-responsive protein IAA17-like     244   2e-77   Brassica rapa
gb|KHN22078.1|  Auxin-responsive protein IAA16                          244   3e-77   Glycine soja [wild soybean]
ref|XP_007162490.1|  hypothetical protein PHAVU_001G156600g             244   4e-77   Phaseolus vulgaris [French bean]
ref|XP_007144686.1|  hypothetical protein PHAVU_007G176600g             244   4e-77   Phaseolus vulgaris [French bean]
emb|CDY63072.1|  BnaCnng41350D                                          249   4e-77   Brassica napus [oilseed rape]
gb|ADL36587.1|  ARF domain class transcription factor                   241   7e-77   Malus domestica [apple tree]
ref|XP_002520980.1|  Auxin-induced protein AUX28, putative              244   7e-77   Ricinus communis
emb|CDY10694.1|  BnaA05g16680D                                          241   8e-77   Brassica napus [oilseed rape]
gb|AAD32147.1|AF123509_1  Nt-iaa4.1 deduced protein                     243   8e-77   Nicotiana tabacum [American tobacco]
emb|CDY10068.1|  BnaC08g43830D                                          243   8e-77   Brassica napus [oilseed rape]
ref|XP_002884465.1|  indoleacetic acid-induced protein 16               243   9e-77   
ref|XP_006443920.1|  hypothetical protein CICLE_v10022032mg             243   1e-76   
gb|AFK44192.1|  unknown                                                 244   1e-76   Medicago truncatula
ref|XP_006298436.1|  hypothetical protein CARUB_v10014507mg             243   1e-76   Capsella rubella
ref|XP_010418365.1|  PREDICTED: auxin-responsive protein IAA16          243   1e-76   Camelina sativa [gold-of-pleasure]
ref|XP_009413916.1|  PREDICTED: auxin-responsive protein IAA30-like     243   1e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007205640.1|  hypothetical protein PRUPE_ppa009254mg             245   1e-76   
ref|XP_004495802.1|  PREDICTED: auxin-responsive protein IAA16-like     243   1e-76   Cicer arietinum [garbanzo]
ref|XP_010485858.1|  PREDICTED: auxin-responsive protein IAA16-like     243   2e-76   Camelina sativa [gold-of-pleasure]
ref|XP_009124981.1|  PREDICTED: auxin-responsive protein IAA16-like     242   2e-76   Brassica rapa
dbj|BAG55005.1|  auxin-responsive Aux/IAA gene family member            242   2e-76   Ipomoea nil [qian niu]
ref|XP_009119323.1|  PREDICTED: auxin-responsive protein IAA17-like     242   2e-76   Brassica rapa
gb|KEH43017.1|  auxin-responsive AUX/IAA family protein                 243   3e-76   Medicago truncatula
gb|AGV54230.1|  auxin-induced protein AUX28                             242   3e-76   Phaseolus vulgaris [French bean]
emb|CDY41894.1|  BnaC05g47100D                                          241   4e-76   Brassica napus [oilseed rape]
ref|NP_001236693.1|  auxin-induced protein AUX28                        242   5e-76   
gb|KHN02537.1|  Auxin-induced protein AUX28                             242   5e-76   Glycine soja [wild soybean]
ref|XP_006605305.1|  PREDICTED: uncharacterized protein LOC100499...    241   5e-76   
ref|XP_010923478.1|  PREDICTED: auxin-responsive protein IAA30-li...    242   5e-76   Elaeis guineensis
gb|KJB11146.1|  hypothetical protein B456_001G242900                    243   6e-76   Gossypium raimondii
ref|XP_009364490.1|  PREDICTED: auxin-responsive protein IAA16          241   8e-76   Pyrus x bretschneideri [bai li]
ref|XP_006838867.1|  hypothetical protein AMTR_s00002p00266760          241   1e-75   Amborella trichopoda
ref|XP_010038039.1|  PREDICTED: auxin-induced protein AUX28-like        242   1e-75   Eucalyptus grandis [rose gum]
gb|ACU21378.1|  unknown                                                 240   2e-75   Glycine max [soybeans]
ref|XP_010463960.1|  PREDICTED: auxin-responsive protein IAA16-like     239   2e-75   Camelina sativa [gold-of-pleasure]
ref|NP_001267662.1|  auxin-induced protein AUX28-like                   239   4e-75   Cucumis sativus [cucumbers]
ref|XP_010917600.1|  PREDICTED: auxin-responsive protein IAA30 is...    239   8e-75   
ref|XP_003521268.1|  PREDICTED: auxin-induced protein AUX28-like        239   8e-75   Glycine max [soybeans]
ref|XP_008451270.1|  PREDICTED: auxin-induced protein AUX28-like        238   1e-74   Cucumis melo [Oriental melon]
ref|XP_009417112.1|  PREDICTED: auxin-responsive protein IAA30-like     238   1e-74   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY30017.1|  BnaC01g39910D                                          236   5e-74   Brassica napus [oilseed rape]
ref|XP_003521753.1|  PREDICTED: auxin-responsive protein IAA16-like     236   5e-74   Glycine max [soybeans]
ref|XP_010522504.1|  PREDICTED: auxin-responsive protein IAA17-like     236   6e-74   Tarenaya hassleriana [spider flower]
gb|KHN31465.1|  Auxin-responsive protein IAA16                          236   7e-74   Glycine soja [wild soybean]
ref|XP_002306817.1|  hypothetical protein POPTR_0005s23980g             236   7e-74   
gb|ACF88333.1|  unknown                                                 237   8e-74   Zea mays [maize]
ref|XP_008235328.1|  PREDICTED: auxin-induced protein AUX28-like        236   2e-73   Prunus mume [ume]
gb|ABD98055.1|  auxin-regulated protein                                 235   2e-73   Striga asiatica [witchweed]
gb|ABI36487.1|  AUX/IAA7 A                                              231   3e-73   Malus domestica [apple tree]
ref|NP_001237212.1|  uncharacterized protein LOC100499872               234   3e-73   
gb|ADL70671.1|  indole-3-acetic acid inducible 16                       231   4e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007201400.1|  hypothetical protein PRUPE_ppa010342mg             234   5e-73   Prunus persica
gb|ADL70672.1|  indole-3-acetic acid inducible 16                       231   6e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004963100.1|  PREDICTED: auxin-responsive protein IAA30-like     233   2e-72   Setaria italica
emb|CAN72026.1|  hypothetical protein VITISV_014421                     234   2e-72   Vitis vinifera
ref|XP_006366663.1|  PREDICTED: auxin-responsive protein IAA16-like     231   3e-72   Solanum tuberosum [potatoes]
ref|XP_006408158.1|  hypothetical protein EUTSA_v10021441mg             231   3e-72   
ref|XP_008462706.1|  PREDICTED: auxin-responsive protein IAA16-li...    231   4e-72   Cucumis melo [Oriental melon]
emb|CDP06818.1|  unnamed protein product                                231   4e-72   Coffea canephora [robusta coffee]
ref|XP_004142529.1|  PREDICTED: auxin-responsive protein IAA16-like     231   5e-72   Cucumis sativus [cucumbers]
gb|ACU19136.1|  unknown                                                 231   8e-72   Glycine max [soybeans]
emb|CAC84711.1|  aux/IAA protein                                        230   9e-72   Populus tremula x Populus tremuloides
dbj|BAJ84870.1|  predicted protein                                      231   1e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK01326.1|  predicted protein                                      231   1e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADL70673.1|  indole-3-acetic acid inducible 16                       227   2e-71   Arabidopsis thaliana [mouse-ear cress]
gb|KFK31703.1|  hypothetical protein AALP_AA6G148100                    229   2e-71   Arabis alpina [alpine rockcress]
gb|AFK43673.1|  unknown                                                 230   3e-71   Lotus japonicus
ref|XP_009774251.1|  PREDICTED: auxin-responsive protein IAA16-like     228   3e-71   Nicotiana sylvestris
gb|ABM53872.1|  IAA4                                                    225   6e-71   Cestrum elegans
gb|ACF87179.1|  unknown                                                 230   6e-71   Zea mays [maize]
ref|XP_003579189.1|  PREDICTED: auxin-responsive protein IAA30-like     229   7e-71   Brachypodium distachyon [annual false brome]
ref|NP_001150626.1|  IAA30 - auxin-responsive Aux/IAA family member     229   7e-71   Zea mays [maize]
ref|XP_004134097.1|  PREDICTED: auxin-responsive protein IAA14-li...    228   9e-71   
ref|XP_004150437.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    228   1e-70   
ref|XP_002443496.1|  hypothetical protein SORBIDRAFT_08g020580          229   2e-70   Sorghum bicolor [broomcorn]
gb|ABR17764.1|  unknown                                                 230   2e-70   Picea sitchensis
ref|XP_010550916.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    226   2e-70   Tarenaya hassleriana [spider flower]
ref|XP_008455985.1|  PREDICTED: auxin-responsive protein IAA16 is...    226   3e-70   Cucumis melo [Oriental melon]
gb|ABK24636.1|  unknown                                                 231   4e-70   Picea sitchensis
gb|ABI36493.1|  AUX/IAA16 A                                             223   4e-70   Malus domestica [apple tree]
emb|CBI28036.3|  unnamed protein product                                223   8e-70   Vitis vinifera
ref|XP_010915883.1|  PREDICTED: auxin-responsive protein IAA17-like     229   8e-70   Elaeis guineensis
ref|XP_006833393.1|  hypothetical protein AMTR_s00109p00120700          229   1e-69   Amborella trichopoda
gb|KEH43016.1|  auxin-responsive AUX/IAA family protein                 225   1e-69   Medicago truncatula
ref|NP_001266055.1|  IAA10 protein                                      224   1e-69   Solanum lycopersicum
gb|KDP21369.1|  hypothetical protein JCGZ_21840                         225   2e-69   Jatropha curcas
ref|XP_008802939.1|  PREDICTED: auxin-responsive protein IAA17-like     228   2e-69   Phoenix dactylifera
gb|EEE53551.1|  hypothetical protein OsJ_36765                          223   2e-69   Oryza sativa Japonica Group [Japonica rice]
emb|CBI36106.3|  unnamed protein product                                226   2e-69   Vitis vinifera
ref|XP_010925905.1|  PREDICTED: auxin-responsive protein IAA17-like     227   3e-69   Elaeis guineensis
ref|NP_001275473.1|  Aux/IAA protein                                    228   3e-69   Solanum tuberosum [potatoes]
gb|ABB55368.1|  Aux/IAA protein-like                                    228   4e-69   
ref|XP_009421456.1|  PREDICTED: auxin-responsive protein IAA21-like     226   4e-69   
gb|KEH42779.1|  auxin-responsive AUX/IAA family protein                 223   5e-69   
gb|ABR16139.1|  unknown                                                 230   5e-69   
ref|XP_003554705.1|  PREDICTED: auxin-responsive protein IAA16-li...    223   6e-69   
gb|KEH27147.1|  auxin response factor                                   224   6e-69   
ref|XP_010254042.1|  PREDICTED: auxin-responsive protein IAA27-like     226   8e-69   
gb|KGN60808.1|  hypothetical protein Csa_2G010920                       223   9e-69   
ref|XP_004156465.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    223   1e-68   
ref|XP_002284282.1|  PREDICTED: auxin-responsive protein IAA27-like     226   1e-68   
ref|NP_001067209.1|  Os12g0601300                                       224   1e-68   
gb|ADL70678.1|  indole-3-acetic acid inducible 16                       220   1e-68   
gb|ADL70681.1|  indole-3-acetic acid inducible 16                       219   2e-68   
gb|AAP44405.1|  auxin-induced protein 2                                 224   3e-68   
emb|CAI77628.1|  Aux/IAA protein                                        223   5e-68   
ref|XP_004982377.1|  PREDICTED: auxin-responsive protein IAA30-li...    221   8e-68   
ref|XP_002284118.1|  PREDICTED: auxin-responsive protein IAA27          223   8e-68   
ref|XP_009789143.1|  PREDICTED: auxin-responsive protein IAA8-like      224   8e-68   
emb|CAC85936.1|  putative auxin induced transcription factor Aux/IAA    223   8e-68   
ref|XP_009608764.1|  PREDICTED: auxin-responsive protein IAA8-like      224   8e-68   
ref|XP_010320058.1|  PREDICTED: auxin-responsive protein (Aux/IAA...    224   9e-68   
ref|NP_001265888.1|  auxin-responsive protein (Aux/IAA)                 224   1e-67   
ref|XP_010249636.1|  PREDICTED: auxin-responsive protein IAA27          223   1e-67   
gb|KHG27397.1|  Auxin-responsive IAA27 -like protein                    220   1e-67   
gb|ABI36490.1|  AUX/IAA7 C                                              217   1e-67   
ref|XP_007201399.1|  hypothetical protein PRUPE_ppa010342mg             220   1e-67   
gb|AFK45766.1|  unknown                                                 220   2e-67   
gb|KJB56779.1|  hypothetical protein B456_009G135900                    222   2e-67   
ref|XP_009390697.1|  PREDICTED: auxin-responsive protein IAA17-like     221   2e-67   
gb|KHG09793.1|  Auxin-responsive IAA27 -like protein                    222   3e-67   
ref|XP_009388718.1|  PREDICTED: auxin-responsive protein IAA17-like     221   3e-67   
gb|AEI70506.1|  auxin-responsive protein                                222   3e-67   
gb|KJB54240.1|  hypothetical protein B456_009G026700                    221   4e-67   
gb|KHG03466.1|  Auxin-responsive IAA27 -like protein                    221   4e-67   
gb|KJB18638.1|  hypothetical protein B456_003G064200                    218   4e-67   
ref|XP_006850381.1|  hypothetical protein AMTR_s00184p00030540          223   5e-67   
ref|XP_008783241.1|  PREDICTED: auxin-responsive protein IAA17-li...    221   5e-67   
ref|XP_004150556.1|  PREDICTED: auxin-responsive protein IAA27-like     220   6e-67   
ref|NP_001267710.1|  auxin-responsive protein IAA9-like                 222   7e-67   
ref|XP_008444965.1|  PREDICTED: auxin-responsive protein IAA9-like      222   8e-67   
ref|XP_009409066.1|  PREDICTED: auxin-responsive protein IAA17-like     221   8e-67   
gb|ACU19616.1|  unknown                                                 217   1e-66   
ref|XP_008793078.1|  PREDICTED: auxin-responsive protein IAA27-li...    220   1e-66   
ref|XP_011072390.1|  PREDICTED: auxin-responsive protein IAA27          220   1e-66   
ref|XP_008236708.1|  PREDICTED: auxin-responsive protein IAA9           221   2e-66   
ref|XP_007205358.1|  hypothetical protein PRUPE_ppa007194mg             221   2e-66   
ref|XP_009380572.1|  PREDICTED: auxin-responsive protein IAA21-li...    219   2e-66   
ref|XP_006381732.1|  hypothetical protein POPTR_0006s16640g             219   2e-66   
ref|XP_007013106.1|  Phytochrome-associated protein 2 isoform 1         219   2e-66   
gb|KJB18635.1|  hypothetical protein B456_003G064200                    219   3e-66   
gb|AEV89263.1|  IAA9                                                    219   3e-66   
ref|XP_007152862.1|  hypothetical protein PHAVU_004G166400g             219   3e-66   
ref|XP_004982376.1|  PREDICTED: auxin-responsive protein IAA30-li...    217   3e-66   
gb|AAM12952.1|  auxin-regulated protein                                 219   4e-66   
ref|XP_010098105.1|  Auxin-responsive protein IAA27                     219   4e-66   
ref|XP_010275506.1|  PREDICTED: auxin-responsive protein IAA9 iso...    221   5e-66   
emb|CAD10639.1|  IAA9 protein                                           219   5e-66   
ref|XP_010275505.1|  PREDICTED: auxin-responsive protein IAA9 iso...    221   7e-66   
ref|XP_010275504.1|  PREDICTED: auxin-responsive protein IAA9 iso...    221   7e-66   
ref|XP_002514266.1|  Auxin-responsive protein IAA27, putative           217   8e-66   
ref|XP_007160318.1|  hypothetical protein PHAVU_002G311500g             217   9e-66   
ref|XP_009344514.1|  PREDICTED: auxin-responsive protein IAA9           219   1e-65   
gb|KDO56957.1|  hypothetical protein CISIN_1g019236mg                   218   1e-65   
gb|ADL36578.1|  ARF domain class transcription factor                   219   1e-65   
gb|ABM53871.1|  IAA3                                                    212   1e-65   
ref|XP_006465643.1|  PREDICTED: auxin-responsive protein IAA8-lik...    218   1e-65   
ref|XP_007024229.1|  Phytochrome-associated protein 2 isoform 2         218   1e-65   
ref|XP_008455992.1|  PREDICTED: auxin-responsive protein IAA16 is...    214   1e-65   
ref|NP_001240013.1|  uncharacterized protein LOC100804423               217   1e-65   
ref|XP_003612933.1|  Auxin-responsive protein (Aux/IAA)                 218   1e-65   
ref|XP_011073641.1|  PREDICTED: auxin-responsive protein IAA9-like      218   2e-65   
ref|XP_008462746.1|  PREDICTED: auxin-responsive protein IAA27          217   2e-65   
ref|XP_006426926.1|  hypothetical protein CICLE_v10025988mg             218   2e-65   
gb|EPS60474.1|  hypothetical protein M569_14329                         213   2e-65   
ref|XP_009352507.1|  PREDICTED: auxin-responsive protein IAA27-like     217   2e-65   
ref|NP_194637.1|  phytochrome-associated protein 2                      216   2e-65   
ref|XP_009381047.1|  PREDICTED: auxin-responsive protein IAA17-like     216   3e-65   
ref|XP_010254653.1|  PREDICTED: auxin-responsive protein IAA9-like      219   3e-65   
ref|XP_002867425.1|  phytochrome-associated protein 2                   216   3e-65   
gb|KHG13564.1|  Auxin-responsive IAA9 -like protein                     218   3e-65   
ref|XP_003534212.1|  PREDICTED: auxin-responsive protein IAA27          216   4e-65   
ref|XP_002516003.1|  Auxin-responsive protein IAA27, putative           218   4e-65   
ref|XP_010924571.1|  PREDICTED: auxin-responsive protein IAA27-like     216   5e-65   
ref|XP_006664171.1|  PREDICTED: auxin-responsive protein IAA30-like     214   5e-65   
gb|KJB64027.1|  hypothetical protein B456_010G031600                    217   5e-65   
ref|XP_007150643.1|  hypothetical protein PHAVU_005G169600g             216   6e-65   
gb|KJB38279.1|  hypothetical protein B456_006G246000                    212   6e-65   
gb|ABY48132.1|  GH1 protein                                             216   7e-65   
gb|KFK29453.1|  hypothetical protein AALP_AA7G136400                    215   7e-65   
ref|XP_010526458.1|  PREDICTED: auxin-responsive protein IAA27          215   7e-65   
gb|AEI70507.1|  auxin-responsive protein                                216   8e-65   
ref|NP_001280937.1|  auxin-responsive protein IAA27                     215   8e-65   
ref|XP_009793769.1|  PREDICTED: auxin-responsive protein IAA27-like     214   8e-65   
ref|XP_006433732.1|  hypothetical protein CICLE_v10001479mg             217   9e-65   
ref|XP_009336858.1|  PREDICTED: auxin-responsive protein IAA27-like     215   9e-65   
ref|XP_007013107.1|  Phytochrome-associated protein 2 isoform 2         215   1e-64   
ref|XP_007158315.1|  hypothetical protein PHAVU_002G142500g             216   1e-64   
gb|AGV54485.1|  auxin-responsive protein                                216   1e-64   
gb|KHN16618.1|  Auxin-responsive protein IAA27                          214   1e-64   
dbj|BAJ97201.1|  predicted protein                                      212   1e-64   
ref|XP_008228477.1|  PREDICTED: auxin-responsive protein IAA27-like     215   2e-64   
gb|KJB18637.1|  hypothetical protein B456_003G064200                    215   2e-64   
ref|XP_002303297.1|  auxin-responsive protein IAA27                     215   2e-64   
emb|CDP02673.1|  unnamed protein product                                216   2e-64   
gb|KDP41528.1|  hypothetical protein JCGZ_15935                         216   3e-64   
gb|KHN09036.1|  Auxin-responsive protein IAA8                           215   3e-64   
ref|XP_003544843.1|  PREDICTED: auxin-responsive protein IAA9           215   4e-64   
gb|ADL70670.1|  indole-3-acetic acid inducible 16                       208   4e-64   
gb|AAV50046.1|  auxin-induced protein                                   209   4e-64   
ref|XP_004512542.1|  PREDICTED: auxin-responsive protein IAA8-like      214   5e-64   
ref|XP_006284170.1|  hypothetical protein CARUB_v10005309mg             213   5e-64   
gb|ABW24025.1|  aux/IAA protein                                         207   6e-64   
ref|XP_008793077.1|  PREDICTED: auxin-responsive protein IAA27-li...    213   6e-64   
ref|XP_002302351.1|  auxin-responsive family protein                    214   7e-64   
ref|XP_011016963.1|  PREDICTED: auxin-responsive protein IAA9-like      214   7e-64   
ref|XP_010447892.1|  PREDICTED: auxin-responsive protein IAA27          213   7e-64   
ref|XP_004287443.1|  PREDICTED: auxin-responsive protein IAA27          213   7e-64   
emb|CAC84706.1|  aux/IAA protein                                        214   7e-64   
dbj|BAJ33683.1|  unnamed protein product                                213   7e-64   
gb|AFZ78618.1|  hypothetical protein                                    214   7e-64   
ref|NP_001241389.1|  uncharacterized protein LOC100783314               214   7e-64   
ref|XP_010433139.1|  PREDICTED: auxin-responsive protein IAA27-like     213   8e-64   
ref|XP_004288310.1|  PREDICTED: auxin-responsive protein IAA9           214   8e-64   
ref|XP_006584572.1|  PREDICTED: uncharacterized protein LOC100795...    214   8e-64   
ref|NP_001239808.1|  uncharacterized protein LOC100778529               212   8e-64   
ref|XP_003519213.1|  PREDICTED: auxin-responsive protein IAA9-like      214   8e-64   
ref|XP_011010527.1|  PREDICTED: auxin-responsive protein IAA27-li...    213   1e-63   
ref|XP_011099452.1|  PREDICTED: auxin-responsive protein IAA9-like      214   1e-63   
gb|KHN08222.1|  Auxin-responsive protein IAA8                           213   1e-63   
ref|XP_010023411.1|  PREDICTED: auxin-responsive protein IAA9 iso...    214   1e-63   
ref|XP_009406220.1|  PREDICTED: auxin-responsive protein IAA21-like     211   1e-63   
ref|XP_007018336.1|  Aux/IAA protein isoform 1                          214   2e-63   
gb|ACJ84768.1|  unknown                                                 208   2e-63   
gb|ADL70680.1|  indole-3-acetic acid inducible 16                       206   2e-63   
ref|XP_009617338.1|  PREDICTED: auxin-responsive protein IAA27-like     211   2e-63   
ref|XP_009366395.1|  PREDICTED: auxin-responsive protein IAA8-like      213   2e-63   
gb|KHN41649.1|  Auxin-responsive protein IAA27                          211   2e-63   
gb|KHN04889.1|  Auxin-responsive protein IAA8                           211   2e-63   
ref|XP_006451212.1|  hypothetical protein CICLE_v10009070mg             211   2e-63   
ref|XP_008789309.1|  PREDICTED: auxin-responsive protein IAA27-like     211   2e-63   
ref|XP_006412880.1|  hypothetical protein EUTSA_v10025542mg             213   2e-63   
gb|ADB93631.2|  indole-3-acetic acid inducible 16                       206   2e-63   
ref|NP_974355.1|  auxin-responsive protein IAA7                         207   3e-63   
ref|XP_007156440.1|  hypothetical protein PHAVU_003G286200g             212   3e-63   
ref|XP_010438351.1|  PREDICTED: auxin-responsive protein IAA27-like     211   4e-63   
ref|NP_001280795.1|  auxin-responsive protein IAA8-like                 212   4e-63   
gb|ABR16302.1|  unknown                                                 211   5e-63   
gb|AAB70005.1|  GH1 protein                                             211   5e-63   
emb|CBI19314.3|  unnamed protein product                                211   5e-63   
ref|XP_004302884.1|  PREDICTED: auxin-responsive protein IAA27-like     211   5e-63   
ref|XP_008339000.1|  PREDICTED: auxin-responsive protein IAA8-lik...    212   5e-63   
ref|XP_008242568.1|  PREDICTED: auxin-responsive protein IAA27          211   5e-63   
ref|XP_008378626.1|  PREDICTED: auxin-responsive protein IAA8-like      212   5e-63   
ref|XP_003517136.1|  PREDICTED: auxin-responsive protein IAA9 iso...    212   6e-63   
gb|KDP32156.1|  hypothetical protein JCGZ_12617                         212   7e-63   
gb|ABI36491.1|  AUX/IAA8A                                               205   7e-63   
gb|KJB58781.1|  hypothetical protein B456_009G226000                    212   8e-63   
ref|XP_006426197.1|  hypothetical protein CICLE_v10025873mg             212   8e-63   
ref|XP_006394000.1|  hypothetical protein EUTSA_v10004532mg             211   9e-63   
ref|XP_006472387.1|  PREDICTED: auxin-responsive protein IAA9-lik...    211   9e-63   
ref|XP_006466369.1|  PREDICTED: auxin-responsive protein IAA9-like      212   9e-63   
ref|NP_001268170.1|  Aux/IAA protein                                    211   9e-63   
ref|XP_007225724.1|  hypothetical protein PRUPE_ppa006744mg             211   9e-63   
gb|EYU41350.1|  hypothetical protein MIMGU_mgv1a009380mg                211   9e-63   
ref|XP_009786555.1|  PREDICTED: auxin-responsive protein IAA27-like     208   9e-63   
ref|XP_003543635.1|  PREDICTED: auxin-responsive protein IAA27-like     210   9e-63   
ref|XP_010917562.1|  PREDICTED: auxin-responsive protein IAA27-like     210   9e-63   
emb|CDP00957.1|  unnamed protein product                                211   9e-63   
gb|KJB58777.1|  hypothetical protein B456_009G226000                    211   9e-63   
ref|XP_010664066.1|  PREDICTED: aux/IAA protein isoform X1              211   1e-62   
ref|XP_004141756.1|  PREDICTED: auxin-responsive protein IAA8-like      211   1e-62   
gb|AAL92850.1|  Aux/IAA protein                                         211   1e-62   
ref|XP_009416499.1|  PREDICTED: auxin-responsive protein IAA21-like     208   1e-62   
gb|KHN46011.1|  Auxin-responsive protein IAA9                           211   1e-62   
gb|KJB44871.1|  hypothetical protein B456_007G276900                    204   1e-62   
gb|AFK38538.1|  unknown                                                 210   1e-62   
ref|XP_008219180.1|  PREDICTED: auxin-responsive protein IAA8-like      211   1e-62   
ref|XP_009129008.1|  PREDICTED: auxin-responsive protein IAA27          209   1e-62   
ref|XP_007137671.1|  hypothetical protein PHAVU_009G146000g             211   2e-62   
ref|XP_007225727.1|  hypothetical protein PRUPE_ppa006744mg             212   2e-62   
gb|AFK41338.1|  unknown                                                 205   2e-62   
gb|ACJ84551.1|  unknown                                                 210   2e-62   
emb|CDP03299.1|  unnamed protein product                                209   2e-62   
ref|XP_010521483.1|  PREDICTED: auxin-responsive protein IAA27-li...    206   3e-62   
emb|CDY06836.1|  BnaC01g09350D                                          207   3e-62   
gb|KHN32629.1|  Auxin-responsive protein IAA27                          208   3e-62   
ref|XP_004490496.1|  PREDICTED: auxin-responsive protein IAA9-like      210   3e-62   
ref|XP_003628839.1|  Indoleacetic acid-induced-like protein             209   3e-62   
gb|KDP37265.1|  hypothetical protein JCGZ_06321                         209   4e-62   
ref|XP_007047689.1|  Transcription factor, putative isoform 3           209   4e-62   
ref|XP_009774736.1|  PREDICTED: auxin-responsive protein IAA27-like     207   4e-62   
ref|XP_003534264.1|  PREDICTED: auxin-responsive protein IAA9           209   5e-62   
ref|XP_003597715.1|  Auxin-responsive protein IAA                       208   5e-62   
ref|XP_002464208.1|  hypothetical protein SORBIDRAFT_01g014130          206   5e-62   
ref|NP_001266034.1|  IAA6 protein                                       206   7e-62   
gb|ADL70679.1|  indole-3-acetic acid inducible 16                       202   7e-62   
ref|XP_008462174.1|  PREDICTED: auxin-responsive protein IAA27-like     209   7e-62   
gb|KDO81302.1|  hypothetical protein CISIN_1g017824mg                   209   8e-62   
gb|AFK38170.1|  unknown                                                 208   9e-62   
ref|XP_008348505.1|  PREDICTED: auxin-responsive protein IAA21-li...    207   9e-62   
ref|XP_002528895.1|  transcription factor, putative                     209   9e-62   
ref|XP_009398379.1|  PREDICTED: auxin-responsive protein IAA30-like     205   9e-62   
ref|XP_010683059.1|  PREDICTED: auxin-responsive protein IAA9           208   1e-61   
ref|XP_007047687.1|  Transcription factor, putative isoform 1           209   1e-61   
ref|NP_569017.2|  auxin-responsive protein IAA9                         208   1e-61   
ref|XP_006475665.1|  PREDICTED: auxin-responsive protein IAA27-li...    206   1e-61   
ref|XP_003630761.1|  Auxin-responsive protein (Aux/IAA)                 206   1e-61   
ref|XP_006432922.1|  hypothetical protein CICLE_v10002290mg             204   1e-61   
gb|AFK49596.1|  unknown                                                 206   1e-61   
gb|EYU21477.1|  hypothetical protein MIMGU_mgv1a011145mg                206   1e-61   
ref|XP_007203891.1|  hypothetical protein PRUPE_ppa009134mg             206   2e-61   
ref|XP_004509716.1|  PREDICTED: auxin-responsive protein IAA9-lik...    207   2e-61   
ref|XP_010521482.1|  PREDICTED: auxin-responsive protein IAA8-lik...    207   2e-61   
ref|XP_010521481.1|  PREDICTED: auxin-responsive protein IAA8-lik...    207   2e-61   
gb|KCW69643.1|  hypothetical protein EUGRSUZ_F03050                     207   2e-61   
gb|AFK49626.1|  unknown                                                 207   2e-61   
ref|XP_009377833.1|  PREDICTED: auxin-responsive protein IAA21-like     206   3e-61   
gb|KDP33705.1|  hypothetical protein JCGZ_07276                         205   4e-61   
ref|XP_008342663.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    206   4e-61   
ref|XP_011464769.1|  PREDICTED: auxin-responsive protein IAA8-lik...    206   4e-61   
ref|XP_002298231.1|  hypothetical protein POPTR_0001s18680g             206   4e-61   



>ref|XP_002517023.1| Auxin-responsive protein IAA7, putative [Ricinus communis]
 gb|EEF45186.1| Auxin-responsive protein IAA7, putative [Ricinus communis]
Length=181

 Score =   280 bits (717),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 141/162 (87%), Gaps = 3/162 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKN+MA     N  EEG++ S   FVKV MDGAPYLRKV
Sbjct  23   KDPAKPPAKAQVVGWPPVRSYRKNIMAQK---NTSEEGEKASSAAFVKVCMDGAPYLRKV  79

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LSDALA MFSSFT GNYG QGMIDFMNE KLMDLLNSSEYVPTYEDKDGD
Sbjct  80   DLKMYKSYQELSDALAKMFSSFTMGNYGTQGMIDFMNESKLMDLLNSSEYVPTYEDKDGD  139

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCKS+ 
Sbjct  140  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRT  181



>gb|KDP40274.1| hypothetical protein JCGZ_02272 [Jatropha curcas]
Length=241

 Score =   282 bits (722),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 144/162 (89%), Gaps = 2/162 (1%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKN+MA+ +  NN +EG++     FVKV MDGAPYLRKV
Sbjct  82   KDPAKPPAKAQVVGWPPVRSYRKNIMANQK--NNSDEGEKSLSAAFVKVCMDGAPYLRKV  139

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDGD
Sbjct  140  DLKMYKSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGD  199

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCKS+ 
Sbjct  200  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRT  241



>ref|XP_007034956.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
 gb|EOY05882.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
Length=254

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 147/164 (90%), Gaps = 5/164 (3%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS---GNNFVKVSMDGAPYL  534
            KDP KPPAKAQVVGWPPVRSYRKN+MA+ +  N+ EE D+K+   G  FVKVSMDGAPYL
Sbjct  92   KDPAKPPAKAQVVGWPPVRSYRKNIMANQK--NSCEESDKKASSGGAAFVKVSMDGAPYL  149

Query  533  RKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  354
            RKVDLK+Y +Y +LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLNSS+YVPTYEDK
Sbjct  150  RKVDLKMYKSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSDYVPTYEDK  209

Query  353  DGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DGDWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCKS+
Sbjct  210  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  253



>ref|NP_001266070.1| IAA14 [Solanum lycopersicum]
 gb|AEX00357.1| IAA14 [Solanum lycopersicum]
Length=236

 Score =   280 bits (715),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 144/161 (89%), Gaps = 4/161 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDPIKPPAKAQVVGWPPVRS+RKNVMA  QKSN  E   +K+   FVKV MDGAPYLRKV
Sbjct  79   KDPIKPPAKAQVVGWPPVRSFRKNVMA--QKSNTEES--EKTTAAFVKVCMDGAPYLRKV  134

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LSDALA MFSSFT GNYG+QGMIDFMNE KLMDLLNSSEYVPTYEDKDGD
Sbjct  135  DLKMYKSYQELSDALAKMFSSFTNGNYGSQGMIDFMNESKLMDLLNSSEYVPTYEDKDGD  194

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            WMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCKS+
Sbjct  195  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  235



>ref|XP_003591806.1| Indoleacetic acid-induced-like protein [Medicago truncatula]
 gb|AES62057.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=236

 Score =   280 bits (715),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 145/166 (87%), Gaps = 6/166 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN----FVKVSMDGAPY  537
            KDP KPPAKAQVVGWPPVRSYRKN+MA  QK NN E+ ++ + N     FVKVSMDGAPY
Sbjct  73   KDPAKPPAKAQVVGWPPVRSYRKNMMA--QKVNNTEDTEKTTSNTTAAAFVKVSMDGAPY  130

Query  536  LRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYED  357
            LRKVDL +Y TY  LSDALA MFSSFTTGNYGAQGMIDFMNE KLMDLLNSSEYVPTYED
Sbjct  131  LRKVDLTMYKTYKDLSDALAKMFSSFTTGNYGAQGMIDFMNESKLMDLLNSSEYVPTYED  190

Query  356  KDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            KDGDWMLVGDVPWEMFV SCKRLRI+KGSEAIGLAPR MEKCK+++
Sbjct  191  KDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKNRS  236



>emb|CBI26357.3| unnamed protein product [Vitis vinifera]
Length=237

 Score =   280 bits (715),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 141/161 (88%), Gaps = 2/161 (1%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRS+RKN+MA    S  GE+G   SG  FVKV MDGAPYLRKV
Sbjct  78   KDPAKPPAKAQVVGWPPVRSFRKNIMAQKNSSEEGEKGS--SGAAFVKVCMDGAPYLRKV  135

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LSDAL  MFSSFT GNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDGD
Sbjct  136  DLKMYKSYQELSDALGKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGD  195

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            WMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCK++
Sbjct  196  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNR  236



>ref|XP_002284133.1| PREDICTED: auxin-responsive protein IAA14 [Vitis vinifera]
Length=243

 Score =   280 bits (715),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 141/161 (88%), Gaps = 2/161 (1%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRS+RKN+MA    S  GE+G   SG  FVKV MDGAPYLRKV
Sbjct  84   KDPAKPPAKAQVVGWPPVRSFRKNIMAQKNSSEEGEKGS--SGAAFVKVCMDGAPYLRKV  141

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LSDAL  MFSSFT GNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDGD
Sbjct  142  DLKMYKSYQELSDALGKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGD  201

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            WMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCK++
Sbjct  202  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNR  242



>emb|CDO99148.1| unnamed protein product [Coffea canephora]
Length=239

 Score =   279 bits (713),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 147/164 (90%), Gaps = 5/164 (3%)
 Frame = -2

Query  704  KDPIKPPA-KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYL  534
            KDP+KPPA KAQVVGWPPVRS+RKN+MA  QKSN  E   +K+G++  FVKVSMDGAPYL
Sbjct  77   KDPVKPPAAKAQVVGWPPVRSFRKNIMA--QKSNTEEAAAEKAGSSAAFVKVSMDGAPYL  134

Query  533  RKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  354
            RKVDLK+Y +Y +LSDALA MFSSFT GNYG QGMIDFMNE KLMDLLNSSEYVPTYEDK
Sbjct  135  RKVDLKMYKSYQELSDALAKMFSSFTMGNYGPQGMIDFMNESKLMDLLNSSEYVPTYEDK  194

Query  353  DGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DGDWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCKS+
Sbjct  195  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  238



>ref|XP_011091113.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=241

 Score =   279 bits (713),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 147/165 (89%), Gaps = 6/165 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN----FVKVSMDGAPY  537
            KDP+KPPAKAQVVGWPPVRS+RKN+MAH + S+  EE ++ + ++    FVKVSMDGAPY
Sbjct  78   KDPVKPPAKAQVVGWPPVRSFRKNIMAHQKSSD--EEAEKAACSSPTAAFVKVSMDGAPY  135

Query  536  LRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYED  357
            LRKVDLK+Y +Y +LSDALA MFSSFT GNYG QGMIDFMNE KLMDLLNSSEYVPTYED
Sbjct  136  LRKVDLKMYKSYQELSDALAKMFSSFTMGNYGTQGMIDFMNESKLMDLLNSSEYVPTYED  195

Query  356  KDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            KDGDWMLVGDVPW+MFVDSCKRLRI+KGSEAIGLAPR MEKCKS+
Sbjct  196  KDGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  240



>ref|XP_006362195.1| PREDICTED: auxin-responsive protein IAA14-like [Solanum tuberosum]
Length=238

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 144/161 (89%), Gaps = 4/161 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDPIKPPAKAQVVGWPPVRS+RKNVMA  QKSN  E   +K+   FVKV MDGAPYLRKV
Sbjct  81   KDPIKPPAKAQVVGWPPVRSFRKNVMA--QKSNTEES--EKTTVAFVKVCMDGAPYLRKV  136

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LSDALA MFSSFT GNYG+QGMIDFMNE KLMDLLNSSEYVPTYEDKDGD
Sbjct  137  DLKMYKSYQELSDALAKMFSSFTNGNYGSQGMIDFMNESKLMDLLNSSEYVPTYEDKDGD  196

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            WMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCKS+
Sbjct  197  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  237



>ref|XP_011030586.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 140/163 (86%), Gaps = 1/163 (1%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK-SGNNFVKVSMDGAPYLRK  528
            KDP KPPAKAQVVGWPPVRSYRKNV+A    S  GE+     S   FVKV MDGAPYLRK
Sbjct  86   KDPAKPPAKAQVVGWPPVRSYRKNVLAQKNASEEGEKASTGGSSAAFVKVCMDGAPYLRK  145

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y +Y +LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDKDG
Sbjct  146  VDLKMYRSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDG  205

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCKS+ 
Sbjct  206  DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRT  248



>ref|XP_004172452.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis sativus]
 gb|KGN61643.1| hypothetical protein Csa_2G200420 [Cucumis sativus]
Length=256

 Score =   279 bits (713),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 145/166 (87%), Gaps = 6/166 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK----SGNNFVKVSMDGAPY  537
            KDP KPPAKAQVVGWPPVRSYRKNVMA  QK+ +G EG +K    S   FVKV MDGAPY
Sbjct  93   KDPAKPPAKAQVVGWPPVRSYRKNVMA--QKNTSGGEGTEKGNGGSSAAFVKVCMDGAPY  150

Query  536  LRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYED  357
            LRKVDLK+Y +Y +LSDALA MFSSFT G YG QGMIDFMNERKLMDLLNSSE+VPTYED
Sbjct  151  LRKVDLKMYQSYQELSDALAKMFSSFTMGEYGTQGMIDFMNERKLMDLLNSSEFVPTYED  210

Query  356  KDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            KDGDWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCKS++
Sbjct  211  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  256



>ref|XP_008465181.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=256

 Score =   278 bits (712),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 145/166 (87%), Gaps = 6/166 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK----SGNNFVKVSMDGAPY  537
            KDP KPPAKAQVVGWPPVRSYRKNVMA  QK+ +G EG +K    S   FVKV MDGAPY
Sbjct  93   KDPAKPPAKAQVVGWPPVRSYRKNVMA--QKNTSGGEGAEKGSSGSSAAFVKVCMDGAPY  150

Query  536  LRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYED  357
            LRKVDLK+Y +Y +LSDALA MFSSFT G YG QGMIDFMNERKLMDLLNSSE+VPTYED
Sbjct  151  LRKVDLKMYQSYQELSDALAKMFSSFTMGEYGTQGMIDFMNERKLMDLLNSSEFVPTYED  210

Query  356  KDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            KDGDWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCKS++
Sbjct  211  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  256



>ref|XP_004495392.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Cicer 
arietinum]
Length=240

 Score =   277 bits (709),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 147/168 (88%), Gaps = 8/168 (5%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEE-GDQKS-----GNNFVKVSMDGA  543
            KDP KPPAKAQVVGWPPVRSYRKN+MA  QK NN ++ G++K+        FVKVSMDGA
Sbjct  75   KDPAKPPAKAQVVGWPPVRSYRKNMMA--QKVNNSDQDGNEKTTSSTTAGTFVKVSMDGA  132

Query  542  PYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTY  363
            PYLRKVDL +YNTY  LSDALA MFSSFTTG YGAQGMIDFMNE KLMDLLNSSEYVPTY
Sbjct  133  PYLRKVDLTMYNTYKDLSDALAKMFSSFTTGKYGAQGMIDFMNESKLMDLLNSSEYVPTY  192

Query  362  EDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            EDKDGDWMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR MEKCK+++
Sbjct  193  EDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  240



>ref|XP_002311658.1| aux/IAA family protein [Populus trichocarpa]
 gb|ABK95711.1| unknown [Populus trichocarpa]
 gb|EEE89025.1| aux/IAA family protein [Populus trichocarpa]
Length=248

 Score =   277 bits (709),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 140/163 (86%), Gaps = 1/163 (1%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK-SGNNFVKVSMDGAPYLRK  528
            KDP KPPAKAQVVGWPPVRSYRKNVMA    S  GE+     S   FVKV MDGAPYLRK
Sbjct  86   KDPAKPPAKAQVVGWPPVRSYRKNVMAQKNASEEGEKASTGGSSAAFVKVCMDGAPYLRK  145

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y +Y +LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDKDG
Sbjct  146  VDLKMYRSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDG  205

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR MEKCKS+ 
Sbjct  206  DWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAMEKCKSRT  248



>ref|XP_009776553.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=244

 Score =   277 bits (708),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 142/166 (86%), Gaps = 4/166 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSG----NNFVKVSMDGAPY  537
            KD  KPPAK QVVGWPPVRSYRKN+MA    S   E  + K G      FVKVSMDGAPY
Sbjct  79   KDSAKPPAKTQVVGWPPVRSYRKNIMAQKGGSICEESENSKGGICSSAAFVKVSMDGAPY  138

Query  536  LRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYED  357
            LRKVDLK+Y +Y QLSDALANMFSSFT GNYGAQGMIDFMNERKLMDLLNSS+YVPTYED
Sbjct  139  LRKVDLKMYKSYQQLSDALANMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSDYVPTYED  198

Query  356  KDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            KDGDWMLVGDVPW+MFVDSCKRLRI+KGSEAIGLAPR MEKCKS+N
Sbjct  199  KDGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRN  244



>ref|XP_009611797.1| PREDICTED: auxin-responsive protein IAA14 [Nicotiana tomentosiformis]
Length=243

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 144/165 (87%), Gaps = 3/165 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN---FVKVSMDGAPYL  534
            KD  KPPAKAQVVGWPPVRS+RKN+MA    S   E  + K G++   FVKVSMDGAPYL
Sbjct  79   KDSAKPPAKAQVVGWPPVRSFRKNIMAQKGSSICEESENSKGGSSSAAFVKVSMDGAPYL  138

Query  533  RKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  354
            RKVDLK+Y +Y QLSDALA MFSSFT GNYGAQGMIDFMNERKLMDLLNSS+YVPTYEDK
Sbjct  139  RKVDLKMYKSYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSDYVPTYEDK  198

Query  353  DGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DGDWMLVGDVPW+MFVDSCKRLRI+KGSEAIGLAPR MEKCKS++
Sbjct  199  DGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  243



>ref|XP_009591035.1| PREDICTED: auxin-responsive protein IAA7-like [Nicotiana tomentosiformis]
Length=225

 Score =   276 bits (705),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 141/163 (87%), Gaps = 5/163 (3%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLR  531
            KD +KPPAKAQVVGWPPVRS+RKNVMA     NN EE ++ S     FVKV MDGAPYLR
Sbjct  65   KDSVKPPAKAQVVGWPPVRSFRKNVMAQK---NNTEETEKSSATAVAFVKVCMDGAPYLR  121

Query  530  KVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD  351
            KVDLK+Y +Y QLSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDKD
Sbjct  122  KVDLKMYKSYQQLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKD  181

Query  350  GDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            GDWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCK +
Sbjct  182  GDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKRR  224



>ref|XP_011027555.1| PREDICTED: auxin-responsive protein IAA14 isoform X2 [Populus 
euphratica]
 ref|XP_011029891.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 140/163 (86%), Gaps = 1/163 (1%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK-SGNNFVKVSMDGAPYLRK  528
            KDP KPPAKAQVVGWPPVRSYRKNVMA    S  GE+     S   FVKV MDGAPYLRK
Sbjct  86   KDPAKPPAKAQVVGWPPVRSYRKNVMAQKNASEEGEKASTGGSSAAFVKVCMDGAPYLRK  145

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y +Y +LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDKDG
Sbjct  146  VDLKMYRSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDG  205

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPWEMFV+SCKRLR++KGSEAIGLAPR MEKCKS+ 
Sbjct  206  DWMLVGDVPWEMFVNSCKRLRLMKGSEAIGLAPRAMEKCKSRT  248



>gb|AFZ78617.1| hypothetical protein [Populus tomentosa]
Length=248

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 140/163 (86%), Gaps = 1/163 (1%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK-SGNNFVKVSMDGAPYLRK  528
            KDP KPPAKAQVVGWPPVRSYRKNVMA    S  GE+     S   FVKV MDGAPYLRK
Sbjct  86   KDPAKPPAKAQVVGWPPVRSYRKNVMAQKNASEEGEKTSTGGSSAAFVKVCMDGAPYLRK  145

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y +Y +LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDKDG
Sbjct  146  VDLKMYRSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDG  205

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR MEKCKS+ 
Sbjct  206  DWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAMEKCKSRT  248



>gb|AFK37379.1| unknown [Medicago truncatula]
Length=236

 Score =   276 bits (705),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 144/166 (87%), Gaps = 6/166 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN----FVKVSMDGAPY  537
            KDP KPPAKAQVVGWPPVRSY+KN+MA  QK NN E+ ++ + N     FVKVSMDGAPY
Sbjct  73   KDPAKPPAKAQVVGWPPVRSYKKNMMA--QKVNNTEDTEKTTSNTTAAVFVKVSMDGAPY  130

Query  536  LRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYED  357
            LRKVDL +Y TY  LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLNSSEYVPTYED
Sbjct  131  LRKVDLTMYKTYKDLSDALAKMFSSFTIGNYGAQGMIDFMNESKLMDLLNSSEYVPTYED  190

Query  356  KDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            KDGDWMLVGDVPWEMFV SCKRLRI+KGSEAIGLAPR MEKCK+++
Sbjct  191  KDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKNRS  236



>gb|AEE25653.1| auxin-responsive protein [Gossypium hirsutum]
Length=249

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 145/161 (90%), Gaps = 3/161 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKN+MA+ QK+++ E G+  SG   VKVSMDGAPYLRKV
Sbjct  91   KDPAKPPAKAQVVGWPPVRSYRKNIMAN-QKNSSEESGN--SGAALVKVSMDGAPYLRKV  147

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LSDALA MFSSFT GNYG QGMIDFMNE KLMDLLNSS+YVP+YEDKDGD
Sbjct  148  DLKMYKSYQELSDALAKMFSSFTMGNYGPQGMIDFMNESKLMDLLNSSDYVPSYEDKDGD  207

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            WMLVGDVPW+MFVDSCKRLRI+KGSEAIGLAPR MEKCKS+
Sbjct  208  WMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  248



>ref|XP_011030585.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 140/165 (85%), Gaps = 3/165 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK-SGNNFVKVSMDGAPYLRK  528
            KDP KPPAKAQVVGWPPVRSYRKNV+A    S  GE+     S   FVKV MDGAPYLRK
Sbjct  86   KDPAKPPAKAQVVGWPPVRSYRKNVLAQKNASEEGEKASTGGSSAAFVKVCMDGAPYLRK  145

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y +Y +LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDKDG
Sbjct  146  VDLKMYRSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDG  205

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGL--APRVMEKCKSKN  219
            DWMLVGDVPWEMFVDSCKRLRI+KGSEAIGL  APR MEKCKS+ 
Sbjct  206  DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLVSAPRAMEKCKSRT  250



>gb|AFK44393.1| unknown [Lotus japonicus]
Length=242

 Score =   273 bits (699),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 144/167 (86%), Gaps = 7/167 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS-----GNNFVKVSMDGAP  540
            KDP KPPAKAQVVGWPPVRSYRKN+M   QK NN ++G +K+     G  F KVSMDGAP
Sbjct  78   KDPAKPPAKAQVVGWPPVRSYRKNMMV--QKVNNEDQGTEKTTSSTAGGAFAKVSMDGAP  135

Query  539  YLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYE  360
            YLRKVDL +Y +Y +LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLNSSEYVPTYE
Sbjct  136  YLRKVDLTMYKSYKELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYE  195

Query  359  DKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DKDGDWMLVGDVPWEMFV SCKRLRI+KGSEAIGLAPR MEKCK+++
Sbjct  196  DKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKNRS  242



>gb|KJB38278.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=294

 Score =   275 bits (704),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 145/161 (90%), Gaps = 3/161 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKN+MA+ QK+++ E G+  SG   VKVSMDGAPYLRKV
Sbjct  136  KDPAKPPAKAQVVGWPPVRSYRKNIMAN-QKNSSEESGN--SGAALVKVSMDGAPYLRKV  192

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LSDALA MFSSFT GNYG QGMIDFMNE KLMDLLNSS+YVP+YEDKDGD
Sbjct  193  DLKMYKSYQELSDALAKMFSSFTMGNYGPQGMIDFMNESKLMDLLNSSDYVPSYEDKDGD  252

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            WMLVGDVPW+MFVDSCKRLRI+KGSEAIGLAPR MEKCKS+
Sbjct  253  WMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  293



>gb|KJB38280.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=249

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 145/161 (90%), Gaps = 3/161 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKN+MA+ QK+++ E G+  SG   VKVSMDGAPYLRKV
Sbjct  91   KDPAKPPAKAQVVGWPPVRSYRKNIMAN-QKNSSEESGN--SGAALVKVSMDGAPYLRKV  147

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LSDALA MFSSFT GNYG QGMIDFMNE KLMDLLNSS+YVP+YEDKDGD
Sbjct  148  DLKMYKSYQELSDALAKMFSSFTMGNYGPQGMIDFMNESKLMDLLNSSDYVPSYEDKDGD  207

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            WMLVGDVPW+MFVDSCKRLRI+KGSEAIGLAPR MEKCKS+
Sbjct  208  WMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  248



>ref|XP_007143877.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
 gb|ESW15871.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
Length=244

 Score =   273 bits (699),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 140/164 (85%), Gaps = 2/164 (1%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLR  531
            KDP K PAKAQVVGWPPVRSYRKN+M     + +G E    S  +  FVKVSMDGAPYLR
Sbjct  81   KDPTKQPAKAQVVGWPPVRSYRKNMMTQKVSTEDGAEKTTSSTASGAFVKVSMDGAPYLR  140

Query  530  KVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD  351
            KVDL +Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD
Sbjct  141  KVDLTMYKSYKDLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD  200

Query  350  GDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            GDWMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR MEKCKS++
Sbjct  201  GDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKSRS  244



>gb|EYU32514.1| hypothetical protein MIMGU_mgv1a012542mg [Erythranthe guttata]
Length=247

 Score =   273 bits (698),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 143/166 (86%), Gaps = 5/166 (3%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQ-----KSGNNFVKVSMDGAP  540
            KDPIKPPAKAQVVGWPPVRS+RKN+++H + S+  ++ D           FVKVSMDGAP
Sbjct  81   KDPIKPPAKAQVVGWPPVRSFRKNIISHQKSSSPADQQDSDKAAAACSAAFVKVSMDGAP  140

Query  539  YLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYE  360
            YLRKVDLK+Y  Y +LSDALA MFSSFT GNYG++GMIDFMNE KLMDLLNSSEYVPTYE
Sbjct  141  YLRKVDLKMYGAYQELSDALAKMFSSFTMGNYGSEGMIDFMNEGKLMDLLNSSEYVPTYE  200

Query  359  DKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DKDGDWMLVGDVPWEMFVDSCKR+RI+KGSEAIGLAPR MEKCKS+
Sbjct  201  DKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRAMEKCKSR  246



>ref|XP_011073485.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=251

 Score =   273 bits (698),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 143/162 (88%), Gaps = 3/162 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDPIKPPAKAQVVGWPPVRS+RKN M+H QKS+  EE     G  FVKVSMDGAPYLRKV
Sbjct  91   KDPIKPPAKAQVVGWPPVRSFRKNAMSH-QKSDK-EEAACSGGAAFVKVSMDGAPYLRKV  148

Query  524  DLKVYNTYNQLSDALANMFSSFT-TGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            DLK+Y +Y +LSDAL  MFS+FT  GNYG+QGMIDFMNE KLMDLLNSSEYVPTYEDKDG
Sbjct  149  DLKMYKSYQELSDALVKMFSAFTMAGNYGSQGMIDFMNEGKLMDLLNSSEYVPTYEDKDG  208

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCKS+
Sbjct  209  DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  250



>gb|KHN05057.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=245

 Score =   273 bits (697),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 143/166 (86%), Gaps = 4/166 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNN--GEEGDQKSGNN--FVKVSMDGAPY  537
            KDP KPPAKAQVVGWPPVRSYRKN+MA  + S     E+    + N+  FVKVSMDGAPY
Sbjct  80   KDPAKPPAKAQVVGWPPVRSYRKNMMAVQKVSTEDVAEKTTSSTANSGAFVKVSMDGAPY  139

Query  536  LRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYED  357
            LRKVDL +Y +Y +LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLNSSEYVPTYED
Sbjct  140  LRKVDLTMYKSYKELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYED  199

Query  356  KDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            KDGDWMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR MEKCKS++
Sbjct  200  KDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKSRS  245



>gb|KHF98789.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=249

 Score =   272 bits (696),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 145/161 (90%), Gaps = 3/161 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQ+VGWPPVRSYRKN+MA+ QK+++ E G+  SG   VKVSMDGAPYLRKV
Sbjct  91   KDPAKPPAKAQMVGWPPVRSYRKNIMAN-QKNSSEESGN--SGAALVKVSMDGAPYLRKV  147

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LSDALA MFSSFT GNYG QGMIDFMNE KLMDLLNSS+YVP+YEDKDGD
Sbjct  148  DLKMYKSYQELSDALAKMFSSFTMGNYGPQGMIDFMNESKLMDLLNSSDYVPSYEDKDGD  207

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            WMLVGDVPW+MFVDSCKRLRI+KGSEAIGLAPR MEKCKS+
Sbjct  208  WMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  248



>ref|NP_001240213.1| auxin-induced protein ali50 [Glycine max]
 gb|ACR39367.1| Aux/IAA protein [Glycine max]
Length=239

 Score =   272 bits (695),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 144/169 (85%), Gaps = 9/169 (5%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-------FVKVSMDG  546
            KDP KPPAKAQVVGWPPVRSYRKN+MA  + SN  EE  +K+ ++       FVKVSMDG
Sbjct  73   KDPAKPPAKAQVVGWPPVRSYRKNMMAVQKVSN--EEVAEKTTSSTIANSGAFVKVSMDG  130

Query  545  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPT  366
            APYLRKVDL +Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLNSSEYVPT
Sbjct  131  APYLRKVDLTMYKSYKDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPT  190

Query  365  YEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            YEDKDGDWMLVGDVPWEMFV SCKRLRI+KGSEAIGLAPR MEKCKS++
Sbjct  191  YEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKSRS  239



>ref|XP_009777122.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=223

 Score =   271 bits (693),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 138/161 (86%), Gaps = 2/161 (1%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KD +KPPAKAQVVGWPPVRS+RKNVMA  QK+N   E    +   FVKV MDGAPYLRKV
Sbjct  64   KDSVKPPAKAQVVGWPPVRSFRKNVMA--QKNNTEAEKSNATAAAFVKVCMDGAPYLRKV  121

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y QLSDALA MFSSFT GNYG QGMIDFMNE KLMDLLNSSEYVPTYEDKDGD
Sbjct  122  DLKMYKSYQQLSDALAKMFSSFTMGNYGPQGMIDFMNESKLMDLLNSSEYVPTYEDKDGD  181

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            WMLVGDVPW MFVDSCKRLRI+KGSEAIGLAPR MEKCK +
Sbjct  182  WMLVGDVPWVMFVDSCKRLRIMKGSEAIGLAPRAMEKCKRR  222



>ref|XP_004288427.1| PREDICTED: auxin-responsive protein IAA14-like [Fragaria vesca 
subsp. vesca]
Length=238

 Score =   271 bits (693),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 140/162 (86%), Gaps = 2/162 (1%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRS+RKNVMA  QKS   E         FVKV MDGAPYLRKV
Sbjct  79   KDPAKPPAKAQVVGWPPVRSFRKNVMA--QKSTGEESSTTTEKAAFVKVCMDGAPYLRKV  136

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LSDAL+ MFSSFTTG YGAQGMIDFMNE KLMDLLNS+EYVPTYEDKDGD
Sbjct  137  DLKMYKSYKELSDALSKMFSSFTTGYYGAQGMIDFMNESKLMDLLNSTEYVPTYEDKDGD  196

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAP+ MEKCK+++
Sbjct  197  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPKAMEKCKNRS  238



>ref|XP_011027545.1| PREDICTED: auxin-responsive protein IAA14 isoform X1 [Populus 
euphratica]
 ref|XP_011029890.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score =   271 bits (694),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 140/165 (85%), Gaps = 3/165 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK-SGNNFVKVSMDGAPYLRK  528
            KDP KPPAKAQVVGWPPVRSYRKNVMA    S  GE+     S   FVKV MDGAPYLRK
Sbjct  86   KDPAKPPAKAQVVGWPPVRSYRKNVMAQKNASEEGEKASTGGSSAAFVKVCMDGAPYLRK  145

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y +Y +LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDKDG
Sbjct  146  VDLKMYRSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDG  205

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGL--APRVMEKCKSKN  219
            DWMLVGDVPWEMFV+SCKRLR++KGSEAIGL  APR MEKCKS+ 
Sbjct  206  DWMLVGDVPWEMFVNSCKRLRLMKGSEAIGLVSAPRAMEKCKSRT  250



>ref|XP_006298251.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
 gb|EOA31149.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
Length=285

 Score =   272 bits (696),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 141/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVR+YRKN+M   + S   E   +K+G   VKVSMDGAPYLRKV
Sbjct  123  KDPAKPPAKAQVVGWPPVRNYRKNIMTQQKTSGTEEASSEKAGAGLVKVSMDGAPYLRKV  182

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLM+LLNSSEYVP+YEDKDGD
Sbjct  183  DLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGD  242

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEK-CKSKN  219
            WMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR MEK CK+++
Sbjct  243  WMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  285



>gb|KFK24541.1| hypothetical protein AALP_AAs58011U000100 [Arabis alpina]
Length=230

 Score =   270 bits (691),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 142/165 (86%), Gaps = 3/165 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN---FVKVSMDGAPYL  534
            KDP KPPAKAQVVGWPPVR+YRKN+MA+ + S   EE     G     FVKVSMDGAPYL
Sbjct  66   KDPSKPPAKAQVVGWPPVRNYRKNIMANQKSSEEAEEAMSGGGGGTVAFVKVSMDGAPYL  125

Query  533  RKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  354
            RKVDLK+YN+Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLNSSEYVP+YEDK
Sbjct  126  RKVDLKMYNSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNETKVMDLLNSSEYVPSYEDK  185

Query  353  DGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DGDWMLVGDVPW MFV+SCKRLRI+KGSEAIGLAPR MEKCK+++
Sbjct  186  DGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  230



>ref|XP_010024036.1| PREDICTED: auxin-responsive protein IAA14-like [Eucalyptus grandis]
 gb|KCW60450.1| hypothetical protein EUGRSUZ_H03170 [Eucalyptus grandis]
Length=243

 Score =   271 bits (692),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKN+M   + ++  EE ++ +   FVKVSMDGAPYLRKV
Sbjct  82   KDPAKPPAKAQVVGWPPVRSYRKNMMVAQKSTDPEEEKEKAAAAAFVKVSMDGAPYLRKV  141

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK Y++Y QLSDAL  MFSSFT G+YGAQGMIDFMNE KLMDLLNSS+YVPTYEDKDGD
Sbjct  142  DLKNYSSYKQLSDALGKMFSSFTMGSYGAQGMIDFMNESKLMDLLNSSDYVPTYEDKDGD  201

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCKS++
Sbjct  202  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  243



>ref|XP_007223810.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
 gb|EMJ25009.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
Length=239

 Score =   270 bits (691),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKN+MA    S    E        FVKV MDGAPYLRKV
Sbjct  78   KDPAKPPAKAQVVGWPPVRSYRKNIMAQKSSSEESTEKGSGCSAAFVKVCMDGAPYLRKV  137

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LS++LA MFSSFT G YGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDGD
Sbjct  138  DLKMYKSYQELSNSLAKMFSSFTMGYYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGD  197

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCK+++
Sbjct  198  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  239



>gb|AFS44507.1| auxin repressor, partial [Fragaria x ananassa]
Length=231

 Score =   270 bits (689),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 139/162 (86%), Gaps = 2/162 (1%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKNVMA  QKS   E         FVKV MDGAPYLRKV
Sbjct  72   KDPAKPPAKAQVVGWPPVRSYRKNVMA--QKSTGEESSTTTEKAAFVKVCMDGAPYLRKV  129

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LSDAL+ MFSSFTTG YG QGMIDFMNE KLMDLLNS++YVPTYEDKDGD
Sbjct  130  DLKMYKSYKELSDALSKMFSSFTTGYYGTQGMIDFMNESKLMDLLNSTDYVPTYEDKDGD  189

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAP+ MEKCK+++
Sbjct  190  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPKAMEKCKNRS  231



>gb|KJB28413.1| hypothetical protein B456_005G046500 [Gossypium raimondii]
Length=248

 Score =   270 bits (689),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 144/163 (88%), Gaps = 5/163 (3%)
 Frame = -2

Query  698  PIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS----GNNFVKVSMDGAPYLR  531
            P KPPAKAQV+GWPPVRSYRKN+MA+ QK+N+ E  D+ S    G  FVKV MDGAPYLR
Sbjct  86   PAKPPAKAQVLGWPPVRSYRKNIMAN-QKNNSDEISDRASSGSGGAAFVKVCMDGAPYLR  144

Query  530  KVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD  351
            KVDLK+YN+Y +LSDALA MFSSFT G+YG +GMIDFMNE KLMDLLNSS+YVPTYEDKD
Sbjct  145  KVDLKMYNSYQKLSDALAKMFSSFTMGSYGCEGMIDFMNESKLMDLLNSSDYVPTYEDKD  204

Query  350  GDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            GDWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCKS+
Sbjct  205  GDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  247



>gb|ADJ68049.1| auxin responsive protein [Catharanthus roseus]
Length=242

 Score =   269 bits (687),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 145/168 (86%), Gaps = 9/168 (5%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN------FVKVSMDGA  543
            KDP+KPPAKAQVVGWPPVR++RKN+MA  QK+N   E  +K  ++      FVKVSMDGA
Sbjct  76   KDPVKPPAKAQVVGWPPVRAFRKNIMA--QKNNTEVEAGEKGSSSSSSSVAFVKVSMDGA  133

Query  542  PYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQ-GMIDFMNERKLMDLLNSSEYVPT  366
            PYLRKVDLK+Y +Y +L+DALA MFSSFT GNYG Q GMIDFMNE KLMDLLNSSEYVPT
Sbjct  134  PYLRKVDLKIYKSYQELADALAKMFSSFTMGNYGTQQGMIDFMNESKLMDLLNSSEYVPT  193

Query  365  YEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            YEDKDGDWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCKS+
Sbjct  194  YEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  241



>ref|XP_010435110.1| PREDICTED: auxin-responsive protein IAA14 [Camelina sativa]
Length=228

 Score =   268 bits (685),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 141/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN-NFVKVSMDGAPYLRK  528
            KDP KPPAKAQVVGWPPVR+YRKNVMA+H+     E      G   FVKVSMDGAPYLRK
Sbjct  66   KDPAKPPAKAQVVGWPPVRNYRKNVMANHKNGEPDEAMSSAGGTVAFVKVSMDGAPYLRK  125

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+YN+Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLNSSEYVP+YEDKDG
Sbjct  126  VDLKMYNSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKDG  185

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPW MFV+SCKRLRI+KGSEA+GLAPR MEKCK+++
Sbjct  186  DWMLVGDVPWPMFVESCKRLRIMKGSEAVGLAPRAMEKCKNRS  228



>ref|XP_002315736.1| aux/IAA family protein [Populus trichocarpa]
 gb|EEF01907.1| aux/IAA family protein [Populus trichocarpa]
Length=277

 Score =   270 bits (689),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 143/191 (75%), Gaps = 29/191 (15%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNG-------------------------  600
            KDP KPPAKAQVVGWPPVRSYRKNV+A    S  G                         
Sbjct  87   KDPAKPPAKAQVVGWPPVRSYRKNVLAQKNASEEGFRAQVVGWPPLRSYRKNVLTQKNAS  146

Query  599  EEGDQKSGNN----FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQG  432
            EEGD+ S       FVKV MDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT GNYGAQG
Sbjct  147  EEGDKASTGGSSAAFVKVCMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGAQG  206

Query  431  MIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLA  252
            MIDFMNE KLMDLLNSSEYVP+YEDKDGDWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLA
Sbjct  207  MIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA  266

Query  251  PRVMEKCKSKN  219
            PR MEKCKS+ 
Sbjct  267  PRAMEKCKSRT  277



>ref|XP_003556389.2| PREDICTED: auxin-responsive protein IAA14-like [Glycine max]
Length=331

 Score =   271 bits (694),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 142/166 (86%), Gaps = 4/166 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNN--GEEGDQKSGN--NFVKVSMDGAPY  537
            KDP KPPAKAQVVGWPPVRSYRKN+MA  + S     E+    + N   FVKVSMDGAPY
Sbjct  166  KDPAKPPAKAQVVGWPPVRSYRKNMMAVQKVSTEDVAEKTTSSTANPGAFVKVSMDGAPY  225

Query  536  LRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYED  357
            LRKVDL +Y +Y +LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLNSSEYVP+YED
Sbjct  226  LRKVDLTMYKSYKELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYED  285

Query  356  KDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            KDGDWMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR MEKCKS++
Sbjct  286  KDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKSRS  331



>gb|KHG01271.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=248

 Score =   268 bits (685),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 144/163 (88%), Gaps = 5/163 (3%)
 Frame = -2

Query  698  PIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS----GNNFVKVSMDGAPYLR  531
            P KPPAKAQV+GWPPVRSYRKN+MA+ QK+N+ E  D+ S    G  FVKV MDGAPYLR
Sbjct  86   PAKPPAKAQVLGWPPVRSYRKNIMAN-QKNNSDEISDRASSGSGGAAFVKVCMDGAPYLR  144

Query  530  KVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD  351
            KVDLK+YN+Y +LSDALA MFSSFT G+YG +GMIDFMNE KLMDLLNSS+YVPTYEDKD
Sbjct  145  KVDLKMYNSYQKLSDALAKMFSSFTMGSYGCEGMIDFMNESKLMDLLNSSDYVPTYEDKD  204

Query  350  GDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            GDWMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR MEKCKS+
Sbjct  205  GDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKSR  247



>ref|XP_010552451.1| PREDICTED: auxin-responsive protein IAA14-like [Tarenaya hassleriana]
Length=235

 Score =   267 bits (682),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 143/162 (88%), Gaps = 3/162 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KD  KPPAKAQVVGWPPVR+YRKN+MAH + S   E   +K+   FVKVSMDGAPYLRKV
Sbjct  77   KDHAKPPAKAQVVGWPPVRNYRKNMMAHQKSSAVEE---EKAAAAFVKVSMDGAPYLRKV  133

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDGD
Sbjct  134  DLKMYKSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGD  193

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPW+MFVDSCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  194  WMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  235



>ref|XP_006414696.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
 gb|ESQ56149.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
Length=257

 Score =   268 bits (684),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 143/167 (86%), Gaps = 6/167 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-----FVKVSMDGAP  540
            KDP KPPAKAQVVGWPPVR+YRK+VMAH QKS+  EE     G       FVKVSMDGAP
Sbjct  92   KDPAKPPAKAQVVGWPPVRNYRKSVMAH-QKSSEVEEASSCGGGRGGTVAFVKVSMDGAP  150

Query  539  YLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYE  360
            YLRKVDLK+Y +Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLNSSEYVP+YE
Sbjct  151  YLRKVDLKMYKSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYE  210

Query  359  DKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DKDGDWMLVGDVPW MFV+SCKRLRI+KGSEAIGLAPR MEKCK+++
Sbjct  211  DKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  257



>ref|XP_010440448.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score =   266 bits (681),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 144/164 (88%), Gaps = 3/164 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLR  531
            KDP KPPAKAQVVGWPPVR+YRKNVMA+ QK+   +E    +G    FVKVSMDGAPYLR
Sbjct  63   KDPAKPPAKAQVVGWPPVRNYRKNVMAN-QKNGETDEAMSSAGGTVAFVKVSMDGAPYLR  121

Query  530  KVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD  351
            KVDLK+YN+Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLNSSEYVP+YEDKD
Sbjct  122  KVDLKMYNSYKNLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKD  181

Query  350  GDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            GDWMLVGDVPW MFV+SCKRLRI+KGSE+IGLAPR MEKCK+++
Sbjct  182  GDWMLVGDVPWPMFVESCKRLRIMKGSESIGLAPRAMEKCKNRS  225



>gb|KJB82525.1| hypothetical protein B456_013G200700 [Gossypium raimondii]
Length=246

 Score =   266 bits (680),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 143/172 (83%), Gaps = 11/172 (6%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-----------FVKVS  555
            DP KPPAKAQVVGWPPVRS+RKN+MA  + S+  E G +K+GN+           FVKVS
Sbjct  75   DPAKPPAKAQVVGWPPVRSFRKNIMAVQKASSEEEGGSKKAGNSAAATTTTTAAAFVKVS  134

Query  554  MDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEY  375
            MDGAPYLRKVDLK+Y +Y QLSDAL+ MFSSFT GN G+ GM DFMNE KL+DLLN SEY
Sbjct  135  MDGAPYLRKVDLKLYKSYQQLSDALSKMFSSFTIGNCGSHGMKDFMNESKLIDLLNGSEY  194

Query  374  VPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            VPTYEDKDGDWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  195  VPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  246



>gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum]
Length=246

 Score =   266 bits (680),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 143/172 (83%), Gaps = 11/172 (6%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-----------FVKVS  555
            DP KPPAKAQVVGWPPVRS+RKN+MA  + S+  E G +K+GN+           FVKVS
Sbjct  75   DPAKPPAKAQVVGWPPVRSFRKNIMAVQKASSEEEGGSKKAGNSAAAITTTTAAAFVKVS  134

Query  554  MDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEY  375
            MDGAPYLRKVDLK+Y +Y QLSDAL+ MFSSFT GN G+ GM DFMNE KL+DLLN SEY
Sbjct  135  MDGAPYLRKVDLKLYKSYQQLSDALSKMFSSFTIGNCGSHGMKDFMNESKLIDLLNGSEY  194

Query  374  VPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            VPTYEDKDGDWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  195  VPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  246



>gb|AAC49055.1| IAA14, partial [Arabidopsis thaliana]
Length=164

 Score =   263 bits (671),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 141/164 (86%), Gaps = 3/164 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLR  531
            KDP KPPAKAQVVGWPPVR+YRKNVMA+ QKS   EE     G    FVKVSMDGAPYLR
Sbjct  2    KDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDGAPYLR  60

Query  530  KVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD  351
            KVDLK+Y +Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLNSSEYVP+YEDKD
Sbjct  61   KVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKD  120

Query  350  GDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            GDWMLVGDVPW MFV+SCKRLRI+KGSEAIGLAPR MEK K+++
Sbjct  121  GDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKFKNRS  164



>gb|KFK39592.1| hypothetical protein AALP_AA3G264300 [Arabis alpina]
Length=235

 Score =   265 bits (678),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 140/165 (85%), Gaps = 3/165 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLR  531
            KDP KPPAKAQVVGWPPVR+YRKN+M   + + + E    K+G     VKVSMDGAPYLR
Sbjct  71   KDPTKPPAKAQVVGWPPVRNYRKNMMTQQKTTGSEEASSDKAGTGAALVKVSMDGAPYLR  130

Query  530  KVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD  351
            KVDL +Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDKD
Sbjct  131  KVDLNMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKD  190

Query  350  GDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEK-CKSKN  219
            GDWMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR MEK CK+++
Sbjct  191  GDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  235



>ref|XP_009135842.1| PREDICTED: auxin-responsive protein IAA7-like [Brassica rapa]
 emb|CDX92973.1| BnaA03g36950D [Brassica napus]
Length=237

 Score =   265 bits (678),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 140/167 (84%), Gaps = 5/167 (3%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN----FVKVSMDGAPY  537
            KDP KPPAKAQVVGWPPVR+YRKN+M   + S   E   +K+GN      VKVSMDGAPY
Sbjct  71   KDPAKPPAKAQVVGWPPVRNYRKNMMTQQKTSGEEEASSEKAGNGGGAALVKVSMDGAPY  130

Query  536  LRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYED  357
            LRKVDL +Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLM+LLNSSEYVP+YED
Sbjct  131  LRKVDLTMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYED  190

Query  356  KDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEK-CKSKN  219
            KDGDWMLVGDVPWEMFV SCKRLRI+KGSEAIGLAPR MEK CK+++
Sbjct  191  KDGDWMLVGDVPWEMFVQSCKRLRIMKGSEAIGLAPRAMEKYCKNRS  237



>ref|XP_008224185.1| PREDICTED: auxin-responsive protein IAA14 [Prunus mume]
Length=248

 Score =   265 bits (678),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            K P KPPAKAQVVGWPPVRSYRKN+MA    S    E        FVKV MDGAPYLRKV
Sbjct  87   KYPAKPPAKAQVVGWPPVRSYRKNIMAQKSSSEESTEKGSGCSAAFVKVCMDGAPYLRKV  146

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LS++LA MFSSFT G YG QGMIDFMNE KLMDLLNSSEYVPTYEDKDGD
Sbjct  147  DLKMYKSYQELSNSLAKMFSSFTMGYYGPQGMIDFMNESKLMDLLNSSEYVPTYEDKDGD  206

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCK+++
Sbjct  207  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  248



>ref|XP_008362015.1| PREDICTED: auxin-responsive protein IAA14-like [Malus domestica]
Length=244

 Score =   265 bits (677),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 136/166 (82%), Gaps = 4/166 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN----FVKVSMDGAPY  537
            KDP KPPAKAQVVGWPPVRSYRKN+MA    S    E     G      FVKV MDGAPY
Sbjct  79   KDPAKPPAKAQVVGWPPVRSYRKNIMAQKNTSEENTEKATVGGGGCSAAFVKVCMDGAPY  138

Query  536  LRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYED  357
            LRKVDLK+Y +Y +LS+ALA MFSSFTTG YGAQGMIDFMNE KLMDLLNSSEYVPTYED
Sbjct  139  LRKVDLKMYKSYQELSNALAKMFSSFTTGYYGAQGMIDFMNESKLMDLLNSSEYVPTYED  198

Query  356  KDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            KDGDWMLVGDVPW MFVDSCKRLRI+KGSEAIGLAP+  EKCK ++
Sbjct  199  KDGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPKAXEKCKGRS  244



>ref|XP_011038568.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=246

 Score =   265 bits (676),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 141/162 (87%), Gaps = 2/162 (1%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSN-NGEE-GDQKSGNNFVKVSMDGAPYLRK  528
            DP KPPAKAQVVGWPP+RS+RKNVMA  + SN NGE+ G   +G  FVKVSMDGAPYLRK
Sbjct  84   DPAKPPAKAQVVGWPPIRSFRKNVMAVQKNSNDNGEKSGSGGAGVAFVKVSMDGAPYLRK  143

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DFMNE KL+DLLN SEYVPTYEDKDG
Sbjct  144  VDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDKDG  203

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR +EKCK++
Sbjct  204  DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  245



>ref|XP_010450026.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score =   264 bits (674),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 143/164 (87%), Gaps = 3/164 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLR  531
            KDP KPPAKAQVVGWPPVR+YRKNVMA+ QK+   +E    +G    FVKVSMDGAPYLR
Sbjct  63   KDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKNGETDEAMSSAGGTVAFVKVSMDGAPYLR  121

Query  530  KVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD  351
            KVDLK+YN+Y  LSDALA MFSSFT  +YGAQGMIDFMNE K+MDLLNSSEYVP+YEDKD
Sbjct  122  KVDLKMYNSYKDLSDALAKMFSSFTMESYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKD  181

Query  350  GDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            GDWMLVGDVPW MFV+SCKRLRI+KGSEAIGLAPR MEKCK+++
Sbjct  182  GDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  225



>ref|XP_010551700.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=234

 Score =   264 bits (674),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 142/162 (88%), Gaps = 5/162 (3%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KD  KPPAKAQVVGWPPVR+YRKN+MA  + S+  EE  +K+   FVKVSMDGAPYLRKV
Sbjct  78   KDKNKPPAKAQVVGWPPVRNYRKNMMAQQKSSSAVEE--EKA---FVKVSMDGAPYLRKV  132

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y  Y  LSDALA MFSSFT GNYG+QGMIDFMNE KLMDLLNSSEYVP+YEDKDGD
Sbjct  133  DLKIYQCYQDLSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSEYVPSYEDKDGD  192

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPW+MFV+SCKRLRI+KGSEAIGLAPR MEKCK+++
Sbjct  193  WMLVGDVPWQMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  234



>ref|NP_193191.2| auxin-responsive protein IAA14 [Arabidopsis thaliana]
 sp|Q38832.2|IAA14_ARATH RecName: Full=Auxin-responsive protein IAA14; AltName: Full=Indoleacetic 
acid-induced protein 14; AltName: Full=Protein SOLITARY 
ROOT [Arabidopsis thaliana]
 gb|AAG50096.1|AF334718_1 IAA14 [Arabidopsis thaliana]
 dbj|BAF00338.1| IAA14 [Arabidopsis thaliana]
 dbj|BAH30518.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83459.1| auxin-responsive protein IAA14 [Arabidopsis thaliana]
Length=228

 Score =   264 bits (674),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 141/164 (86%), Gaps = 3/164 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLR  531
            KDP KPPAKAQVVGWPPVR+YRKNVMA+ QKS   EE     G    FVKVSMDGAPYLR
Sbjct  66   KDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDGAPYLR  124

Query  530  KVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD  351
            KVDLK+Y +Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLNSSEYVP+YEDKD
Sbjct  125  KVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKD  184

Query  350  GDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            GDWMLVGDVPW MFV+SCKRLRI+KGSEAIGLAPR MEK K+++
Sbjct  185  GDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKFKNRS  228



>ref|XP_009337294.1| PREDICTED: auxin-responsive protein IAA14-like [Pyrus x bretschneideri]
Length=244

 Score =   264 bits (675),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 143/167 (86%), Gaps = 7/167 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-----FVKVSMDGAP  540
            KDP KPPAKAQVVGWPPVRSYRKN+M+  QK+ + E+ ++ SG       FVKV MDGAP
Sbjct  80   KDPSKPPAKAQVVGWPPVRSYRKNIMS--QKNTSEEKTEKASGGGGCSAAFVKVCMDGAP  137

Query  539  YLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYE  360
            YLRKVDLK+Y +Y +LS+AL+ MFSSFTTG YG QGMIDFMNE KLMDLLNSSEYVPTYE
Sbjct  138  YLRKVDLKMYKSYQELSNALSKMFSSFTTGYYGTQGMIDFMNESKLMDLLNSSEYVPTYE  197

Query  359  DKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DKDGDWMLVGDVPW MFVDSCKRLRI+KGSEAIGLAP+ MEKCK ++
Sbjct  198  DKDGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPKAMEKCKGRS  244



>ref|XP_010556884.1| PREDICTED: auxin-responsive protein IAA17 [Tarenaya hassleriana]
Length=238

 Score =   264 bits (674),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 140/163 (86%), Gaps = 9/163 (6%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKN+ A  QK++ G          FVKVSMDGAPYLRKV
Sbjct  82   KDPSKPPAKAQVVGWPPVRSYRKNMTAMSQKASGGSA-------TFVKVSMDGAPYLRKV  134

Query  524  DLKVYNTYNQLSDALANMFSSFTT--GNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD  351
            DLK+YN+Y  LS+ALA MFSSFTT  GNYGAQGMIDFMNE KLMDLLNSS+YVPTYEDKD
Sbjct  135  DLKMYNSYEDLSNALAKMFSSFTTEKGNYGAQGMIDFMNESKLMDLLNSSDYVPTYEDKD  194

Query  350  GDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            GDWMLVGDVPW MFV+SCKRLRI+KGSEAIGLAPR MEKCK++
Sbjct  195  GDWMLVGDVPWLMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  237



>ref|XP_004134096.1| PREDICTED: auxin-responsive protein IAA14-like isoform 1 [Cucumis 
sativus]
 ref|XP_004162257.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA14-like 
[Cucumis sativus]
 gb|KGN56916.1| hypothetical protein Csa_3G143570 [Cucumis sativus]
Length=237

 Score =   264 bits (674),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 137/163 (84%), Gaps = 1/163 (1%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKN M+        + G       FVKV MDGAPYLRKV
Sbjct  75   KDPAKPPAKAQVVGWPPVRSYRKNAMSQKSSEAGEKGGSSGGSAMFVKVCMDGAPYLRKV  134

Query  524  DLKVYNTYNQLSDALANMFSSFT-TGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            DLK+Y +Y +LS+ALA MFSSFT  G+YGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDG
Sbjct  135  DLKMYKSYQELSNALAKMFSSFTMAGDYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDG  194

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCKS++
Sbjct  195  DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  237



>ref|XP_002319075.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
 gb|EEE94998.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
Length=246

 Score =   264 bits (674),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 141/162 (87%), Gaps = 2/162 (1%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSN-NGEE-GDQKSGNNFVKVSMDGAPYLRK  528
            DP KPPAKAQVVGWPP+RS+RKNVMA  + SN NGE+ G   +G  FVKVSMDGAPYLRK
Sbjct  84   DPAKPPAKAQVVGWPPIRSFRKNVMAVQKNSNDNGEKSGSSGTGVAFVKVSMDGAPYLRK  143

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DFMNE KL+DLLN S+YVPTYEDKDG
Sbjct  144  VDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDG  203

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR +EKCK++
Sbjct  204  DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  245



>ref|NP_001280875.1| auxin-responsive protein IAA14-like [Malus domestica]
 gb|ADL36585.1| ARF domain class transcription factor [Malus domestica]
Length=244

 Score =   263 bits (673),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 141/167 (84%), Gaps = 7/167 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-----FVKVSMDGAP  540
            KDP KPPAKAQVVGWPPVRSYRKN+MA  QK+ + E+  + SG       FVKV MDGAP
Sbjct  80   KDPSKPPAKAQVVGWPPVRSYRKNIMA--QKNTSEEKTKKASGGGGCTAAFVKVCMDGAP  137

Query  539  YLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYE  360
            YLRKVDLK+Y +Y +LS+ALA MFSSFTTG YG QGMIDFMNE KLMDLLNSSEYVPTYE
Sbjct  138  YLRKVDLKMYKSYQELSNALAKMFSSFTTGYYGTQGMIDFMNESKLMDLLNSSEYVPTYE  197

Query  359  DKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DKDGDWMLVGDVPW M VDSCKRLRI+KGSEAIGLAP+ MEKCK ++
Sbjct  198  DKDGDWMLVGDVPWGMLVDSCKRLRIMKGSEAIGLAPKAMEKCKGRS  244



>ref|XP_010532600.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=229

 Score =   262 bits (670),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 144/162 (89%), Gaps = 2/162 (1%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPP+KAQVVGWPPVR+YRKNVMA+ +  N+  E ++K+   FVKVSMDGAPYLRKV
Sbjct  70   KDPAKPPSKAQVVGWPPVRNYRKNVMANQK--NSAMEEEEKAAAAFVKVSMDGAPYLRKV  127

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK++ +Y  LSDALA MFSSFT G+YGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDGD
Sbjct  128  DLKMHKSYQDLSDALAKMFSSFTMGSYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGD  187

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPW MFV+SCKRLRI+KGSEAIGLAPR MEKCK+++
Sbjct  188  WMLVGDVPWLMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  229



>ref|XP_008438588.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=237

 Score =   262 bits (670),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 138/163 (85%), Gaps = 1/163 (1%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKN M+     +  + G       FVKV MDGAPYLRKV
Sbjct  75   KDPAKPPAKAQVVGWPPVRSYRKNAMSQKSPDSGEKGGSSGGSAMFVKVCMDGAPYLRKV  134

Query  524  DLKVYNTYNQLSDALANMFSSFT-TGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            DLK+Y +Y +LS+ALA MFSSFT  G+YGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDG
Sbjct  135  DLKMYKSYQELSNALAKMFSSFTMAGDYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDG  194

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCKS++
Sbjct  195  DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  237



>emb|CDY47148.1| BnaA08g05350D [Brassica napus]
Length=233

 Score =   262 bits (670),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 141/164 (86%), Gaps = 2/164 (1%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLR  531
            KDP KPPAKAQVVGWPPVR+YRK+VM H + S   E    + G    FVKVSMDGAPYLR
Sbjct  70   KDPSKPPAKAQVVGWPPVRNYRKSVMTHQKCSEVEEASSDRGGGTVAFVKVSMDGAPYLR  129

Query  530  KVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD  351
            KVDLK+Y +Y +LSDALA MFSSFT G+YGAQGMIDFMNE K+MDL+NSS+YVP+YEDKD
Sbjct  130  KVDLKMYTSYKELSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLVNSSDYVPSYEDKD  189

Query  350  GDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            GDWMLVGDVPW MF++SCKRLRI+KGSEAIGLAPR M+KCK+++
Sbjct  190  GDWMLVGDVPWPMFIESCKRLRIMKGSEAIGLAPRAMQKCKNRS  233



>ref|XP_006284476.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
 gb|EOA17374.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
Length=228

 Score =   262 bits (669),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 140/164 (85%), Gaps = 3/164 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLR  531
            +DP KPP KAQVVGWPPVR+YRK VMA  QK+   EE     G    FVKVSMDGAPYLR
Sbjct  66   QDPTKPPTKAQVVGWPPVRNYRKTVMAT-QKNGETEETMSSGGGTIAFVKVSMDGAPYLR  124

Query  530  KVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD  351
            KVDL++YN+Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLNSSEYVP+YEDKD
Sbjct  125  KVDLRMYNSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKD  184

Query  350  GDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            GDWMLVGDVPW MFV+SCKRLRI+KGSEAIGLAPR MEKCK+++
Sbjct  185  GDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  228



>ref|NP_001275031.1| auxin-responsive protein IAA14-like [Solanum tuberosum]
 gb|ABK41009.1| auxin/indole-3-acetic acid [Solanum tuberosum]
Length=213

 Score =   261 bits (668),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 141/161 (88%), Gaps = 4/161 (2%)
 Frame = -2

Query  695  IKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRKVD  522
            +KPP KAQVVGWPPVRS+RKN+M+  QK NN  E  +K      FVKVSMDGAPYLRKVD
Sbjct  55   LKPPTKAQVVGWPPVRSFRKNIMS--QKGNNNVEISEKGEKTIAFVKVSMDGAPYLRKVD  112

Query  521  LKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  342
            LK+Y +Y QLSD+L  MFSSFT GNYG+QGMIDFMNERKLMD+LNSS+YVPTYEDKDGDW
Sbjct  113  LKMYKSYQQLSDSLTKMFSSFTMGNYGSQGMIDFMNERKLMDVLNSSDYVPTYEDKDGDW  172

Query  341  MLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            MLVGDVPW+MFVDSCKRLRI+KGSEAIGLAPR MEKCK+++
Sbjct  173  MLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  213



>ref|XP_002868277.1| hypothetical protein ARALYDRAFT_493451 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44536.1| hypothetical protein ARALYDRAFT_493451 [Arabidopsis lyrata subsp. 
lyrata]
Length=228

 Score =   261 bits (668),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 141/164 (86%), Gaps = 3/164 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLR  531
            KDP KPPAKAQVVGWPPVR+YRKNVMA+ QKS   EE     G    FVKVSMDGAPYLR
Sbjct  66   KDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDGAPYLR  124

Query  530  KVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD  351
            KVDLK+Y +Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLNSSEYVP+YEDKD
Sbjct  125  KVDLKMYKSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKD  184

Query  350  GDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            GDWMLVGDVPW MFV+SCKR+RI+KGSEAIGLAPR MEK K+++
Sbjct  185  GDWMLVGDVPWPMFVESCKRMRIMKGSEAIGLAPRAMEKFKNRS  228



>ref|XP_010274203.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=252

 Score =   262 bits (670),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 141/162 (87%), Gaps = 3/162 (2%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-FVKVSMDGAPYLRKV  525
            DP KPPAKAQVVGWPPVRS+RKN+++ H+ S   EEG++ S +  FVKVSMDGAPYLRKV
Sbjct  93   DPAKPPAKAQVVGWPPVRSFRKNILSVHKSST--EEGEKVSSSAAFVKVSMDGAPYLRKV  150

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LSDAL  MFSSFT GN G QGM DFMNE KLMDLLN SEYVPTYEDKDGD
Sbjct  151  DLKMYKSYQELSDALGKMFSSFTIGNCGPQGMKDFMNESKLMDLLNGSEYVPTYEDKDGD  210

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  211  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  252



>ref|XP_010466604.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score =   261 bits (668),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 142/171 (83%), Gaps = 9/171 (5%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--------FVKVSMD  549
            KDP KPPAKAQVVGWPPVR+YRKN+M   + S   E   +K+G+          VKVSMD
Sbjct  72   KDPAKPPAKAQVVGWPPVRNYRKNIMTQQKASGTEEASSEKAGSGSGGAAGAGLVKVSMD  131

Query  548  GAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVP  369
            GAPYLRKVDLK+Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLM+LLNSSEYVP
Sbjct  132  GAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVP  191

Query  368  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEK-CKSKN  219
            +YEDKDGDWMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR MEK CK+++
Sbjct  192  SYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  242



>ref|XP_010488346.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score =   261 bits (668),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 142/171 (83%), Gaps = 9/171 (5%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--------FVKVSMD  549
            KDP KPPAKAQVVGWPPVR+YRKN+M   + S   E   +K+G+          VKVSMD
Sbjct  72   KDPAKPPAKAQVVGWPPVRNYRKNIMTQQKASGTEEASSEKAGSGSGGAAGAGLVKVSMD  131

Query  548  GAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVP  369
            GAPYLRKVDLK+Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLM+LLNSSEYVP
Sbjct  132  GAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVP  191

Query  368  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEK-CKSKN  219
            +YEDKDGDWMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR MEK CK+++
Sbjct  192  SYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  242



>ref|XP_009107777.1| PREDICTED: auxin-responsive protein IAA14 [Brassica rapa]
Length=233

 Score =   261 bits (667),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 140/163 (86%), Gaps = 2/163 (1%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLR  531
            KDP KPPAKAQVVGWPPVR+YRK+VM H + S   E    + G    FVKVSMDGAPYLR
Sbjct  70   KDPSKPPAKAQVVGWPPVRNYRKSVMTHQKCSEVEEASSDRGGGTVAFVKVSMDGAPYLR  129

Query  530  KVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD  351
            KVDLK+Y +Y +LSDALA MFSSFT G+YGAQGMIDFMNE K+MDL+NSS+YVP+YEDKD
Sbjct  130  KVDLKMYKSYKELSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLVNSSDYVPSYEDKD  189

Query  350  GDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            GDWMLVGDVPW MF++SCKRLRI+KGSEAIGLAPR M+KCK++
Sbjct  190  GDWMLVGDVPWPMFIESCKRLRIMKGSEAIGLAPRAMQKCKNR  232



>ref|XP_010512022.1| PREDICTED: auxin-responsive protein IAA7 [Camelina sativa]
Length=242

 Score =   261 bits (668),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 142/171 (83%), Gaps = 9/171 (5%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--------FVKVSMD  549
            KDP KPPAKAQVVGWPPVR+YRKN+M   + S   E   +K+G+          VKVSMD
Sbjct  72   KDPAKPPAKAQVVGWPPVRNYRKNIMTQQKASGTEEASSEKAGSGSGGAAGAGLVKVSMD  131

Query  548  GAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVP  369
            GAPYLRKVDLK+Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLM+LLNSSEYVP
Sbjct  132  GAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVP  191

Query  368  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEK-CKSKN  219
            +YEDKDGDWMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR MEK CK+++
Sbjct  192  SYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  242



>gb|AAM65301.1| indoleacetic acid (IAA)-inducible gene (IAA7) [Arabidopsis thaliana]
Length=238

 Score =   261 bits (667),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 142/172 (83%), Gaps = 10/172 (6%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK---------SGNNFVKVSM  552
            KDP KPPAKAQVVGWPPVR+YRKN+M   + S+  EE   +         +G   VKVSM
Sbjct  67   KDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGGAAGAGLVKVSM  126

Query  551  DGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYV  372
            DGAPYLRKVDLK+Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLM+LLNSSEYV
Sbjct  127  DGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYV  186

Query  371  PTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEK-CKSKN  219
            P+YEDKDGDWMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR MEK CK+++
Sbjct  187  PSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  238



>gb|KHG19190.1| Auxin-responsive IAA16 -like protein [Gossypium arboreum]
Length=246

 Score =   261 bits (668),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 142/172 (83%), Gaps = 11/172 (6%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-----------FVKVS  555
            D  KPPAKAQVVGWPPVRS+RKN+MA  + S+  E G +K+GN+           FVKVS
Sbjct  75   DTAKPPAKAQVVGWPPVRSFRKNIMAVQKASSEEEGGSKKAGNSAAATTTTTAAAFVKVS  134

Query  554  MDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEY  375
            MDGAPYLRKVDLK+Y +Y QLSDAL+ MFSSFT GN G+ GM DFMNE KL+DLLN SEY
Sbjct  135  MDGAPYLRKVDLKLYKSYQQLSDALSKMFSSFTIGNCGSHGMKDFMNESKLIDLLNGSEY  194

Query  374  VPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            VPTYED+DGDWMLVGDVPWEMFVD+CKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  195  VPTYEDRDGDWMLVGDVPWEMFVDTCKRLRIMKGSEAIGLAPRAVEKCKNRS  246



>emb|CAC84710.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=277

 Score =   262 bits (670),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 141/191 (74%), Gaps = 29/191 (15%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNG-------------------------  600
            KDP KPPAKAQVVGWPPVRSYRKNV+A    S  G                         
Sbjct  87   KDPAKPPAKAQVVGWPPVRSYRKNVLAQKNASEEGFGAQVEGWPPVRSYRKNVLVQKNAS  146

Query  599  EEGDQKSGNN----FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQG  432
            EEG++ S       FVKV MDGAPYLRKVDLK+Y +Y +LSDALA MFSS T GNYGAQG
Sbjct  147  EEGEKASTGGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSDALAKMFSSLTMGNYGAQG  206

Query  431  MIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLA  252
            MIDFMNE KLMDLLNSSEYVP+YEDKDGDWMLVGDVPWEMFVDSCKR RI+KGSEA+GLA
Sbjct  207  MIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVDSCKRPRIMKGSEAVGLA  266

Query  251  PRVMEKCKSKN  219
            PR MEKCKS+ 
Sbjct  267  PRAMEKCKSRT  277



>ref|XP_004493739.1| PREDICTED: auxin-induced protein AUX28-like [Cicer arietinum]
Length=246

 Score =   261 bits (667),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVD  522
            DP KPPAKAQVVGWPPVRSYRKN++A  QKS+N   G++ +  +FVKVSMDGAPYLRKVD
Sbjct  86   DPAKPPAKAQVVGWPPVRSYRKNMLAM-QKSSNDVVGEENNAISFVKVSMDGAPYLRKVD  144

Query  521  LKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  342
            LK+YN+Y+QLSD+L  MFSSFT GN  +QGM DFMNE KLMDLLN+S+YVPTYEDKDGDW
Sbjct  145  LKIYNSYSQLSDSLGKMFSSFTIGNCESQGMKDFMNESKLMDLLNNSDYVPTYEDKDGDW  204

Query  341  MLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            M+VGDVPWEMFV+SCKRLRI+KG EAIG+APR MEKCK+++
Sbjct  205  MVVGDVPWEMFVESCKRLRIMKGKEAIGIAPRAMEKCKNRS  245



>dbj|BAH15071.1| indole-3-acetic acid 14 transcription factor like [Malus prunifolia]
Length=243

 Score =   261 bits (666),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 138/167 (83%), Gaps = 8/167 (5%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-----FVKVSMDGAP  540
            KDP KPPAKAQVVGWPPVRSYRKNVMA     N  EE  +K+        FVKV MDGAP
Sbjct  80   KDPSKPPAKAQVVGWPPVRSYRKNVMAQK---NTSEEKTKKASAGGCTAAFVKVCMDGAP  136

Query  539  YLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYE  360
            YLRKVDLK+Y +Y +LS+ALA MFSSFTTG YG QGMIDFMNE KLMDLLNSSEYVPTYE
Sbjct  137  YLRKVDLKMYRSYQELSNALAKMFSSFTTGYYGDQGMIDFMNESKLMDLLNSSEYVPTYE  196

Query  359  DKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DKDGDWMLVGDVPW M VDSCKRLRI+KGSEAIG+AP+ MEKCK ++
Sbjct  197  DKDGDWMLVGDVPWGMLVDSCKRLRIMKGSEAIGIAPKAMEKCKGRS  243



>ref|NP_188945.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 sp|Q38825.1|IAA7_ARATH RecName: Full=Auxin-responsive protein IAA7; AltName: Full=Auxin 
resistant 2; AltName: Full=Indoleacetic acid-induced protein 
7 [Arabidopsis thaliana]
 gb|AAG48759.1|AF332395_1 indoleacetic acid-inducible protein IAA7 [Arabidopsis thaliana]
 gb|AAC49048.1| IAA7 [Arabidopsis thaliana]
 dbj|BAB02096.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAK96842.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAL66876.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AEE76710.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
Length=243

 Score =   261 bits (666),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 142/172 (83%), Gaps = 10/172 (6%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK---------SGNNFVKVSM  552
            KDP KPPAKAQVVGWPPVR+YRKN+M   + S+  EE   +         +G   VKVSM
Sbjct  72   KDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGGAAGAGLVKVSM  131

Query  551  DGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYV  372
            DGAPYLRKVDLK+Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLM+LLNSSEYV
Sbjct  132  DGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYV  191

Query  371  PTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEK-CKSKN  219
            P+YEDKDGDWMLVGDVPWEMFV+SCKRLRI+KGSEA+GLAPR MEK CK+++
Sbjct  192  PSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKYCKNRS  243



>ref|XP_007034957.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
 gb|EOY05883.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
Length=204

 Score =   259 bits (661),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 136/152 (89%), Gaps = 5/152 (3%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS---GNNFVKVSMDGAPYL  534
            KDP KPPAKAQVVGWPPVRSYRKN+MA+ +  N+ EE D+K+   G  FVKVSMDGAPYL
Sbjct  55   KDPAKPPAKAQVVGWPPVRSYRKNIMANQK--NSCEESDKKASSGGAAFVKVSMDGAPYL  112

Query  533  RKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  354
            RKVDLK+Y +Y +LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLNSS+YVPTYEDK
Sbjct  113  RKVDLKMYKSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSDYVPTYEDK  172

Query  353  DGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIG  258
            DGDWMLVGDVPWEMFVDSCKRLRI+KGSEAIG
Sbjct  173  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIG  204



>emb|CDY62130.1| BnaC08g47390D [Brassica napus]
Length=233

 Score =   259 bits (662),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 139/163 (85%), Gaps = 2/163 (1%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLR  531
            KDP KPPAKAQVVGWPPVR+YRK+VM H + S   E    + G    FVKVSMDGAPYLR
Sbjct  70   KDPSKPPAKAQVVGWPPVRNYRKSVMTHQKCSEVEEASSDRGGGTVAFVKVSMDGAPYLR  129

Query  530  KVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD  351
            KVDLK+Y +Y +LSDALA MFSSFT G+YGAQGMIDFMNE K+MDL+NSSEYVP+YEDKD
Sbjct  130  KVDLKMYTSYKELSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLVNSSEYVPSYEDKD  189

Query  350  GDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            GDWMLVGDVPW MF++SCKRLRI+KGSEAIGLAPR MEK K++
Sbjct  190  GDWMLVGDVPWPMFIESCKRLRIMKGSEAIGLAPRAMEKYKNR  232



>gb|KEH42778.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=239

 Score =   259 bits (663),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 134/154 (87%), Gaps = 6/154 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN----FVKVSMDGAPY  537
            KDP KPPAKAQVVGWPPVRSYRKN+MA  QK NN E+ ++ + N     FVKVSMDGAPY
Sbjct  73   KDPAKPPAKAQVVGWPPVRSYRKNMMA--QKVNNTEDTEKTTSNTTAAAFVKVSMDGAPY  130

Query  536  LRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYED  357
            LRKVDL +Y TY  LSDALA MFSSFTTGNYGAQGMIDFMNE KLMDLLNSSEYVPTYED
Sbjct  131  LRKVDLTMYKTYKDLSDALAKMFSSFTTGNYGAQGMIDFMNESKLMDLLNSSEYVPTYED  190

Query  356  KDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGL  255
            KDGDWMLVGDVPWEMFV SCKRLRI+KGSEAIGL
Sbjct  191  KDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGL  224



>ref|XP_011032399.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=249

 Score =   259 bits (663),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 141/166 (85%), Gaps = 7/166 (4%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS-----GNNFVKVSMDGAPY  537
            DP KPP+KAQVVGWPP+RS+RKNVMA  +  NN +EG++ S     G  FVKVSMDGAPY
Sbjct  86   DPAKPPSKAQVVGWPPIRSFRKNVMAVQK--NNNDEGEKASSSGTTGAAFVKVSMDGAPY  143

Query  536  LRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYED  357
            LRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QG  DFMNE KL+DLLNSSEYVPTYED
Sbjct  144  LRKVDLKLYKSYRELSDALGKMFSSFTIGNCGSQGTKDFMNESKLIDLLNSSEYVPTYED  203

Query  356  KDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            KDGDWMLVGDVPW MFVDSCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  204  KDGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  249



>ref|XP_004289900.1| PREDICTED: auxin-induced protein AUX28-like [Fragaria vesca subsp. 
vesca]
Length=250

 Score =   259 bits (663),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 138/163 (85%), Gaps = 5/163 (3%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRK  528
            DP KPPAKAQVVGWPPVRS+RKN+++  + S   E    K+G N   VKVSMDGAPYLRK
Sbjct  91   DPAKPPAKAQVVGWPPVRSFRKNMLSAQKSSTTDE---SKAGGNAALVKVSMDGAPYLRK  147

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDL +Y TY QLSDALA MFSSFT GN G+QG IDFMNERKLMDLLN S+Y+PTYEDKDG
Sbjct  148  VDLNMYKTYPQLSDALAKMFSSFTIGNCGSQGTIDFMNERKLMDLLNDSDYIPTYEDKDG  207

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPWEMFV+SCKRLRI+KG EA+GLAPR MEKCK+++
Sbjct  208  DWMLVGDVPWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS  250



>ref|XP_007030567.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
 gb|EOY11069.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
Length=249

 Score =   259 bits (662),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 143/170 (84%), Gaps = 10/170 (6%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN---------FVKVSMD  549
            DP KPPAKAQVVGWPPVRS+RKN+MA  QK+++  EG++   +N         FVKVSMD
Sbjct  81   DPAKPPAKAQVVGWPPVRSFRKNIMAV-QKNSSDVEGEKAGSSNTTTATVAAAFVKVSMD  139

Query  548  GAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVP  369
            GAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DFMNE KL+DLLN SEYVP
Sbjct  140  GAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVP  199

Query  368  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            TYEDKDGDWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  200  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  249



>gb|AAM21317.1|AF373100_1 auxin-regulated protein [Populus tremula x Populus tremuloides]
Length=249

 Score =   259 bits (662),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 141/166 (85%), Gaps = 7/166 (4%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS-----GNNFVKVSMDGAPY  537
            DP KPP+KAQVVGWPP+RS+RKNVMA  + SN  +EG++ S     G  FVKVSMDGAPY
Sbjct  86   DPAKPPSKAQVVGWPPIRSFRKNVMAVQKNSN--DEGEKASSSGATGAAFVKVSMDGAPY  143

Query  536  LRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYED  357
            LRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QG  DFMNE KL+DLLNSSEYVPTYED
Sbjct  144  LRKVDLKLYKSYRELSDALGKMFSSFTIGNCGSQGTKDFMNESKLIDLLNSSEYVPTYED  203

Query  356  KDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            KDGDWMLVGDVPW MFVDSCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  204  KDGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  249



>ref|XP_006382798.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
 gb|ABK94241.1| unknown [Populus trichocarpa]
 gb|ERP60595.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
Length=250

 Score =   259 bits (662),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 138/165 (84%), Gaps = 4/165 (2%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN----FVKVSMDGAPYL  534
            DP KPP+KAQVVGWPP+RS+RKNVMA  + SN+  E    SG      FVKVSMDGAPYL
Sbjct  86   DPAKPPSKAQVVGWPPIRSFRKNVMAVQKNSNDEGEKASSSGTTGTAAFVKVSMDGAPYL  145

Query  533  RKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  354
            RKVDLK+Y +Y +LSDAL  MFSSFT GN G+QG  DFMNE KL+DLLNSSEYVPTYEDK
Sbjct  146  RKVDLKLYKSYRELSDALGKMFSSFTIGNCGSQGTKDFMNESKLIDLLNSSEYVPTYEDK  205

Query  353  DGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DGDWMLVGDVPW MFVDSCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  206  DGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  250



>gb|ABM53874.1| IAA6 [Cestrum elegans]
Length=153

 Score =   255 bits (652),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 134/154 (87%), Gaps = 6/154 (4%)
 Frame = -2

Query  671  VVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS----GNNFVKVSMDGAPYLRKVDLKVYNT  504
            VVGWPPVRS+RKNVMA  QKSN  +E ++ S       FVKV MDGAPYLRKVDLK+Y +
Sbjct  1    VVGWPPVRSFRKNVMA--QKSNTDQENEKNSITTAAAAFVKVCMDGAPYLRKVDLKMYKS  58

Query  503  YNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDV  324
            Y QLSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLN+SEYVP+YEDKDGDWMLVGDV
Sbjct  59   YKQLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNTSEYVPSYEDKDGDWMLVGDV  118

Query  323  PWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            PWEMFVDSCKRLRI+KGSEAIGLAPR MEKCKS+
Sbjct  119  PWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  152



>ref|XP_006443921.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
 ref|XP_006479598.1| PREDICTED: auxin-induced protein AUX28-like [Citrus sinensis]
 gb|ESR57161.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
Length=232

 Score =   258 bits (659),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 137/161 (85%), Gaps = 3/161 (2%)
 Frame = -2

Query  698  PIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRKV  525
            P KPPAK QVVGWPPVRS+RKN++   QKS+ GEE D   GNN  FVKVSMDGAPYLRKV
Sbjct  72   PAKPPAKTQVVGWPPVRSFRKNMLGVVQKSS-GEESDMAGGNNAAFVKVSMDGAPYLRKV  130

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DL++YNTY  L DAL  MFSSFT GN G+QGM DFMNE KLMDLLN S+YVPTYEDKDGD
Sbjct  131  DLRMYNTYKDLYDALGKMFSSFTIGNCGSQGMKDFMNESKLMDLLNGSDYVPTYEDKDGD  190

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            WMLVGDVPW MFV+SCKRLRI+KG+EAIGLAPR MEKCK++
Sbjct  191  WMLVGDVPWGMFVESCKRLRIVKGTEAIGLAPRAMEKCKNR  231



>ref|XP_004495391.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Cicer 
arietinum]
Length=244

 Score =   258 bits (660),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 136/157 (87%), Gaps = 8/157 (5%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEE-GDQKS-----GNNFVKVSMDGA  543
            KDP KPPAKAQVVGWPPVRSYRKN+MA  QK NN ++ G++K+        FVKVSMDGA
Sbjct  75   KDPAKPPAKAQVVGWPPVRSYRKNMMA--QKVNNSDQDGNEKTTSSTTAGTFVKVSMDGA  132

Query  542  PYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTY  363
            PYLRKVDL +YNTY  LSDALA MFSSFTTG YGAQGMIDFMNE KLMDLLNSSEYVPTY
Sbjct  133  PYLRKVDLTMYNTYKDLSDALAKMFSSFTTGKYGAQGMIDFMNESKLMDLLNSSEYVPTY  192

Query  362  EDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLA  252
            EDKDGDWMLVGDVPWEMFV+SCKRLRI+KGSEAIGL 
Sbjct  193  EDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLG  229



>dbj|BAI94494.1| Aux/IAA protein [Dianthus caryophyllus]
Length=238

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 136/164 (83%), Gaps = 4/164 (2%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEG---DQKSGNNFVKVSMDGAPYLR  531
            D +KPPAKAQVVGWPPVRSYRKNVM   QK   GEEG   D+ S    VKVSMDGAPYLR
Sbjct  76   DSVKPPAKAQVVGWPPVRSYRKNVMTL-QKGTAGEEGETVDKSSSGGLVKVSMDGAPYLR  134

Query  530  KVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD  351
            KV LK+Y +Y +LSDAL  MFS FT GNYG QGMIDFMNERKLMDLLN S+YVPTYEDKD
Sbjct  135  KVHLKMYKSYQELSDALGKMFSFFTLGNYGEQGMIDFMNERKLMDLLNDSDYVPTYEDKD  194

Query  350  GDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            GDWMLVGDVPW MFV+SCKR+RI+KG EA GLAPR MEKCK+++
Sbjct  195  GDWMLVGDVPWGMFVESCKRIRIMKGKEAAGLAPRAMEKCKNRS  238



>ref|NP_001288823.1| auxin-responsive protein IAA7 [Brassica rapa]
 dbj|BAF81520.1| auxin-responsive protein IAA [Brassica rapa]
Length=242

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 141/171 (82%), Gaps = 9/171 (5%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--------FVKVSMD  549
            KDP KPPAKAQVVGWPPVR+YRKN++   + S   E   +K+GN+         VKVSMD
Sbjct  72   KDPAKPPAKAQVVGWPPVRNYRKNIITQQKTSGKEEASSEKAGNSGGGASGAALVKVSMD  131

Query  548  GAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVP  369
            GAPYLRKVDLK+Y +Y   SDALA MFSSFT G YGAQGMIDFMNE KLMDLLNSSEYVP
Sbjct  132  GAPYLRKVDLKMYKSYKDFSDALAKMFSSFTMGKYGAQGMIDFMNESKLMDLLNSSEYVP  191

Query  368  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEK-CKSKN  219
            +YEDKDGDWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEK CK+++
Sbjct  192  SYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKYCKNRS  242



>ref|XP_010674855.1| PREDICTED: auxin-induced protein AUX28 [Beta vulgaris subsp. 
vulgaris]
Length=297

 Score =   259 bits (663),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 143/168 (85%), Gaps = 8/168 (5%)
 Frame = -2

Query  701  DPIKP-PAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN------FVKVSMDGA  543
            DP KP  AKAQVVGWPPVR++RKN++A  +KS+  E+ DQK+ NN      FVKVSMDGA
Sbjct  131  DPAKPSAAKAQVVGWPPVRAFRKNIVAVQKKSSE-EQADQKASNNTIASAAFVKVSMDGA  189

Query  542  PYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTY  363
            PYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DFMNE KL+DLLN S+YVPTY
Sbjct  190  PYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTY  249

Query  362  EDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            EDKDGDWMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR +EKCKS++
Sbjct  250  EDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKSRS  297



>ref|XP_002281771.1| PREDICTED: auxin-responsive protein IAA16-like [Vitis vinifera]
Length=244

 Score =   258 bits (658),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 140/162 (86%), Gaps = 3/162 (2%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-FVKVSMDGAPYLRKV  525
            DP +PPAKAQVVGWPPVRS+RKN++A  +     EEG++ S N  FVKVSMDGAPYLRKV
Sbjct  85   DPARPPAKAQVVGWPPVRSFRKNMLAGQK--GGSEEGEKVSCNAAFVKVSMDGAPYLRKV  142

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LS+AL NMFSSFT GNYG+QGM DFMNE KLMDLLN  ++VPTYEDKDGD
Sbjct  143  DLKMYTSYQELSNALGNMFSSFTIGNYGSQGMKDFMNESKLMDLLNGFDHVPTYEDKDGD  202

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFVDSCKRLRI+KG EAIGLAPR MEKCK+++
Sbjct  203  WMLVGDVPWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNRS  244



>emb|CAN63268.1| hypothetical protein VITISV_013635 [Vitis vinifera]
 emb|CBI17932.3| unnamed protein product [Vitis vinifera]
Length=235

 Score =   257 bits (657),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 140/162 (86%), Gaps = 3/162 (2%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-FVKVSMDGAPYLRKV  525
            DP +PPAKAQVVGWPPVRS+RKN++A  +     EEG++ S N  FVKVSMDGAPYLRKV
Sbjct  76   DPARPPAKAQVVGWPPVRSFRKNMLAGQK--GGSEEGEKVSCNAAFVKVSMDGAPYLRKV  133

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LS+AL NMFSSFT GNYG+QGM DFMNE KLMDLLN  ++VPTYEDKDGD
Sbjct  134  DLKMYTSYQELSNALGNMFSSFTIGNYGSQGMKDFMNESKLMDLLNGFDHVPTYEDKDGD  193

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFVDSCKRLRI+KG EAIGLAPR MEKCK+++
Sbjct  194  WMLVGDVPWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNRS  235



>emb|CDY10349.1| BnaC05g29300D [Brassica napus]
Length=246

 Score =   257 bits (657),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 142/171 (83%), Gaps = 9/171 (5%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--------FVKVSMD  549
            KDP KPPAKAQVVGWPPVR+YRKN++   + S   E   +K+GN+         VKVSMD
Sbjct  76   KDPAKPPAKAQVVGWPPVRNYRKNIITQQKTSGKEEASSEKAGNSGGGASGAALVKVSMD  135

Query  548  GAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVP  369
            GAPYLRKVDLK+Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLNSS+YVP
Sbjct  136  GAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSDYVP  195

Query  368  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEK-CKSKN  219
            +YEDKD DWMLVGDVPWEMFVDSCKRLRI+KG+EAIGLAPR MEK CK+++
Sbjct  196  SYEDKDSDWMLVGDVPWEMFVDSCKRLRIMKGAEAIGLAPRAMEKYCKNRS  246



>ref|XP_010457463.1| PREDICTED: auxin-responsive protein IAA17 [Camelina sativa]
Length=229

 Score =   257 bits (656),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 141/162 (87%), Gaps = 6/162 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKNVM   QKS++G E        FVKVSMDGAPYLRKV
Sbjct  72   KDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSSGPEAAA-----FVKVSMDGAPYLRKV  126

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            DL++Y +Y++LS+AL+NMFSSFT G YG + GMIDFMNERKLMDL+NS +YVP+YEDKDG
Sbjct  127  DLRMYKSYDELSNALSNMFSSFTMGKYGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDG  186

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DWMLVGDVPW MFVD+CKRLR++KGS+AIGLAPR MEKCKS+
Sbjct  187  DWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>ref|XP_010483317.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=229

 Score =   256 bits (655),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 141/162 (87%), Gaps = 6/162 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKNVM   QKS++G E        FVKVSMDGAPYLRKV
Sbjct  72   KDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSSGPEAAA-----FVKVSMDGAPYLRKV  126

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            DL++Y +Y++LS+AL+NMFSSFT G YG + GMIDFMNERKLMDL+NS +YVP+YEDKDG
Sbjct  127  DLRMYKSYDELSNALSNMFSSFTLGKYGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDG  186

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DWMLVGDVPW MFVD+CKRLR++KGS+AIGLAPR MEKCKS+
Sbjct  187  DWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>gb|KJB11141.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
 gb|KJB11144.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=253

 Score =   257 bits (657),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 140/161 (87%), Gaps = 2/161 (1%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVD  522
            DP KPPAKAQVVGWPPVRS+RKN++A   + ++ EE  +K+    VKVSMDGAPYLRKVD
Sbjct  95   DPAKPPAKAQVVGWPPVRSFRKNMLAATTQKSSSEESGEKAA--LVKVSMDGAPYLRKVD  152

Query  521  LKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  342
            L++Y +Y+QLSDALA MFSSFT GN G+QG+ DFMNE KLMDLLN S+YVPTYEDKDGDW
Sbjct  153  LRMYTSYHQLSDALAKMFSSFTIGNCGSQGIKDFMNESKLMDLLNGSDYVPTYEDKDGDW  212

Query  341  MLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            MLVGDVPWEMFV+SCKRLRI+KG+EAIGLAP+ +EKCK ++
Sbjct  213  MLVGDVPWEMFVESCKRLRIMKGTEAIGLAPKAVEKCKKRS  253



>ref|XP_006406100.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
 dbj|BAJ33997.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47553.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
Length=239

 Score =   256 bits (655),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 141/168 (84%), Gaps = 6/168 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-----FVKVSMDGAP  540
            KD  KPPAKAQVVGWPPVR+YRKN+M   + S   E   +K+G+       VKVSMDGAP
Sbjct  72   KDHSKPPAKAQVVGWPPVRNYRKNIMTQQKTSGVEEASSEKAGSGGGAAALVKVSMDGAP  131

Query  539  YLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYE  360
            YLRKVDLK+Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLM+LLNSSEYVP+YE
Sbjct  132  YLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYE  191

Query  359  DKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEK-CKSKN  219
            DKDGDWMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR MEK CK+++
Sbjct  192  DKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  239



>gb|KHN18836.1| Auxin-induced protein AUX28 [Glycine soja]
Length=246

 Score =   256 bits (655),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 141/162 (87%), Gaps = 2/162 (1%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN-NFVKVSMDGAPYLRKV  525
            DP KPPAKAQVVGWPPVRS+RKN+ A  QKS+ GEE ++ S N +FVKVSMDGAPYLRKV
Sbjct  86   DPAKPPAKAQVVGWPPVRSFRKNMFAA-QKSSGGEESEKSSPNASFVKVSMDGAPYLRKV  144

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LSDAL  MFSSFT GN  +QG  DFMNE KLMDLLNSS+YVPTYED+DGD
Sbjct  145  DLKMYKSYPELSDALGKMFSSFTIGNCESQGFKDFMNESKLMDLLNSSDYVPTYEDRDGD  204

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFV+SCKRLRI+KG EAIGLAPR +EKCK+++
Sbjct  205  WMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAVEKCKNRS  246



>ref|XP_010679165.1| PREDICTED: auxin-responsive protein IAA14-like [Beta vulgaris 
subsp. vulgaris]
Length=278

 Score =   258 bits (658),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 138/165 (84%), Gaps = 5/165 (3%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK----SGNNFVKVSMDGAPYL  534
            D +KPPAKAQVVGWPPVRSYRKN++A  QK+  G + + +     G   VKVSMDGAPYL
Sbjct  115  DSVKPPAKAQVVGWPPVRSYRKNMLAV-QKTTGGPDSETEKPMNGGGALVKVSMDGAPYL  173

Query  533  RKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  354
            RKVDLK+Y +Y  LSDAL  MFSSFT GNYGAQGMIDFMNE KLMDLLN S+YVPTYEDK
Sbjct  174  RKVDLKMYKSYQDLSDALGKMFSSFTLGNYGAQGMIDFMNESKLMDLLNDSDYVPTYEDK  233

Query  353  DGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DGDWMLVGDVPWEMFV+SCKRLRI+KG EA GLAPR MEKCK+++
Sbjct  234  DGDWMLVGDVPWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNRS  278



>ref|XP_006304183.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
 gb|EOA37081.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
Length=224

 Score =   256 bits (653),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 140/162 (86%), Gaps = 6/162 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKNVM   QK+++G E        FVKVSMDGAPYLRKV
Sbjct  67   KDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKASSGPEAAA-----FVKVSMDGAPYLRKV  121

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            DL++Y +Y++LS AL+NMFSSFT G YG + GMIDFMNERKLMDL+NS +YVP+YEDKDG
Sbjct  122  DLRMYKSYDELSTALSNMFSSFTMGKYGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDG  181

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DWMLVGDVPW MFVD+CKRLR++KGS+AIGLAPR MEKCKS+
Sbjct  182  DWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  223



>ref|XP_002883395.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59654.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
Length=242

 Score =   256 bits (655),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 140/170 (82%), Gaps = 9/170 (5%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--------FVKVSMD  549
            KDP KPP KAQVVGWPPVR+YRKN+M   + S   E   +K+G+          VKVSMD
Sbjct  72   KDPSKPPTKAQVVGWPPVRNYRKNMMTQQKTSGVEEASSEKAGSGGGGAAGAGLVKVSMD  131

Query  548  GAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVP  369
            GAPYLRKVDLK+Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLM+LLNSSEYVP
Sbjct  132  GAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVP  191

Query  368  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEK-CKSK  222
            +YEDKDGDWMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR MEK CK++
Sbjct  192  SYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNR  241



>ref|NP_001241599.1| uncharacterized protein LOC100803065 [Glycine max]
 gb|ACU20028.1| unknown [Glycine max]
 gb|KHN03840.1| Auxin-induced protein AUX28 [Glycine soja]
Length=248

 Score =   256 bits (655),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 141/162 (87%), Gaps = 2/162 (1%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN-NFVKVSMDGAPYLRKV  525
            DP KPPAKAQVVGWPPVRS+RKN+ A  QKS+ GEE ++ S N +FVKVSMDGAPYLRKV
Sbjct  88   DPAKPPAKAQVVGWPPVRSFRKNMFAA-QKSSGGEESEKNSPNASFVKVSMDGAPYLRKV  146

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LSDAL  MFSSFT GN  +QG  DFMNE KLMDLLNSS+YVPTYED+DGD
Sbjct  147  DLKMYKSYPELSDALGKMFSSFTIGNCESQGFKDFMNESKLMDLLNSSDYVPTYEDRDGD  206

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFV+SCKRLRI+KG EAIGLAPR +EKCK+++
Sbjct  207  WMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAVEKCKNRS  248



>gb|ABH01143.1| auxin-regulated protein [Populus tomentosa]
Length=258

 Score =   256 bits (655),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 141/166 (85%), Gaps = 7/166 (4%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS-----GNNFVKVSMDGAPY  537
            DP KPP+KAQVVGWPP+RS+RKNVMA  + SN  +EG++ S     G  FVKVSMDGAPY
Sbjct  88   DPAKPPSKAQVVGWPPIRSFRKNVMAVQKNSN--DEGEKASSSGATGAAFVKVSMDGAPY  145

Query  536  LRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYED  357
            LRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QG  +FMNE KL+DLLNSSEYVPTYED
Sbjct  146  LRKVDLKLYKSYRELSDALGKMFSSFTIGNCGSQGTKEFMNESKLIDLLNSSEYVPTYED  205

Query  356  KDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            KDGDWMLVGDVPW MFVDSCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  206  KDGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  251



>gb|KDO68557.1| hypothetical protein CISIN_1g026823mg [Citrus sinensis]
Length=232

 Score =   256 bits (653),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 136/161 (84%), Gaps = 3/161 (2%)
 Frame = -2

Query  698  PIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRKV  525
            P KPPAK QVVGWPPVRS+RKN++   QKS+ GEE D   GNN  FVKVSMDGAPYLRKV
Sbjct  72   PAKPPAKTQVVGWPPVRSFRKNMLGVVQKSS-GEESDMAGGNNAAFVKVSMDGAPYLRKV  130

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DL++YNTY  L  AL  MFSSFT GN G+QGM DFMNE KLMDLLN S+YVPTYEDKDGD
Sbjct  131  DLRMYNTYQDLYHALGKMFSSFTIGNCGSQGMKDFMNESKLMDLLNGSDYVPTYEDKDGD  190

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            WMLVGDVPW MFV+SCKRLRI+KG+EAIGLAPR MEKCK++
Sbjct  191  WMLVGDVPWGMFVESCKRLRIVKGTEAIGLAPRAMEKCKNR  231



>ref|XP_011082603.1| PREDICTED: auxin-responsive protein IAA14-like [Sesamum indicum]
Length=215

 Score =   255 bits (651),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 140/163 (86%), Gaps = 3/163 (2%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRK  528
            D +KPPAKAQVVGWPPVRS+RKN+MA  +KS + E+ ++ SG    FVKVSMDGAPYLRK
Sbjct  54   DSVKPPAKAQVVGWPPVRSFRKNIMAV-KKSGDSEDNEKGSGGGGAFVKVSMDGAPYLRK  112

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            +DLK+Y TY +LSDAL  MFSSFT G    QGM+DFMNE KLMDLLNSSEYVPTYEDKDG
Sbjct  113  IDLKMYKTYQELSDALGKMFSSFTMGKCDTQGMMDFMNESKLMDLLNSSEYVPTYEDKDG  172

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPW+MFV+SCKRLR++KG+EA GLAPR MEKCKS++
Sbjct  173  DWMLVGDVPWQMFVESCKRLRVMKGTEAKGLAPRAMEKCKSRS  215



>gb|EYU33008.1| hypothetical protein MIMGU_mgv1a012321mg [Erythranthe guttata]
Length=254

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 137/156 (88%), Gaps = 2/156 (1%)
 Frame = -2

Query  683  AKAQVVGWPPVRSYRKNVMAHHQK--SNNGEEGDQKSGNNFVKVSMDGAPYLRKVDLKVY  510
            AKAQVVGWPPVRS+RKN++  HQK  S++ E G   +   FVKVSMDGAPYLRKVDLK+Y
Sbjct  98   AKAQVVGWPPVRSFRKNIVMSHQKNSSSDEEAGGGGAAAAFVKVSMDGAPYLRKVDLKMY  157

Query  509  NTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVG  330
             +Y + SDALA MFSSFT G YG++GMIDFMNERKLMD+LNS+EYVPTYEDKDGDWMLVG
Sbjct  158  KSYQEFSDALAKMFSSFTMGKYGSEGMIDFMNERKLMDVLNSTEYVPTYEDKDGDWMLVG  217

Query  329  DVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DVPWEMFV+SCKRLRI+KGSEAIGLAPR MEKCKS+
Sbjct  218  DVPWEMFVNSCKRLRIMKGSEAIGLAPRAMEKCKSR  253



>ref|XP_006420094.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 ref|XP_006489503.1| PREDICTED: auxin-responsive protein IAA14-like [Citrus sinensis]
 gb|ESR33334.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 gb|KDO53918.1| hypothetical protein CISIN_1g026811mg [Citrus sinensis]
Length=232

 Score =   255 bits (652),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 132/162 (81%), Gaps = 15/162 (9%)
 Frame = -2

Query  704  KDPIKPPA-KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRK  528
            KDP KP A KAQVVGWPPVRSYRKN MA                  FVKV MDGAPYLRK
Sbjct  84   KDPAKPSANKAQVVGWPPVRSYRKNAMAETAA--------------FVKVCMDGAPYLRK  129

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK Y +Y +LSDALA MFSSFT GNYG+QGMIDFMNE KLMDLLNSS+YVPTYEDKDG
Sbjct  130  VDLKTYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDG  189

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DWMLVGDVPWEMFVDSCKR+RI+KGSEAIGLAPR MEKCKS+
Sbjct  190  DWMLVGDVPWEMFVDSCKRMRIMKGSEAIGLAPRAMEKCKSR  231



>ref|XP_010475075.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=230

 Score =   255 bits (651),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 140/162 (86%), Gaps = 6/162 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKNVM   QK ++G E        FVKVSMDGAPYLRKV
Sbjct  73   KDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKPSSGPEAAA-----FVKVSMDGAPYLRKV  127

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            DL++Y +Y++LS+AL+NMFSSFT G YG + GMIDFMNERKLMDL+NS +YVP+YEDKDG
Sbjct  128  DLRMYKSYDELSNALSNMFSSFTMGKYGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDG  187

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DWMLVGDVPW MFVD+CKRLR++KGS+AIGLAPR MEKCKS+
Sbjct  188  DWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  229



>ref|XP_011042427.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 138/163 (85%), Gaps = 2/163 (1%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRK  528
            DP KPPAKAQVVGWPPVRS+RKN++A  + S + E  D+  G N  FVKVSMDGAPYLRK
Sbjct  73   DPAKPPAKAQVVGWPPVRSFRKNMLAVQKSSTDQESTDKVPGGNATFVKVSMDGAPYLRK  132

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y TY++LSDAL  MFSSFT GN G+ GM DF+NE KL+DLL  ++YVPTYEDKDG
Sbjct  133  VDLKMYKTYHELSDALGEMFSSFTIGNCGSHGMKDFLNESKLIDLLTGTDYVPTYEDKDG  192

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPW+MFV+SCKRLRI+KG+EA GLAPR MEKCKS++
Sbjct  193  DWMLVGDVPWDMFVESCKRLRIMKGTEATGLAPRAMEKCKSRS  235



>ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum]
 gb|AEX00359.1| IAA16 [Solanum lycopersicum]
Length=251

 Score =   255 bits (652),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 135/162 (83%), Gaps = 1/162 (1%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNN-GEEGDQKSGNNFVKVSMDGAPYLRKV  525
            DP KPPAKAQVVGWPPVRS+RKNVM   + +   GE     +G  FVKVS+DGAPYLRKV
Sbjct  90   DPAKPPAKAQVVGWPPVRSFRKNVMTVQKNTTGAGEISGTGTGAAFVKVSVDGAPYLRKV  149

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y QLSDAL  MFSSFT GN G QG  DFMNE KL+DLLN S+YVPTYEDKDGD
Sbjct  150  DLKMYKSYQQLSDALGKMFSSFTIGNCGTQGFKDFMNESKLIDLLNGSDYVPTYEDKDGD  209

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  210  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  251



>ref|XP_006383686.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|ERP61483.1| auxin-induced protein aux28 [Populus trichocarpa]
Length=237

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 139/163 (85%), Gaps = 2/163 (1%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRK  528
            DP KPPAKAQVVGWPPVRS+RKN++A  + S + E  D+  G N  FVKVSMDGAPYLRK
Sbjct  73   DPAKPPAKAQVVGWPPVRSFRKNMLAVQKSSTDQESTDKVPGGNATFVKVSMDGAPYLRK  132

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y TY++LSDAL  MFSSFT GN G+ GM DF+NE KL+DLLN ++YVPTYEDKDG
Sbjct  133  VDLKMYKTYHELSDALGKMFSSFTIGNCGSHGMKDFLNESKLIDLLNGTDYVPTYEDKDG  192

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPW+MFV+SCKRLRI+KG+EA GLAPR MEKCK+++
Sbjct  193  DWMLVGDVPWDMFVESCKRLRIMKGTEATGLAPRAMEKCKNRS  235



>gb|KDP23667.1| hypothetical protein JCGZ_23500 [Jatropha curcas]
Length=248

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 141/169 (83%), Gaps = 10/169 (6%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--------FVKVSMDG  546
            DP KPPAKAQVVGWPP+RS+RKNVM+  +  +NG+E ++ +           FVKVSMDG
Sbjct  82   DPAKPPAKAQVVGWPPIRSFRKNVMSVQK--SNGDEAEKAATATAAGSSSAAFVKVSMDG  139

Query  545  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPT  366
            APYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DFMNE KL+DLLN SEYVPT
Sbjct  140  APYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPT  199

Query  365  YEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            YEDKDGDWMLVGDVPWEMF+DSCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  200  YEDKDGDWMLVGDVPWEMFIDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  248



>ref|XP_010278165.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=251

 Score =   255 bits (652),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 138/162 (85%), Gaps = 3/162 (2%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-FVKVSMDGAPYLRKV  525
            D  KPPAKAQVVGWPPVRS+RKN+++  + S   EEG++ S +  FVKVSMDGAPYLRKV
Sbjct  92   DLAKPPAKAQVVGWPPVRSFRKNILSVQKSST--EEGEKVSSSAAFVKVSMDGAPYLRKV  149

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LSDAL  MFSSFT GN G QGM DFMNE KLMDLLN SEYVPTYEDKDGD
Sbjct  150  DLKMYKSYQELSDALGKMFSSFTIGNCGPQGMKDFMNESKLMDLLNGSEYVPTYEDKDGD  209

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR +EKCK ++
Sbjct  210  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKKRS  251



>ref|NP_171921.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 sp|P93830.2|IAA17_ARATH RecName: Full=Auxin-responsive protein IAA17; AltName: Full=Auxin 
response 3; AltName: Full=Indoleacetic acid-induced protein 
17 [Arabidopsis thaliana]
 gb|AAG53997.1|AF336916_1 auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAB84354.1| IAA17 [Arabidopsis thaliana]
 gb|AAC39439.1| IAA17/AXR3 protein [Arabidopsis thaliana]
 gb|AAB70451.2| Identical to Arabidopsis gb|AF040632 and gb|U49073 IAA17/AXR3 
gene. ESTs gb|H36782 and gb|F14074 come from this gene [Arabidopsis 
thaliana]
 gb|AAL49831.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAM51258.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AEE27674.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 gb|AGZ13682.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17]
 gb|AGZ59820.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17-spo5DSR]
Length=229

 Score =   254 bits (649),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 140/162 (86%), Gaps = 6/162 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKNVM   QKS+ G E        FVKVSMDGAPYLRK+
Sbjct  72   KDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSGGPEAAA-----FVKVSMDGAPYLRKI  126

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            DL++Y +Y++LS+AL+NMFSSFT G +G + GMIDFMNERKLMDL+NS +YVP+YEDKDG
Sbjct  127  DLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDG  186

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DWMLVGDVPW MFVD+CKRLR++KGS+AIGLAPR MEKCKS+
Sbjct  187  DWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>gb|AAM64837.1| putative auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
Length=228

 Score =   254 bits (649),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 140/162 (86%), Gaps = 6/162 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKNVM   QKS+ G E        FVKVSMDGAPYLRK+
Sbjct  71   KDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSGGPEAAA-----FVKVSMDGAPYLRKI  125

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            DL++Y +Y++LS+AL+NMFSSFT G +G + GMIDFMNERKLMDL+NS +YVP+YEDKDG
Sbjct  126  DLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDG  185

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DWMLVGDVPW MFVD+CKRLR++KGS+AIGLAPR MEKCKS+
Sbjct  186  DWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  227



>ref|XP_011079949.1| PREDICTED: auxin-induced protein AUX28-like [Sesamum indicum]
Length=244

 Score =   255 bits (651),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 140/163 (86%), Gaps = 3/163 (2%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRK  528
            D +KPPAKAQVVGWPPVRS+RKNVMA  QK ++ EE ++ SG    FVKVSMDGAPYLRK
Sbjct  83   DSVKPPAKAQVVGWPPVRSFRKNVMAV-QKVSDSEETEKGSGGAAAFVKVSMDGAPYLRK  141

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y +Y +LSDAL  MFSSFT G   +QGM+DFMNE KLMDLLN S+YVPTYEDKDG
Sbjct  142  VDLKMYKSYQELSDALGKMFSSFTIGKCDSQGMMDFMNESKLMDLLNGSDYVPTYEDKDG  201

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPWEMFV+SCKRLRI+KG+EA GLAPR MEKCKS++
Sbjct  202  DWMLVGDVPWEMFVESCKRLRIMKGTEAKGLAPRAMEKCKSRS  244



>ref|XP_010936171.1| PREDICTED: auxin-responsive protein IAA30-like [Elaeis guineensis]
Length=251

 Score =   255 bits (651),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 141/165 (85%), Gaps = 4/165 (2%)
 Frame = -2

Query  701  DPIKPPA-KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-FVKVSMDGAPYLRK  528
            DP KPPA KAQVVGWPPVRS+RKN+MA H    + E G++ S +  FVKVSMDGAPYLRK
Sbjct  87   DPEKPPAPKAQVVGWPPVRSFRKNMMASHSDKGSKEAGEKSSNSAAFVKVSMDGAPYLRK  146

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGM--IDFMNERKLMDLLNSSEYVPTYEDK  354
            VDLK+Y++Y +LS AL  MFSSFT+GN G+QGM   DFMNE KLMDLLN SEYVPTYEDK
Sbjct  147  VDLKMYSSYKELSMALEKMFSSFTSGNCGSQGMNGRDFMNESKLMDLLNGSEYVPTYEDK  206

Query  353  DGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DGDWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCK+++
Sbjct  207  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  251



>ref|XP_010087762.1| Auxin-responsive protein IAA7 [Morus notabilis]
 gb|EXB29843.1| Auxin-responsive protein IAA7 [Morus notabilis]
Length=304

 Score =   256 bits (655),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 133/159 (84%), Gaps = 6/159 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN------FVKVSMDGA  543
            KDP KPPAKAQVVGWPPVRSYRKN+MA    +N      +K+ ++      FVKV MDGA
Sbjct  88   KDPAKPPAKAQVVGWPPVRSYRKNIMAQKMSTNEESSPHEKTSSSSNSAGAFVKVCMDGA  147

Query  542  PYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTY  363
            PYLRKVDLK+Y +Y +LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLNSSEYVPTY
Sbjct  148  PYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTY  207

Query  362  EDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPR  246
            EDKDGDWMLVGDVPWEMFVDSCKRLRI+KGSEAIGL  R
Sbjct  208  EDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLGLR  246



>ref|XP_007050421.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
 gb|EOX94578.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
Length=305

 Score =   256 bits (655),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVD  522
            DP KPPAKAQVVGWPPVRS+RKN+ A  + S+   E        FVKVSMDGAPYLRKVD
Sbjct  145  DPAKPPAKAQVVGWPPVRSFRKNMFATQKSSSEESEKGGAGNAAFVKVSMDGAPYLRKVD  204

Query  521  LKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  342
            L++Y TY +LSDALA MFSSFT GN G+QG+ DFMNE KLMDLLN S+YVPTYEDKDGDW
Sbjct  205  LRMYKTYLELSDALAKMFSSFTIGNCGSQGVKDFMNESKLMDLLNGSDYVPTYEDKDGDW  264

Query  341  MLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            MLVGDVPW+MFV+SCKRLRI+KG+EAIGLAPR MEKCK+++
Sbjct  265  MLVGDVPWDMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  305



>gb|ACJ83896.1| unknown [Medicago truncatula]
 gb|AFK48514.1| unknown [Medicago truncatula]
 gb|KEH42620.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=245

 Score =   254 bits (649),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 143/164 (87%), Gaps = 7/164 (4%)
 Frame = -2

Query  692  KPPAKAQVVGWPPVRSYRKNVMAHHQKSNNG-EEGDQKSGNN----FVKVSMDGAPYLRK  528
            KPPAKAQVVGWPPVRS+RKN+ A  QKSN G EE ++K+ NN    FVKVSMDGAPYLRK
Sbjct  83   KPPAKAQVVGWPPVRSFRKNMFAA-QKSNEGSEESEKKNSNNNPISFVKVSMDGAPYLRK  141

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNER-KLMDLLNSSEYVPTYEDKD  351
            VDLK+Y +Y +LSDALA MF+SFTTGN  +QG+ DFMNE  KLMDLLNSS+YVPTYEDKD
Sbjct  142  VDLKMYKSYPELSDALAKMFNSFTTGNCESQGIKDFMNESNKLMDLLNSSDYVPTYEDKD  201

Query  350  GDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            GDWMLVGDVPWEMF+DSCKRLRI+KG EAIGLAPR MEKCK+++
Sbjct  202  GDWMLVGDVPWEMFIDSCKRLRIMKGKEAIGLAPRAMEKCKNRS  245



>gb|AEE25650.1| auxin-responsive protein [Gossypium hirsutum]
Length=253

 Score =   254 bits (650),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 139/161 (86%), Gaps = 2/161 (1%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVD  522
            DP KPPAKAQVVGWPPVRS+RKN++A   + ++ EE  +K+    VKVSMDGAPYLRKVD
Sbjct  95   DPAKPPAKAQVVGWPPVRSFRKNMLATTTQKSSSEESGEKAA--LVKVSMDGAPYLRKVD  152

Query  521  LKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  342
            L++Y +Y+QLSDALA MFSSFT GN G+QGM DFMNE KLMDLLN S+YVPTYEDKDGD 
Sbjct  153  LRMYTSYHQLSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDLLNGSDYVPTYEDKDGDR  212

Query  341  MLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            MLVGDVPWEMFV+SCKRLRI+KG+EAIGLAP+ +EKCK ++
Sbjct  213  MLVGDVPWEMFVESCKRLRIMKGTEAIGLAPKAVEKCKKRS  253



>gb|ACU18407.1| unknown [Glycine max]
Length=246

 Score =   254 bits (649),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 140/162 (86%), Gaps = 2/162 (1%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN-NFVKVSMDGAPYLRKV  525
            DP KPPAKAQVVGWPPVRS+RKN+ A  QKS+ GEE ++ S N +FVKVSMDGAPYLRKV
Sbjct  86   DPAKPPAKAQVVGWPPVRSFRKNMFAA-QKSSGGEESEKSSPNASFVKVSMDGAPYLRKV  144

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LSDAL  MFSSFT GN  +QG  DFMNE KLMDLLNSS+YVPTYED+DGD
Sbjct  145  DLKMYKSYPELSDALGKMFSSFTIGNCESQGFKDFMNESKLMDLLNSSDYVPTYEDRDGD  204

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFV+SCKRL I+KG EAIGLAPR +EKCK+++
Sbjct  205  WMLVGDVPWEMFVESCKRLHIMKGKEAIGLAPRAVEKCKNRS  246



>gb|EYU46510.1| hypothetical protein MIMGU_mgv1a013084mg [Erythranthe guttata]
Length=231

 Score =   253 bits (647),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVD  522
            D +KPPAKAQVVGWPPVRS+RKNVMA  +++++ E      G  FVKVSMDGAPYLRKVD
Sbjct  71   DSVKPPAKAQVVGWPPVRSFRKNVMAVQKRTDSDEAEKGTGGAAFVKVSMDGAPYLRKVD  130

Query  521  LKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  342
            LK+Y TY +LSDAL  MFSSFT G   +QGM+DFM+E KLMDLLNSS+YVPTYEDKDGDW
Sbjct  131  LKMYKTYKELSDALGKMFSSFTIGKCDSQGMMDFMSESKLMDLLNSSDYVPTYEDKDGDW  190

Query  341  MLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            MLVGDVPWEMFV SCKRLRI+KG+EA GLAP+ M+KCK+++
Sbjct  191  MLVGDVPWEMFVGSCKRLRIMKGTEAKGLAPKAMDKCKTRS  231



>ref|NP_001275398.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
 gb|ACV31209.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
Length=249

 Score =   254 bits (649),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNN-GEEGDQKSGNNFVKVSMDGAPYLRKV  525
            DP K PAKAQVVGWPPVRS+RKNVM   + +   GE     +G  FVKVS+DGAPYLRKV
Sbjct  88   DPAKSPAKAQVVGWPPVRSFRKNVMTVQKNTTGAGESSGTGTGAAFVKVSVDGAPYLRKV  147

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y QLSDAL  MFSSFT GN G QG  DFMNE KL+DLLN S+YVPTYEDKDGD
Sbjct  148  DLKMYKSYQQLSDALGKMFSSFTIGNCGTQGFKDFMNESKLIDLLNGSDYVPTYEDKDGD  207

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  208  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  249



>gb|EPS64756.1| hypothetical protein M569_10024, partial [Genlisea aurea]
Length=214

 Score =   253 bits (645),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 139/160 (87%), Gaps = 7/160 (4%)
 Frame = -2

Query  692  KPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVDLKV  513
            KPP+KAQVVGWPPVRS+RKNV+ + +KS++ EE    S  ++VKVSMDGAPYLRKVDLK 
Sbjct  60   KPPSKAQVVGWPPVRSFRKNVICN-RKSSSVEE----STGSYVKVSMDGAPYLRKVDLKT  114

Query  512  YNTYNQLSDALANMFSSFTT--GNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWM  339
            Y +Y QLSDALA MFSSFT   GNYG +GMIDFMNE K+M LLNSSEYVPTYEDKDGDWM
Sbjct  115  YGSYQQLSDALAKMFSSFTMNEGNYGVEGMIDFMNESKVMHLLNSSEYVPTYEDKDGDWM  174

Query  338  LVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            LVGDVPWEMFV SCKRLRI+KGSEAIGLAPR MEKCKS+N
Sbjct  175  LVGDVPWEMFVCSCKRLRIMKGSEAIGLAPRAMEKCKSRN  214



>ref|NP_001266039.1| IAA7 protein [Solanum lycopersicum]
 gb|AEX00351.1| IAA7 [Solanum lycopersicum]
Length=218

 Score =   253 bits (646),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 140/162 (86%), Gaps = 4/162 (2%)
 Frame = -2

Query  692  KPPAKAQVVGWPPVRSYRKNVMAHH--QKSNNGEEGDQKSGNN--FVKVSMDGAPYLRKV  525
            KPP KAQVVGWPPVRS+RKN+++      +NN EE  +K      FVKVSMDGAPYLRKV
Sbjct  57   KPPTKAQVVGWPPVRSFRKNMLSQKGNNNNNNNEEISEKDEKTIAFVKVSMDGAPYLRKV  116

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y QLS +L NMFSSFT GNYG+QGMIDFMNERKLMD+LNSS+YVPTYEDKDGD
Sbjct  117  DLKMYKSYQQLSHSLTNMFSSFTMGNYGSQGMIDFMNERKLMDVLNSSDYVPTYEDKDGD  176

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPW+MFVDSCKRLRI+KGSEAIGLAPR MEKCK+++
Sbjct  177  WMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  218



>emb|CAH59413.1| auxin resistance protein [Plantago major]
Length=227

 Score =   253 bits (646),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 135/160 (84%), Gaps = 3/160 (2%)
 Frame = -2

Query  698  PIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVDL  519
            P+KPPAKAQVVGWPPVR++RKNVMA  QK+   EE    +   FVKVSMDGAPYLRKVDL
Sbjct  71   PVKPPAKAQVVGWPPVRNFRKNVMAV-QKTEKAEESGGSAA--FVKVSMDGAPYLRKVDL  127

Query  518  KVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWM  339
            K+Y TY +LSDAL  MFSSFT     AQGM+DFMNE KLMDLLN S+YVPTYEDKDGDWM
Sbjct  128  KMYKTYEELSDALGKMFSSFTMSKCDAQGMMDFMNESKLMDLLNGSDYVPTYEDKDGDWM  187

Query  338  LVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            LVGDVPWEMFV SCKRLRI+KG+EAIGLAPR MEKCKS++
Sbjct  188  LVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRAMEKCKSRS  227



>ref|XP_002889499.1| hypothetical protein ARALYDRAFT_470401 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65758.1| hypothetical protein ARALYDRAFT_470401 [Arabidopsis lyrata subsp. 
lyrata]
Length=229

 Score =   253 bits (646),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 140/162 (86%), Gaps = 6/162 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPP+KAQVVGWPPVRSYRKNVM   QKS+ G E        FVKVSMDGAPYLRKV
Sbjct  72   KDPAKPPSKAQVVGWPPVRSYRKNVMVSCQKSSGGPEAAA-----FVKVSMDGAPYLRKV  126

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            DL++Y +Y++LS+AL+NMFSSFT G +G + GMIDFMNERKLMDL+NS +YVP+YEDKDG
Sbjct  127  DLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDG  186

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DWMLVGDVPW MFVD+CKRLR++KGS+AIGLAPR MEKCKS+
Sbjct  187  DWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>gb|AAM96891.1| auxin-responsive protein IAA1 [Mirabilis jalapa]
Length=194

 Score =   251 bits (642),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 134/162 (83%), Gaps = 2/162 (1%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRK  528
            D  KPPAKAQVVGWPPVRSYRKN++A  + +   E   +K   N   VKVSMDGAPYLRK
Sbjct  32   DLAKPPAKAQVVGWPPVRSYRKNMLAVQKSTGAPESESEKPAANGGLVKVSMDGAPYLRK  91

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y +Y  LSDAL  MFSSFT GNYG+QGMIDFMNE KLMDL+N S+YVPTYEDKDG
Sbjct  92   VDLKLYKSYQDLSDALGKMFSSFTLGNYGSQGMIDFMNESKLMDLINGSDYVPTYEDKDG  151

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DWMLVGDVPWEMFV+SCKRLRI+KG EA GLAPR MEKCK++
Sbjct  152  DWMLVGDVPWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNR  193



>gb|KJB42200.1| hypothetical protein B456_007G141900 [Gossypium raimondii]
Length=235

 Score =   253 bits (645),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 143/163 (88%), Gaps = 5/163 (3%)
 Frame = -2

Query  701  DPIKPP-AKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            DP KPP AKAQVVGWPPVRS+RKN++A  QKS+  E+  +K+   FVKVSMDGAPYLRKV
Sbjct  76   DPAKPPPAKAQVVGWPPVRSFRKNMLAT-QKSSASEDSGEKAA--FVKVSMDGAPYLRKV  132

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMI-DFMNERKLMDLLNSSEYVPTYEDKDG  348
            DL++Y TY QLSDALA MFSSFT GN G+QG++ DFMNE KLMDLLN S+YVPTYEDKDG
Sbjct  133  DLRMYKTYQQLSDALAKMFSSFTIGNCGSQGLLKDFMNESKLMDLLNGSDYVPTYEDKDG  192

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPWEMF++SCKRLRI+KG+EAIGLAPR MEKCK+++
Sbjct  193  DWMLVGDVPWEMFIESCKRLRIMKGTEAIGLAPRAMEKCKNRS  235



>gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tabacum]
Length=240

 Score =   253 bits (646),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 134/161 (83%), Gaps = 1/161 (1%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVD  522
            DP KPPAKAQVVGWPPVRS+RKNV+   QK++ G       G  FVKVS+DGAPYLRKVD
Sbjct  81   DPAKPPAKAQVVGWPPVRSFRKNVLTV-QKNSTGNGESSGGGAAFVKVSVDGAPYLRKVD  139

Query  521  LKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  342
            LK+Y +Y QLSDAL  MFSSFT GN G  G  DFMNE KL+DLLN S+YVPTYEDKDGDW
Sbjct  140  LKMYKSYQQLSDALGKMFSSFTIGNCGTHGFKDFMNESKLIDLLNGSDYVPTYEDKDGDW  199

Query  341  MLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            MLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  200  MLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  240



>ref|XP_008382962.1| PREDICTED: auxin-induced protein AUX28-like [Malus domestica]
Length=257

 Score =   253 bits (647),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 139/167 (83%), Gaps = 6/167 (4%)
 Frame = -2

Query  701  DPIKPPA-KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQ--KSGNN---FVKVSMDGAP  540
            DP KPPA KAQVVGWPPVRS+RKN+    QKS N  E +Q  K  NN    VKVSMDGAP
Sbjct  91   DPAKPPAAKAQVVGWPPVRSFRKNMFTAVQKSTNDGESEQMNKGSNNNAVLVKVSMDGAP  150

Query  539  YLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYE  360
            YLRKVDLK+Y +Y +LSDALA MFSSFT GN G+QGM DFMNERKLMD+LN S+Y+PTYE
Sbjct  151  YLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNERKLMDVLNGSDYIPTYE  210

Query  359  DKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DKDGDWMLVGDVPWEMFV+SCKRLRI+K  EA+GLAPR MEKCK+++
Sbjct  211  DKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNRS  257



>gb|ACL81167.1| auxin-responsive protein IAA1, partial [Mirabilis jalapa]
Length=263

 Score =   253 bits (647),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 134/162 (83%), Gaps = 2/162 (1%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRK  528
            D  KPPAKAQVVGWPPVRSYRKN++A  + +   E   +K   N   VKVSMDGAPYLRK
Sbjct  101  DLAKPPAKAQVVGWPPVRSYRKNMLAVQKSTGAPESESEKPAANGGLVKVSMDGAPYLRK  160

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y +Y  LSDAL  MFSSFT GNYG+QGMIDFMNE KLMDL+N S+YVPTYEDKDG
Sbjct  161  VDLKLYKSYQDLSDALGKMFSSFTLGNYGSQGMIDFMNESKLMDLINGSDYVPTYEDKDG  220

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DWMLVGDVPWEMFV+SCKRLRI+KG EA GLAPR MEKCK++
Sbjct  221  DWMLVGDVPWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNR  262



>ref|XP_006432923.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
 ref|XP_006471684.1| PREDICTED: auxin-responsive protein IAA16-like isoform X1 [Citrus 
sinensis]
 gb|ESR46163.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
Length=245

 Score =   253 bits (646),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 142/167 (85%), Gaps = 9/167 (5%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN------FVKVSMDGAP  540
            D  KPPAKAQVVGWPPVRS+RKN+MA  QK N  EEGD K+ ++      FVKVSMDGAP
Sbjct  82   DLSKPPAKAQVVGWPPVRSFRKNIMAV-QKDN--EEGDNKASSSSSSNVAFVKVSMDGAP  138

Query  539  YLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYE  360
            YLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DFMNE KL+DLLN S+YVPTYE
Sbjct  139  YLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYE  198

Query  359  DKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DKDGDWMLVGDVPW+MFVDSCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  199  DKDGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  245



>ref|XP_002531288.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
 gb|EEF31101.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
Length=257

 Score =   253 bits (646),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 141/175 (81%), Gaps = 16/175 (9%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK--------------SGNNFV  564
            DP KPPAKAQVVGWPP+RS+RKNVMA  +  N+ +EG++               +   FV
Sbjct  85   DPAKPPAKAQVVGWPPIRSFRKNVMAVQK--NSTDEGEKGTATSAPAAAATSGSTSAAFV  142

Query  563  KVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNS  384
            KVSMDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DFMNE KL+DLLN 
Sbjct  143  KVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNG  202

Query  383  SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            SEYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  203  SEYVPTYEDKDGDWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAVEKCKNRS  257



>ref|XP_006418149.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
 dbj|BAJ33922.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36502.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
Length=226

 Score =   252 bits (643),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 137/162 (85%), Gaps = 10/162 (6%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKNV+   QKS             FVKVSMDGAPYLRKV
Sbjct  73   KDPAKPPAKAQVVGWPPVRSYRKNVLVSSQKSEAAA---------FVKVSMDGAPYLRKV  123

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            DLK+Y +Y++LS+AL+NMFSSFT G YG + GMIDFMNERKLMDL+NS +YVP+YEDKDG
Sbjct  124  DLKMYKSYDELSNALSNMFSSFTMGKYGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDG  183

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DWMLVGDVPW MFVD+CKRLR++KGS+AIGLAPR MEKCKS+
Sbjct  184  DWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  225



>ref|XP_009761467.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana sylvestris]
Length=240

 Score =   252 bits (644),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 134/161 (83%), Gaps = 1/161 (1%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVD  522
            DP KPPAKAQVVGWPPVRS+RKNV+   QK++ G       G  FVKVS+DGAPYLRKVD
Sbjct  81   DPAKPPAKAQVVGWPPVRSFRKNVLTV-QKNSTGNGESSGGGAAFVKVSVDGAPYLRKVD  139

Query  521  LKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  342
            LK+Y +Y QLSDAL  MFSSFT GN G  G  DFMNE KL+DLLN S+YVPTYEDKDGDW
Sbjct  140  LKMYKSYQQLSDALGKMFSSFTIGNCGTHGFKDFMNESKLIDLLNGSDYVPTYEDKDGDW  199

Query  341  MLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            MLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  200  MLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  240



>ref|XP_010025014.1| PREDICTED: auxin-responsive protein IAA16-like [Eucalyptus grandis]
 gb|KCW61599.1| hypothetical protein EUGRSUZ_H04335 [Eucalyptus grandis]
Length=270

 Score =   253 bits (646),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 135/165 (82%), Gaps = 7/165 (4%)
 Frame = -2

Query  692  KPPAKAQVVGWPPVRSYRKNVMA-------HHQKSNNGEEGDQKSGNNFVKVSMDGAPYL  534
            KPPAKAQVVGWPPVRS+RKN+MA         +K  +   G   SG  FVKVSMDGAPYL
Sbjct  106  KPPAKAQVVGWPPVRSFRKNIMAVQKSGSDEAEKGGSSGNGAATSGAAFVKVSMDGAPYL  165

Query  533  RKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  354
            RKVDLK+Y +Y  LSDALA MFSSFT GN G+ GM DFMNE KL+DLLN S+YVPTYEDK
Sbjct  166  RKVDLKLYKSYQDLSDALAKMFSSFTIGNCGSGGMKDFMNESKLIDLLNGSDYVPTYEDK  225

Query  353  DGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DGDWMLVGDVPW+MFVDSCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  226  DGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  270



>ref|XP_009354870.1| PREDICTED: auxin-induced protein AUX28-like [Pyrus x bretschneideri]
Length=257

 Score =   252 bits (644),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 137/164 (84%), Gaps = 6/164 (4%)
 Frame = -2

Query  701  DPIKPPA-KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQ--KSGNN---FVKVSMDGAP  540
            DP KPPA KAQVVGWPPVRS+RKN+    QKS+N  E +Q  K GNN    VKVSMDGAP
Sbjct  91   DPAKPPAAKAQVVGWPPVRSFRKNMFTAVQKSSNDGESEQMNKGGNNNAVLVKVSMDGAP  150

Query  539  YLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYE  360
            YLRKVDLK+Y +Y +LSDALA MFSSFT GN G+QGM DFMNE KLMD+LN S+Y+PTYE
Sbjct  151  YLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVLNGSDYIPTYE  210

Query  359  DKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCK  228
            DKDGDWMLVGDVPWEMFV+SCKRLRI+K  EA+GLAPR MEKCK
Sbjct  211  DKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCK  254



>ref|XP_009610435.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana tomentosiformis]
Length=240

 Score =   251 bits (642),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 135/162 (83%), Gaps = 3/162 (2%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSN-NGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            DP KPPAKAQVVGWPPVRS+RKNV+   +KS  NGE      G  FVKVS+DGAPYLRKV
Sbjct  81   DPSKPPAKAQVVGWPPVRSFRKNVLNVQKKSTGNGES--SGGGAAFVKVSVDGAPYLRKV  138

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y QLSDAL  MFSSFT GN G  G  DFMNE KL+DLLN S+YVPTYEDKDGD
Sbjct  139  DLKMYKSYQQLSDALGKMFSSFTIGNCGNHGFKDFMNESKLIDLLNGSDYVPTYEDKDGD  198

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  199  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  240



>gb|KDO48905.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=245

 Score =   251 bits (642),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 142/167 (85%), Gaps = 9/167 (5%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN------FVKVSMDGAP  540
            D  KPPAK+QVVGWPPVRS+RKN+MA  QK N  EEGD K+ ++      FVKVSMDGAP
Sbjct  82   DLSKPPAKSQVVGWPPVRSFRKNIMAV-QKDN--EEGDNKASSSSSSNVAFVKVSMDGAP  138

Query  539  YLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYE  360
            YLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DFMNE KL+DLLN S+YVPTYE
Sbjct  139  YLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYE  198

Query  359  DKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DKDGDWMLVGDVPW+MFVDSCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  199  DKDGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  245



>ref|XP_002302075.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|EEE81348.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|AFZ78622.1| hypothetical protein [Populus tomentosa]
Length=237

 Score =   251 bits (641),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 140/163 (86%), Gaps = 3/163 (2%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRK  528
            DP KPPAKAQVVGWPPVRS+RKN++A  QKS+  +E ++  G N  FVKVSMDGAPYLRK
Sbjct  74   DPAKPPAKAQVVGWPPVRSFRKNMLAV-QKSSTDQECEKVPGGNATFVKVSMDGAPYLRK  132

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y TY +LSDAL  MFSSFT GN G+ G+ DF+NE KL+DLLN ++YVPTYEDKDG
Sbjct  133  VDLKMYKTYQELSDALGKMFSSFTIGNCGSHGLKDFLNESKLIDLLNGTDYVPTYEDKDG  192

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPW+MFV+SCKRLRI+KG+EA GLAPR MEKCK+++
Sbjct  193  DWMLVGDVPWDMFVESCKRLRIMKGTEATGLAPRAMEKCKNRS  235



>gb|AAC39440.1| IAA17/AXR3-1 protein [Arabidopsis thaliana]
Length=229

 Score =   251 bits (640),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 139/162 (86%), Gaps = 6/162 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWP VRSYRKNVM   QKS+ G E        FVKVSMDGAPYLRK+
Sbjct  72   KDPAKPPAKAQVVGWPLVRSYRKNVMVSCQKSSGGPEAAA-----FVKVSMDGAPYLRKI  126

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            DL++Y +Y++LS+AL+NMFSSFT G +G + GMIDFMNERKLMDL+NS +YVP+YEDKDG
Sbjct  127  DLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDG  186

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DWMLVGDVPW MFVD+CKRLR++KGS+AIGLAPR MEKCKS+
Sbjct  187  DWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>ref|XP_008372303.1| PREDICTED: auxin-induced protein AUX28-like [Malus domestica]
Length=257

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 139/167 (83%), Gaps = 6/167 (4%)
 Frame = -2

Query  701  DPIKPPA-KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQ--KSGNN---FVKVSMDGAP  540
            DP KPPA KAQVVGWPPVRS+RKN+    QKS+N  E +Q  K GNN    VKVSMDGAP
Sbjct  91   DPAKPPAAKAQVVGWPPVRSFRKNMFTGVQKSSNDGESEQMNKGGNNNAVLVKVSMDGAP  150

Query  539  YLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYE  360
            YLRKVDLK+Y +Y +LSDALA MFSSFT GN G+QGM DFMNE KLMD+LN S+Y PTYE
Sbjct  151  YLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVLNGSDYTPTYE  210

Query  359  DKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DKDGDWMLVGDVPWEMFV+SCKRLRI+K  EA+GLAPR MEKCK+++
Sbjct  211  DKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNRS  257



>gb|AFK42876.1| unknown [Medicago truncatula]
 gb|KEH23853.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=250

 Score =   251 bits (641),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVD  522
            DP KPPAKAQVVGWPPVRSYRKN++A  +  +        +   FVKVSMDGAPYLRKVD
Sbjct  90   DPAKPPAKAQVVGWPPVRSYRKNMLAMQKSESEKNSSSNFNAITFVKVSMDGAPYLRKVD  149

Query  521  LKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  342
            LK+Y +Y+QLSD+L  MFSSFT GN  +QGM DFMNE KLMDLLN+S+YVPTYEDKDGDW
Sbjct  150  LKMYTSYSQLSDSLGKMFSSFTIGNCESQGMKDFMNESKLMDLLNNSDYVPTYEDKDGDW  209

Query  341  MLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            MLVGDVPWEMFV+SCKRLRI+KG EAIG+APR MEKCK+++
Sbjct  210  MLVGDVPWEMFVESCKRLRIMKGKEAIGIAPRAMEKCKNRS  250



>emb|CDY63910.1| BnaC01g43640D [Brassica napus]
 emb|CDY30781.1| BnaC07g16810D [Brassica napus]
Length=240

 Score =   251 bits (640),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 140/171 (82%), Gaps = 10/171 (6%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--------FVKVSMD  549
            KDP+KPPAKAQVVGWPPVR+YRKN+M + + S   E   +K+GN          VKVSMD
Sbjct  71   KDPVKPPAKAQVVGWPPVRNYRKNIMTNQKTSGADEASSEKAGNGGGGATGATLVKVSMD  130

Query  548  GAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVP  369
            GAPYLRKV LK+Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLMD LNSSEYVP
Sbjct  131  GAPYLRKVHLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNETKLMD-LNSSEYVP  189

Query  368  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKNK  216
            +YEDKDGDWM VGDVPWEMFV+SCKRLRI+KGSEAIGLAPR MEK  SKN+
Sbjct  190  SYEDKDGDWMPVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKY-SKNR  239



>ref|XP_009420668.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=241

 Score =   250 bits (639),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 141/166 (85%), Gaps = 6/166 (4%)
 Frame = -2

Query  701  DPIKPPA-KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLR  531
            DP KPPA KAQVVGWPPVRS+RKNV++ H      EEG +KSG +  FVKVSMDGAPYLR
Sbjct  77   DPEKPPAPKAQVVGWPPVRSFRKNVLSVHSVKGGKEEG-EKSGTSAAFVKVSMDGAPYLR  135

Query  530  KVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYED  357
            KVDLK+Y +Y++LS AL  MFS+FT GN G+QGM   DFMNE K+MDLLN SEYVPTYED
Sbjct  136  KVDLKMYRSYHELSMALQKMFSTFTGGNCGSQGMSGRDFMNESKVMDLLNGSEYVPTYED  195

Query  356  KDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            KDGDWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCK+++
Sbjct  196  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  241



>ref|XP_008788131.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score =   250 bits (639),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 140/165 (85%), Gaps = 4/165 (2%)
 Frame = -2

Query  701  DPIKPPA-KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-FVKVSMDGAPYLRK  528
            DP KPPA KAQVVGWPPVRS+RKN+MA H    + E G++ S +   VKVSMDGAPYLRK
Sbjct  77   DPEKPPAPKAQVVGWPPVRSFRKNMMATHSDKGSKEAGEKFSNSAALVKVSMDGAPYLRK  136

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGM--IDFMNERKLMDLLNSSEYVPTYEDK  354
            VDLK+Y++Y +LS AL  MFSSFT+GN G+QGM   DFMNE KLMDLLN SEYVPTYEDK
Sbjct  137  VDLKIYSSYKELSMALEKMFSSFTSGNCGSQGMNGRDFMNESKLMDLLNGSEYVPTYEDK  196

Query  353  DGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DGDWMLVGDVPWEMFVDSCKRLR++KGSEAIGLAPR MEKCK+++
Sbjct  197  DGDWMLVGDVPWEMFVDSCKRLRMMKGSEAIGLAPRAMEKCKNRS  241



>emb|CDY15493.1| BnaA08g27770D [Brassica napus]
Length=229

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 139/162 (86%), Gaps = 6/162 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKNVM   QKS++  +        FVKVSMDGAPYLRK+
Sbjct  72   KDPTKPPAKAQVVGWPPVRSYRKNVMGSCQKSSSSADTAA-----FVKVSMDGAPYLRKI  126

Query  524  DLKVYNTYNQLSDALANMFSSFTTG-NYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            DLK+Y +Y++LSDAL+NMFSSFT G N G +GMIDFMNERK+MD ++S +YVP+YEDKDG
Sbjct  127  DLKMYKSYDELSDALSNMFSSFTMGKNGGEEGMIDFMNERKVMDTVSSWDYVPSYEDKDG  186

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DWMLVGDVPW MFVD+CKRLR++KGS+AIGLAPR MEKCKS+
Sbjct  187  DWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>ref|XP_009111119.1| PREDICTED: auxin-responsive protein IAA17 [Brassica rapa]
Length=229

 Score =   249 bits (637),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 139/162 (86%), Gaps = 6/162 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKNVM   QKS++  +        FVKVSMDGAPYLRK+
Sbjct  72   KDPTKPPAKAQVVGWPPVRSYRKNVMGSCQKSSSSADTAA-----FVKVSMDGAPYLRKI  126

Query  524  DLKVYNTYNQLSDALANMFSSFTTG-NYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            DLK+Y +Y++LSDAL+NMFSSFT G N G +GMIDFMNERK+MD ++S +YVP+YEDKDG
Sbjct  127  DLKMYKSYDELSDALSNMFSSFTMGKNGGEEGMIDFMNERKVMDTVSSWDYVPSYEDKDG  186

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DWMLVGDVPW MFVD+CKRLR++KGS+AIGLAPR MEKCKS+
Sbjct  187  DWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>ref|NP_001288939.1| auxin-responsive protein IAA16 [Brassica rapa]
 gb|ABV89663.1| indoleacetic acid-induced protein 16 [Brassica rapa]
Length=231

 Score =   249 bits (637),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 140/169 (83%), Gaps = 10/169 (6%)
 Frame = -2

Query  695  IKPPAKAQVVGWPPVRSYRKNVMAHHQ-KSNNGEEGDQKSGNN---------FVKVSMDG  546
            +KPPAKAQVVGWPPVRS+RKNVM+  +  + +  EG +K+ ++         +VKVSMDG
Sbjct  63   VKPPAKAQVVGWPPVRSFRKNVMSGQKPTAGDATEGTEKTSSSNGATSSAAAYVKVSMDG  122

Query  545  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPT  366
            APYLRK+DLK+Y TY  LSDAL+ MFSSFT GNYG QGM DFMNE +L+DLLN S+YVPT
Sbjct  123  APYLRKIDLKLYKTYQDLSDALSKMFSSFTLGNYGPQGMKDFMNESRLIDLLNGSDYVPT  182

Query  365  YEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            YEDKDGDWMLVGDVPW MFVDSCKR+RI+KGSEAIGLAPR +EKCK+++
Sbjct  183  YEDKDGDWMLVGDVPWGMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  231



>ref|XP_006408159.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
 gb|ESQ49612.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
Length=234

 Score =   249 bits (637),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 137/172 (80%), Gaps = 13/172 (8%)
 Frame = -2

Query  695  IKPPAKAQVVGWPPVRSYRKNVMAHHQKSNN----------GEEGDQKSGNN---FVKVS  555
            +KPPAK QVVGWPPVRS+RKNVM+  +++            G  G   S N    +VKVS
Sbjct  63   VKPPAKTQVVGWPPVRSFRKNVMSGQKQTTEVAAEGTEKTCGSSGATSSANAAVAYVKVS  122

Query  554  MDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEY  375
            MDGAPYLRK+DLK+Y TY  LSDAL+ MFSSFT GNYG QGM DFMNE KL+DLLN S+Y
Sbjct  123  MDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDY  182

Query  374  VPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            VPTYEDKDGDWMLVGDVPW+MFVDSCKR+RI+KGSEAIGLAPR +EKCK+++
Sbjct  183  VPTYEDKDGDWMLVGDVPWKMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  234



>ref|XP_009367750.1| PREDICTED: auxin-induced protein AUX28-like [Pyrus x bretschneideri]
Length=259

 Score =   250 bits (639),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 138/167 (83%), Gaps = 6/167 (4%)
 Frame = -2

Query  701  DPIKPPA-KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQ--KSGNN---FVKVSMDGAP  540
            DP KPPA KAQVVGWPPVRS+RKN+    Q S N  E +Q  K GNN    VKVSMDGAP
Sbjct  93   DPAKPPAAKAQVVGWPPVRSFRKNMFTAVQNSTNDGESEQMNKGGNNNAVLVKVSMDGAP  152

Query  539  YLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYE  360
            YLRKVDLK+Y +Y +LSDALA MFSSFT GN G+QGM DFMNE KLMD+LN S+Y+PTYE
Sbjct  153  YLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVLNGSDYIPTYE  212

Query  359  DKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DKDGDWMLVGDVPWEMFV+SCKRLRI+K  EA+GLAPR MEKCK+++
Sbjct  213  DKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNRS  259



>dbj|BAJ34138.1| unnamed protein product [Thellungiella halophila]
Length=234

 Score =   249 bits (637),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 137/172 (80%), Gaps = 13/172 (8%)
 Frame = -2

Query  695  IKPPAKAQVVGWPPVRSYRKNVMAHHQKSNN----------GEEGDQKSGNN---FVKVS  555
            +KPPAK QVVGWPPVRS+RKNVM+  +++            G  G   S N    +VKVS
Sbjct  63   VKPPAKTQVVGWPPVRSFRKNVMSGQKQTTEVAAEGTEKTCGSSGATSSANAAVAYVKVS  122

Query  554  MDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEY  375
            MDGAPYLRK+DLK+Y TY  LSDAL+ MFSSFT GNYG QGM DFMNE KL+DLLN S+Y
Sbjct  123  MDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDY  182

Query  374  VPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            VPTYEDKDGDWMLVGDVPW+MFVDSCKR+RI+KGSEAIGLAPR +EKCK+++
Sbjct  183  VPTYEDKDGDWMLVGDVPWKMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  234



>gb|KHG04941.1| Auxin-induced AUX28 [Gossypium arboreum]
Length=235

 Score =   249 bits (637),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 142/163 (87%), Gaps = 5/163 (3%)
 Frame = -2

Query  701  DPIKPP-AKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            DP KPP AKAQVVGWPPVRS+RKN++A  QKS+  E+  +K+   FVKVSMDGAPYLRKV
Sbjct  76   DPAKPPPAKAQVVGWPPVRSFRKNMLAT-QKSSGSEDSGEKAA--FVKVSMDGAPYLRKV  132

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMI-DFMNERKLMDLLNSSEYVPTYEDKDG  348
            DL++Y TY QLSDALA MFSSFT GN G+QG++ DFMNE KLMDLLN S+YVPTYEDKDG
Sbjct  133  DLRMYKTYQQLSDALAKMFSSFTIGNCGSQGLLKDFMNESKLMDLLNGSDYVPTYEDKDG  192

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            D MLVGDVPWEMF++SCKRLRI+KG+EAIGLAPR MEKCK+++
Sbjct  193  DLMLVGDVPWEMFIESCKRLRIMKGTEAIGLAPRAMEKCKNRS  235



>ref|XP_010102292.1| Auxin-responsive protein IAA16 [Morus notabilis]
 gb|EXB93235.1| Auxin-responsive protein IAA16 [Morus notabilis]
Length=257

 Score =   250 bits (639),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 137/168 (82%), Gaps = 7/168 (4%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGE-------EGDQKSGNNFVKVSMDGA  543
            D +KPPAKAQVVGWPPVRS+RKN+++  + S + E        G   S   FVKVSMDGA
Sbjct  90   DSVKPPAKAQVVGWPPVRSFRKNIVSAQKNSGDHEAVKAGGGGGGSSSSAAFVKVSMDGA  149

Query  542  PYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTY  363
            PYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DFMNE KL+DLLN SEYVPTY
Sbjct  150  PYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPTY  209

Query  362  EDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            EDKDGDWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR +EKCK++ 
Sbjct  210  EDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRT  257



>gb|KJB44873.1| hypothetical protein B456_007G276900 [Gossypium raimondii]
Length=254

 Score =   250 bits (638),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 137/170 (81%), Gaps = 9/170 (5%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--------FVKVSMD  549
            K+  KPPAKAQVVGWPPVRS+RKN+M   + S++ +     SGN         FVKVSMD
Sbjct  72   KNTAKPPAKAQVVGWPPVRSFRKNIMTVQKNSSDNKGEKTGSGNTINTAVPAAFVKVSMD  131

Query  548  GAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYG-AQGMIDFMNERKLMDLLNSSEYV  372
            GAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G +QGM DFMNE KL+DLLN SEYV
Sbjct  132  GAPYLRKVDLKLYKSYQELSDALGKMFSSFTVGNCGGSQGMKDFMNEGKLIDLLNGSEYV  191

Query  371  PTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            PTYEDKDGDWML+GDVPWEMFVDSCKRLRI+KGSEAIGLAPR +EKCK +
Sbjct  192  PTYEDKDGDWMLIGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKEQ  241



>emb|CAB46059.1| IAA7 like protein [Arabidopsis thaliana]
 emb|CAB78497.1| IAA7 like protein [Arabidopsis thaliana]
Length=234

 Score =   249 bits (636),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 131/153 (86%), Gaps = 3/153 (2%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLR  531
            KDP KPPAKAQVVGWPPVR+YRKNVMA+ QKS   EE     G    FVKVSMDGAPYLR
Sbjct  66   KDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDGAPYLR  124

Query  530  KVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD  351
            KVDLK+Y +Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLNSSEYVP+YEDKD
Sbjct  125  KVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKD  184

Query  350  GDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLA  252
            GDWMLVGDVPW MFV+SCKRLRI+KGSEAIGL 
Sbjct  185  GDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLG  217



>gb|KJB11145.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=261

 Score =   250 bits (638),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 140/169 (83%), Gaps = 10/169 (6%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVD  522
            DP KPPAKAQVVGWPPVRS+RKN++A   + ++ EE  +K+    VKVSMDGAPYLRKVD
Sbjct  95   DPAKPPAKAQVVGWPPVRSFRKNMLAATTQKSSSEESGEKAA--LVKVSMDGAPYLRKVD  152

Query  521  LKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  342
            L++Y +Y+QLSDALA MFSSFT GN G+QG+ DFMNE KLMDLLN S+YVPTYEDKDGDW
Sbjct  153  LRMYTSYHQLSDALAKMFSSFTIGNCGSQGIKDFMNESKLMDLLNGSDYVPTYEDKDGDW  212

Query  341  MLVGDVPWEMFVDSCKRLRIIKGSEAIGL--------APRVMEKCKSKN  219
            MLVGDVPWEMFV+SCKRLRI+KG+EAIGL        AP+ +EKCK ++
Sbjct  213  MLVGDVPWEMFVESCKRLRIMKGTEAIGLENYMLIIAAPKAVEKCKKRS  261



>ref|NP_001268036.1| uncharacterized protein LOC100250231 [Vitis vinifera]
 gb|ADR80321.1| indole-3-acetic acid-induced protein 16 [Vitis vinifera]
Length=238

 Score =   249 bits (635),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVD  522
            DP KPPAKAQVVGWPPVRS+RKN++   +  N+ EE    S   FVKVSMDGAPYLRKVD
Sbjct  80   DPAKPPAKAQVVGWPPVRSFRKNILTVQK--NSSEEEKASSSAAFVKVSMDGAPYLRKVD  137

Query  521  LKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  342
            LK+Y +Y +LSDAL  MFSSFT GN G+QGM DFMNE KL+DLLN S+YVPTYEDKDGDW
Sbjct  138  LKMYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDW  197

Query  341  MLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            MLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  198  MLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNRS  238



>emb|CBI35213.3| unnamed protein product [Vitis vinifera]
Length=170

 Score =   246 bits (629),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVD  522
            DP KPPAKAQVVGWPPVRS+RKN++   +  N+ EE    S   FVKVSMDGAPYLRKVD
Sbjct  12   DPAKPPAKAQVVGWPPVRSFRKNILTVQK--NSSEEEKASSSAAFVKVSMDGAPYLRKVD  69

Query  521  LKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  342
            LK+Y +Y +LSDAL  MFSSFT GN G+QGM DFMNE KL+DLLN S+YVPTYEDKDGDW
Sbjct  70   LKMYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDW  129

Query  341  MLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            MLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  130  MLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNRS  170



>ref|XP_009418923.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=243

 Score =   249 bits (635),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 141/167 (84%), Gaps = 7/167 (4%)
 Frame = -2

Query  701  DPIKPPA-KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN---NFVKVSMDGAPYL  534
            DP KPPA KAQVVGWPPVRS+RKN+++ H +  + +EG +K GN    FVKVSMDGAPYL
Sbjct  78   DPEKPPAPKAQVVGWPPVRSFRKNILSAHSEKGS-KEGGEKPGNPVAAFVKVSMDGAPYL  136

Query  533  RKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYE  360
            RKVDLK+Y +Y +LS  L  MF SFT+GN G+QGM   DFMNER++MDLLN SEYVPTYE
Sbjct  137  RKVDLKMYRSYQELSMGLQKMFGSFTSGNCGSQGMSGRDFMNEREVMDLLNGSEYVPTYE  196

Query  359  DKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DKDGDWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCK+++
Sbjct  197  DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  243



>emb|CDY50750.1| BnaAnng10570D [Brassica napus]
Length=291

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 140/169 (83%), Gaps = 10/169 (6%)
 Frame = -2

Query  695  IKPPAKAQVVGWPPVRSYRKNVMAHHQ-KSNNGEEGDQKSGNN---------FVKVSMDG  546
            +KPPAKAQVVGWPPVRS+RKNVM+  +  + +  EG +K+ ++         +VKVSMDG
Sbjct  123  VKPPAKAQVVGWPPVRSFRKNVMSGQKPTAGDAAEGTEKTSSSNGATSSAAAYVKVSMDG  182

Query  545  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPT  366
            APYLRK+DLK+Y TY  LSDAL+ MFSSFT GNYG QGM DFMNE +L+DLLN S+YVPT
Sbjct  183  APYLRKIDLKLYKTYQDLSDALSKMFSSFTIGNYGPQGMKDFMNESRLIDLLNGSDYVPT  242

Query  365  YEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            YEDKDGDWMLVGDVPW MFVDSCKR+RI+KGSEAIGLAPR +EKCK+++
Sbjct  243  YEDKDGDWMLVGDVPWGMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  291



>gb|KHN30563.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=233

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 132/158 (84%), Gaps = 9/158 (6%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-------FVKVSMDG  546
            KDP KPPAKAQVVGWPPVRSYRKN+MA  + S   EE  +K+ ++       FVKVSMDG
Sbjct  70   KDPAKPPAKAQVVGWPPVRSYRKNMMAVQKVST--EEVAEKTTSSTTANSGAFVKVSMDG  127

Query  545  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPT  366
            APYLRKVDL +Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLNSSEYVPT
Sbjct  128  APYLRKVDLTMYKSYKDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPT  187

Query  365  YEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLA  252
            YEDKDGDWMLVGDVPWEMFV SCKRLRI+KGSEAIGL 
Sbjct  188  YEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLG  225



>ref|XP_004302055.1| PREDICTED: auxin-responsive protein IAA16 [Fragaria vesca subsp. 
vesca]
Length=254

 Score =   249 bits (635),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 137/162 (85%), Gaps = 5/162 (3%)
 Frame = -2

Query  689  PPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-----FVKVSMDGAPYLRKV  525
            P AKAQVVGWPPVRS+RKN++A  +KS + ++  +KSG+      FVKVSMDGAPYLRKV
Sbjct  93   PRAKAQVVGWPPVRSFRKNIVAVQKKSTDQDQAAEKSGSTSTSAAFVKVSMDGAPYLRKV  152

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LS AL  MFSSFT GN G+QGM DFMNE KL+DLLN SEYVP+YEDKDGD
Sbjct  153  DLKLYQSYQELSTALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPSYEDKDGD  212

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR +EK K+++
Sbjct  213  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS  254



>gb|EYU30526.1| hypothetical protein MIMGU_mgv1a012831mg [Erythranthe guttata]
Length=239

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 137/162 (85%), Gaps = 5/162 (3%)
 Frame = -2

Query  692  KPPAKAQVVGWPPVRSYRKNVMAHHQKSNNG--EEGDQKSGNN---FVKVSMDGAPYLRK  528
            KPP+K QVVGWPPVRS+RKN++A  + S++G   E D+ SG     FVKVS+DGAPYLRK
Sbjct  77   KPPSKTQVVGWPPVRSFRKNILAVQKNSSSGATTEADKSSGGAAAAFVKVSLDGAPYLRK  136

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y +Y QLSDAL  MFSSFT GN G++G+ D MNE KL+DLLN S+YVPTYEDKDG
Sbjct  137  VDLKMYTSYQQLSDALGKMFSSFTIGNCGSEGIKDLMNESKLIDLLNGSDYVPTYEDKDG  196

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DWMLVGDVPWEMFVDSCKR+RI+KGSEAIGLAPR +EKCK++
Sbjct  197  DWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRAVEKCKNR  238



>ref|XP_011026048.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 139/163 (85%), Gaps = 3/163 (2%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRK  528
            DP KPPAKAQVVGWPPVRS+RKN++A  QKS+  +E ++  G N  FVKVSMDGAPYLRK
Sbjct  74   DPAKPPAKAQVVGWPPVRSFRKNMLAV-QKSSTDQECEKVPGGNATFVKVSMDGAPYLRK  132

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y TY +LS AL  MFSSFT GN G+ G+ DF+NE KL+DLLN ++YVPTYEDKDG
Sbjct  133  VDLKMYKTYQELSGALEEMFSSFTIGNCGSHGLKDFLNESKLIDLLNGTDYVPTYEDKDG  192

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPW+MFV+SCKRLRI+KG+EA GLAPR MEKCK+++
Sbjct  193  DWMLVGDVPWDMFVESCKRLRIMKGTEATGLAPRAMEKCKNRS  235



>gb|ACJ84642.1| unknown [Medicago truncatula]
Length=250

 Score =   248 bits (634),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVD  522
            DP KPPAKAQVVGWPPVRSYRKN++A  +  +        +   FVKVSMDGAPYLRKVD
Sbjct  90   DPAKPPAKAQVVGWPPVRSYRKNMLAMQKSESEKNSSSNFNAITFVKVSMDGAPYLRKVD  149

Query  521  LKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  342
            LK+Y +Y+QLSD+L  MFSSFT GN  +QGM DFMNE KLMDLLN+S+YVPTYEDKDGDW
Sbjct  150  LKMYTSYSQLSDSLGKMFSSFTIGNCESQGMKDFMNESKLMDLLNNSDYVPTYEDKDGDW  209

Query  341  MLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            MLVGDVPW MFV+SCKRLRI+KG EAIG+APR MEKCK+++
Sbjct  210  MLVGDVPWGMFVESCKRLRIMKGKEAIGIAPRAMEKCKNRS  250



>ref|XP_010917602.1| PREDICTED: auxin-responsive protein IAA30 isoform X2 [Elaeis 
guineensis]
Length=238

 Score =   248 bits (632),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 137/164 (84%), Gaps = 5/164 (3%)
 Frame = -2

Query  701  DPIKPPA-KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            DP KPPA KAQVVGWPPVRS+RKN+M+      N EEG++ +   FVKVSMDGAPYLRK+
Sbjct  77   DPEKPPAPKAQVVGWPPVRSFRKNIMSVQSDKGNKEEGEKSA--TFVKVSMDGAPYLRKI  134

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYEDKD  351
            DLK+Y +Y +LS AL  MFSSFT GN  +QG+   DFMNE KLMDL+N SEYVPTYEDKD
Sbjct  135  DLKMYRSYQELSVALEKMFSSFTIGNCSSQGIKGRDFMNESKLMDLINGSEYVPTYEDKD  194

Query  350  GDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            GDWMLVGDVPWEMF+DSCKRLRI+KGSEAIGLAP+ MEKCK+K+
Sbjct  195  GDWMLVGDVPWEMFIDSCKRLRIMKGSEAIGLAPKAMEKCKNKS  238



>emb|CDY18214.1| BnaC05g02370D [Brassica napus]
Length=224

 Score =   247 bits (630),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 138/163 (85%), Gaps = 6/163 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKNVM   QKSN+  E        FVKVSMDGAPYLRKV
Sbjct  67   KDPTKPPAKAQVVGWPPVRSYRKNVMGSCQKSNDVTETAV-----FVKVSMDGAPYLRKV  121

Query  524  DLKVYNTYNQLSDALANMFSSFTTG-NYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            DLK+Y +Y++LS+AL+NMF SFT G N G +GMIDFMNER++ DL+NS +YVP+YEDKDG
Sbjct  122  DLKMYKSYDELSNALSNMFGSFTMGKNGGEEGMIDFMNEREVRDLVNSWDYVPSYEDKDG  181

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPW MFVD+CKRLR++KGS+AIGLAPR MEKCKS+ 
Sbjct  182  DWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSRT  224



>ref|XP_006418150.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
 gb|ESQ36503.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
Length=229

 Score =   247 bits (630),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 137/165 (83%), Gaps = 13/165 (8%)
 Frame = -2

Query  704  KDPIKPPAK---AQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYL  534
            KDP KPPAK   AQVVGWPPVRSYRKNV+   QKS             FVKVSMDGAPYL
Sbjct  73   KDPAKPPAKISRAQVVGWPPVRSYRKNVLVSSQKSEAAA---------FVKVSMDGAPYL  123

Query  533  RKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYED  357
            RKVDLK+Y +Y++LS+AL+NMFSSFT G YG + GMIDFMNERKLMDL+NS +YVP+YED
Sbjct  124  RKVDLKMYKSYDELSNALSNMFSSFTMGKYGGEEGMIDFMNERKLMDLVNSWDYVPSYED  183

Query  356  KDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            KDGDWMLVGDVPW MFVD+CKRLR++KGS+AIGLAPR MEKCKS+
Sbjct  184  KDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>gb|KFK37887.1| hypothetical protein AALP_AA3G042100 [Arabis alpina]
Length=232

 Score =   247 bits (630),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 140/175 (80%), Gaps = 17/175 (10%)
 Frame = -2

Query  695  IKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGE--EGDQKSGNN--------------FV  564
            +KPPAKAQVVGWPPVRS+RKNVM+  QK   G+  EG  K+  +              +V
Sbjct  59   VKPPAKAQVVGWPPVRSFRKNVMSG-QKPTTGDAVEGTDKTSGSSGATSSASAGTTVAYV  117

Query  563  KVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNS  384
            KVSMDGAPYLRK+DLK+Y TY  LSDAL+ MFSSFT GNYG QGM DFMNE KL+DLLN 
Sbjct  118  KVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNG  177

Query  383  SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RI+KGSEAIGLAPR +EKCK+++
Sbjct  178  SDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  232



>ref|XP_008810170.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score =   247 bits (630),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 139/165 (84%), Gaps = 4/165 (2%)
 Frame = -2

Query  701  DPIKPPA-KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN-NFVKVSMDGAPYLRK  528
            DP KPPA KAQVVGWPPVRS+RKN+M+        +EG++ + +  FVKVSMDGAPYLRK
Sbjct  77   DPEKPPAPKAQVVGWPPVRSFRKNIMSIQSDKGKKDEGEKSATSATFVKVSMDGAPYLRK  136

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYEDK  354
            +DLK+Y++Y +LS AL  MFSSFT GN  +QG+   DFMNE KLMDLLN SEYVPTYEDK
Sbjct  137  IDLKMYSSYQELSVALEKMFSSFTIGNCSSQGIKGRDFMNESKLMDLLNGSEYVPTYEDK  196

Query  353  DGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DGDWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAP+VMEKCK+++
Sbjct  197  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPKVMEKCKNQS  241



>ref|NP_187124.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
 sp|O24407.1|IAA16_ARATH RecName: Full=Auxin-responsive protein IAA16; AltName: Full=Indoleacetic 
acid-induced protein 16 [Arabidopsis thaliana]
 gb|AAF04899.1|AC011437_14 auxin-induced protein [Arabidopsis thaliana]
 gb|AAG48764.1|AF332400_1 auxin-induced protein IAA16 [Arabidopsis thaliana]
 gb|AAK53004.1|AF375420_1 AT3g04730/F7O18_22 [Arabidopsis thaliana]
 gb|AAB84353.1| IAA16 [Arabidopsis thaliana]
 gb|AAM64751.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AAN38694.1| At3g04730/F7O18_22 [Arabidopsis thaliana]
 dbj|BAF01307.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AEE74127.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
Length=236

 Score =   246 bits (629),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 138/178 (78%), Gaps = 23/178 (13%)
 Frame = -2

Query  695  IKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN------------------  570
            +KPPAKAQVVGWPPVRS+RKNVM+  + +     GD   GN+                  
Sbjct  63   VKPPAKAQVVGWPPVRSFRKNVMSGQKPTT----GDATEGNDKTSGSSGATSSASACATV  118

Query  569  -FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDL  393
             +VKVSMDGAPYLRK+DLK+Y TY  LS+AL+ MFSSFT GNYG QGM DFMNE KL+DL
Sbjct  119  AYVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDL  178

Query  392  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            LN S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RI+KGSEAIGLAPR +EKCK+++
Sbjct  179  LNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  236



>gb|AFK36086.1| unknown [Lotus japonicus]
Length=257

 Score =   247 bits (630),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 138/169 (82%), Gaps = 10/169 (6%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN--------NFVKVSMDG  546
            DP KPPAKAQVVGWPPVRS+RKN++A  +  + GEE   +  N        +FVKVSMDG
Sbjct  91   DPAKPPAKAQVVGWPPVRSFRKNMLAVQK--SVGEESGGEKSNNGGGGGGASFVKVSMDG  148

Query  545  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPT  366
            APYLRKVDLK+Y +Y  LSD+LA MFSSFT G   +QGM DFMNE KLMDLLNSS+YVPT
Sbjct  149  APYLRKVDLKMYKSYRDLSDSLAKMFSSFTIGTCESQGMKDFMNESKLMDLLNSSDYVPT  208

Query  365  YEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            YEDKDGDWMLVGDVPWEMFV+SCKRLRI+KG EAIGLAPR MEKCK+++
Sbjct  209  YEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNRS  257



>ref|XP_007147174.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
 gb|ESW19168.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
Length=272

 Score =   247 bits (631),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 139/171 (81%), Gaps = 9/171 (5%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHH-QKSNNGEE--------GDQKSGNNFVKVSM  552
            KDP KPPAKAQVVGWPPVRS+RKN++ ++ QKSNN EE            +G  FVKVSM
Sbjct  102  KDPAKPPAKAQVVGWPPVRSFRKNIVNNNVQKSNNKEEVQGGTSGRNHGNTGAAFVKVSM  161

Query  551  DGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYV  372
            DGAPYLRKVDLKVY +Y +LSD+LA MFSSFT     +QGM DFMNE KL+D LN S+YV
Sbjct  162  DGAPYLRKVDLKVYKSYQELSDSLAKMFSSFTIDKCESQGMKDFMNETKLIDFLNGSDYV  221

Query  371  PTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            PTYEDKDGDWMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR +EK K+++
Sbjct  222  PTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKRKNRS  272



>ref|XP_008218270.1| PREDICTED: auxin-responsive protein IAA16 [Prunus mume]
Length=256

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 136/163 (83%), Gaps = 2/163 (1%)
 Frame = -2

Query  701  DPIKPPA-KAQVVGWPPVRSYRKNVMAHHQKSNN-GEEGDQKSGNNFVKVSMDGAPYLRK  528
            DP KPPA KAQVVGWPPVRS+RKN++   +KS+   E+G+      FVKVSMDGAPYLRK
Sbjct  94   DPSKPPASKAQVVGWPPVRSFRKNIVTVQKKSSEEAEKGNSNISAAFVKVSMDGAPYLRK  153

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y +Y +LS AL  MFSSFT GN G+ GM DFMNE KL+DLLN S+YVPTYEDKDG
Sbjct  154  VDLKLYKSYQELSTALGKMFSSFTIGNCGSDGMKDFMNESKLIDLLNGSDYVPTYEDKDG  213

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPW MFVDSCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  214  DWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  256



>ref|NP_001280973.1| auxin-responsive protein IAA16 [Malus domestica]
 gb|ABI36494.1| AUX/IAA16 B [Malus domestica]
Length=251

 Score =   246 bits (628),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 138/163 (85%), Gaps = 3/163 (2%)
 Frame = -2

Query  701  DPIKP-PAKAQVVGWPPVRSYRKNVMAHHQK-SNNGEEGDQKSGNNFVKVSMDGAPYLRK  528
            DP KP  AKAQVVGWPPVRS+R N++A  +  S+ GE+ +  S   FVKVSMDGAPYLRK
Sbjct  90   DPTKPHAAKAQVVGWPPVRSFRXNILAVQKDVSDEGEKTNSXSAA-FVKVSMDGAPYLRK  148

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y +Y +LS AL  MFSSFT G+YG+QGM DFMNE KL+DLLN SEYVPTYEDKDG
Sbjct  149  VDLKLYKSYQELSTALGKMFSSFTIGSYGSQGMKDFMNESKLIDLLNGSEYVPTYEDKDG  208

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPWEMFV+SCKRLRI++GSEAIGLAPR +EKCK+++
Sbjct  209  DWMLVGDVPWEMFVNSCKRLRIMRGSEAIGLAPRAVEKCKNRS  251



>emb|CDX89832.1| BnaA10g02500D [Brassica napus]
Length=224

 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 136/163 (83%), Gaps = 6/163 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKNVM   QKSN   E        FVKVSMDGAPYLRKV
Sbjct  67   KDPTKPPAKAQVVGWPPVRSYRKNVMGSCQKSNGVTETAV-----FVKVSMDGAPYLRKV  121

Query  524  DLKVYNTYNQLSDALANMFSSFTTG-NYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            DLK+Y +Y++LS+AL+NMF SFT G N G +GMIDFMNERK+ DL+NS +YVP+YEDKDG
Sbjct  122  DLKMYKSYDELSNALSNMFGSFTMGKNGGEEGMIDFMNERKVRDLVNSWDYVPSYEDKDG  181

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPW MFVD+CKRLR++KGS+AIGLAPR M KCKS+ 
Sbjct  182  DWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMGKCKSRT  224



>emb|CDY32537.1| BnaA09g50590D [Brassica napus]
Length=228

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 137/163 (84%), Gaps = 7/163 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKNVM   QK + G E       +FVKVSMDGAPYLRKV
Sbjct  72   KDPAKPPAKAQVVGWPPVRSYRKNVMGSCQKPSGGTET-----ASFVKVSMDGAPYLRKV  126

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            DLK+Y +Y++LS+AL+NMFSSFT G YG + GMIDFMNER  M L+N+ +YVP+YEDKDG
Sbjct  127  DLKMYKSYDELSNALSNMFSSFTMGKYGGEEGMIDFMNERN-MALVNTWDYVPSYEDKDG  185

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPW MFVD+CKRLR++KGS+AIGLAPR MEKCKS+ 
Sbjct  186  DWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSRT  228



>ref|XP_009398568.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=248

 Score =   245 bits (626),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 137/166 (83%), Gaps = 6/166 (4%)
 Frame = -2

Query  701  DPIKPPA-KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLR  531
            DP +P A KAQVVGWPPVRSYRKN++A   +  + EEG +K GN   FVKV MDGAPYLR
Sbjct  84   DPERPRAPKAQVVGWPPVRSYRKNILAVQSEKASKEEG-EKPGNTAAFVKVCMDGAPYLR  142

Query  530  KVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGM--IDFMNERKLMDLLNSSEYVPTYED  357
            KVDLK+Y +Y +LS AL  MFSSFT+ N G+QGM   DF NE KLMDL+N SEYVPTYED
Sbjct  143  KVDLKMYRSYQELSMALEKMFSSFTSANCGSQGMNGRDFTNEGKLMDLINGSEYVPTYED  202

Query  356  KDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            KDGDWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEKCKS++
Sbjct  203  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  248



>ref|NP_001239753.1| uncharacterized protein LOC100781847 [Glycine max]
 gb|ACU21611.1| unknown [Glycine max]
Length=231

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 136/161 (84%), Gaps = 9/161 (6%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVD  522
            DP KPPAKAQVVGWPPVRS+RKN++   Q++ N EE        FVKVSMDGAPYLRKVD
Sbjct  80   DPAKPPAKAQVVGWPPVRSFRKNIV---QRNKNEEEA------AFVKVSMDGAPYLRKVD  130

Query  521  LKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  342
            +K+Y +Y +LSDALA MFSSFT    G+QGM DFMNE KL+DLLN S+YVPTY+DKDGDW
Sbjct  131  IKLYKSYQELSDALAKMFSSFTIEKCGSQGMKDFMNETKLIDLLNGSDYVPTYQDKDGDW  190

Query  341  MLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            MLVGDVPWEMFV+SC+RLRI+KGSEAIGLAPR +EKCK+++
Sbjct  191  MLVGDVPWEMFVESCQRLRIMKGSEAIGLAPRAVEKCKNRS  231



>ref|XP_009118658.1| PREDICTED: auxin-responsive protein IAA17-like [Brassica rapa]
Length=228

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 137/162 (85%), Gaps = 7/162 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKNVM   QK + G E       +FVKVSMDGAPYLRKV
Sbjct  72   KDPAKPPAKAQVVGWPPVRSYRKNVMGSCQKPSGGTET-----ASFVKVSMDGAPYLRKV  126

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            DLK+Y +Y++LS+AL+NMFSSFT G YG + GMIDFMNER  M L+N+ +YVP+YEDKDG
Sbjct  127  DLKMYKSYDELSNALSNMFSSFTMGKYGGEEGMIDFMNERN-MALVNTWDYVPSYEDKDG  185

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DWMLVGDVPW MFVD+CKRLR++KGS+AIGLAPR MEKCKS+
Sbjct  186  DWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  227



>gb|KHN22078.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=231

 Score =   244 bits (624),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 136/161 (84%), Gaps = 9/161 (6%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVD  522
            DP KPPAKAQVVGWPPVRS+RKN++   Q++ N EE        FVKVSMDGAPYLRKVD
Sbjct  80   DPAKPPAKAQVVGWPPVRSFRKNIV---QRNKNEEEA------AFVKVSMDGAPYLRKVD  130

Query  521  LKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  342
            +K+Y +Y +LSDALA MFSSFT    G+QGM DFMNE KL+DLLN S+YVPTY+DKDGDW
Sbjct  131  IKLYKSYQELSDALAKMFSSFTIEKCGSQGMKDFMNETKLIDLLNGSDYVPTYQDKDGDW  190

Query  341  MLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            MLVGDVPWEMFV+SC+RLRI+KGSEAIGLAPR +EKCK+++
Sbjct  191  MLVGDVPWEMFVESCQRLRIMKGSEAIGLAPRAVEKCKNRS  231



>ref|XP_007162490.1| hypothetical protein PHAVU_001G156600g [Phaseolus vulgaris]
 gb|ESW34484.1| hypothetical protein PHAVU_001G156600g [Phaseolus vulgaris]
Length=246

 Score =   244 bits (624),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 138/165 (84%), Gaps = 6/165 (4%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRK  528
            DP KPPAKAQVVGWPPVRS+RKN++A  +  + GEE ++ S  N  FVKVSMDGAPYLRK
Sbjct  84   DPAKPPAKAQVVGWPPVRSFRKNMLAVQK--SVGEESEKNSSPNASFVKVSMDGAPYLRK  141

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y +Y +LSD+L  MFSSFT GN  +QGM DFMNE KLMDLLNSS+YVPTYEDKDG
Sbjct  142  VDLKMYQSYRELSDSLGKMFSSFTIGNCESQGMKDFMNESKLMDLLNSSDYVPTYEDKDG  201

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAI--GLAPRVMEKCKSKN  219
            DWMLVGDVPWEMFV+SCKRLRI+KG EAI  GLAPR M K K+++
Sbjct  202  DWMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKSKNRS  246



>ref|XP_007144686.1| hypothetical protein PHAVU_007G176600g [Phaseolus vulgaris]
 gb|ESW16680.1| hypothetical protein PHAVU_007G176600g [Phaseolus vulgaris]
Length=245

 Score =   244 bits (624),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 136/162 (84%), Gaps = 3/162 (2%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN-NFVKVSMDGAPYLRKV  525
            DP KPPAK QVVGWPPVRS+RKN+ A  +  +  EE ++ S N +FVKVSMDGAPYLRKV
Sbjct  86   DPAKPPAKEQVVGWPPVRSFRKNMFAAQK--SMVEESEKNSPNASFVKVSMDGAPYLRKV  143

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LSDAL  MFSSFT GN  +QG  DFMNE KLMDLLNSS+ VPTYED+DGD
Sbjct  144  DLKMYKSYPELSDALGKMFSSFTIGNCESQGFKDFMNESKLMDLLNSSDCVPTYEDRDGD  203

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFV+SCKRLRI+KG EAIGLAPR MEKCK+++
Sbjct  204  WMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNRS  245



>emb|CDY63072.1| BnaCnng41350D [Brassica napus]
Length=398

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 137/161 (85%), Gaps = 6/161 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KP AKAQVVGWPPVRSYRKNVM   QKS++  E        FVKVSMDGAPYLRKV
Sbjct  236  KDPTKPLAKAQVVGWPPVRSYRKNVMGSCQKSSSSAETAA-----FVKVSMDGAPYLRKV  290

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            DLK+Y +Y++LSDAL+NMFSSFT GN G + GMIDFMNERK+MD ++S +YVP+YEDKDG
Sbjct  291  DLKMYKSYDELSDALSNMFSSFTMGNNGGEEGMIDFMNERKVMDTVSSWDYVPSYEDKDG  350

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKS  225
            DWMLVGDVPW MFVD+CKRLR++KGS+AIGLAPR MEKCKS
Sbjct  351  DWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKS  391



>gb|ADL36587.1| ARF domain class transcription factor [Malus domestica]
Length=175

 Score =   241 bits (616),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = -2

Query  701  DPIKPPA-KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            DP KPPA KAQVVGWPPVRS+RKN++   + S+   E        FVKVSMDGAPYLRKV
Sbjct  14   DPTKPPAAKAQVVGWPPVRSFRKNILTVQKNSSEEGENTNSISAAFVKVSMDGAPYLRKV  73

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LS AL+ MFSSFT GN G+QGM DFMNE KL+DLL+ SEYVP+YEDKDGD
Sbjct  74   DLKLYKSYQELSTALSKMFSSFTIGNCGSQGMKDFMNESKLIDLLSGSEYVPSYEDKDGD  133

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR +EK K+++
Sbjct  134  WMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAVEKYKNRS  175



>ref|XP_002520980.1| Auxin-induced protein AUX28, putative [Ricinus communis]
 gb|EEF41397.1| Auxin-induced protein AUX28, putative [Ricinus communis]
Length=244

 Score =   244 bits (622),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 137/163 (84%), Gaps = 5/163 (3%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRK  528
            DP KPPAKAQVVGWPPVRS+RK+++   + SN   E  +K G N  FVKVSMDGAPYLRK
Sbjct  85   DPAKPPAKAQVVGWPPVRSFRKHMLTVQKSSN---EETEKLGLNPTFVKVSMDGAPYLRK  141

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DF+NE KL+DLLN ++YVPTYEDKDG
Sbjct  142  VDLKMYKSYQELSDALGKMFSSFTIGNCGSQGMKDFLNESKLIDLLNGTDYVPTYEDKDG  201

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPW+MFV+SCKRLRI+KG+EA GLAPR MEK K+++
Sbjct  202  DWMLVGDVPWKMFVESCKRLRIMKGTEATGLAPRAMEKRKNRS  244



>emb|CDY10694.1| BnaA05g16680D [Brassica napus]
Length=174

 Score =   241 bits (615),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 134/163 (82%), Gaps = 9/163 (6%)
 Frame = -2

Query  680  KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--------FVKVSMDGAPYLRKV  525
            +AQVVGWPPVR+YRKN++   + S   E   +K+GN+         VKVSMDGAPYLRKV
Sbjct  12   RAQVVGWPPVRNYRKNIITQQKTSGKEEASSEKAGNSGGGASGAALVKVSMDGAPYLRKV  71

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y   SDALA MFSSFT G YGAQGMIDFMNE KLMDLLNSSEYVP+YEDKDGD
Sbjct  72   DLKMYKSYKDFSDALAKMFSSFTMGKYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGD  131

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEK-CKSKN  219
            WMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAPR MEK CK+++
Sbjct  132  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKYCKNRS  174



>gb|AAD32147.1|AF123509_1 Nt-iaa4.1 deduced protein [Nicotiana tabacum]
Length=220

 Score =   243 bits (620),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 130/158 (82%), Gaps = 3/158 (2%)
 Frame = -2

Query  689  PPAKAQVVGWPPVRSYRKNVMAHHQKSN-NGEEGDQKSGNNFVKVSMDGAPYLRKVDLKV  513
            P  KAQVVGWPPVRS+RKNV+   +KS  NGE      G  FVKVS+DGAPYLRKVDLK+
Sbjct  65   PAPKAQVVGWPPVRSFRKNVLTVQKKSTGNGES--SSGGAAFVKVSVDGAPYLRKVDLKM  122

Query  512  YNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLV  333
            Y +Y QLSDAL  MFSSFT GN G  G  DFMNE KL+DLLN S+YVPTYEDKDGDWMLV
Sbjct  123  YKSYQQLSDALGKMFSSFTIGNCGNHGFKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLV  182

Query  332  GDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            GDVPWEMFVDSCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  183  GDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  220



>emb|CDY10068.1| BnaC08g43830D [Brassica napus]
Length=228

 Score =   243 bits (620),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 136/162 (84%), Gaps = 7/162 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKNVM  +QK + G E        FVKVSMDGAPYLRKV
Sbjct  72   KDPAKPPAKAQVVGWPPVRSYRKNVMGSYQKPSGGTETAA-----FVKVSMDGAPYLRKV  126

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            DLK+Y +Y++LS+AL+NMFSSFT G YG + GMIDFMNER  M L+ + +YVP+YEDKDG
Sbjct  127  DLKMYKSYDELSNALSNMFSSFTMGKYGGEEGMIDFMNERN-MALVTTWDYVPSYEDKDG  185

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DWMLVGDVPW MFVD+CKRLR++KGS+AIGLAPR MEKCKS+
Sbjct  186  DWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  227



>ref|XP_002884465.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60724.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
Length=236

 Score =   243 bits (621),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 136/178 (76%), Gaps = 23/178 (13%)
 Frame = -2

Query  695  IKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN------------------  570
            +KPPAKAQVVGWPPVRS+RKNVM+  + +     GD   GN+                  
Sbjct  63   VKPPAKAQVVGWPPVRSFRKNVMSGQKPTT----GDATVGNDKTSGSSGATSSASVCAAV  118

Query  569  -FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDL  393
             +VKVSMDGAPYLRK+DLK+Y TY  LSDAL+ MFSSFT G YG QGM DFMNE  L+DL
Sbjct  119  AYVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGTYGPQGMKDFMNESILIDL  178

Query  392  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            LN S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RI+KGSEAIGLAPR +EKCK+++
Sbjct  179  LNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  236



>ref|XP_006443920.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
 gb|ESR57160.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
Length=226

 Score =   243 bits (619),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 132/161 (82%), Gaps = 9/161 (6%)
 Frame = -2

Query  698  PIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRKV  525
            P KPPAK QVVGWPPVRS+RKN++   QKS+ GEE D   GNN  FVKVSMDGAPYLRKV
Sbjct  72   PAKPPAKTQVVGWPPVRSFRKNMLGVVQKSS-GEESDMAGGNNAAFVKVSMDGAPYLRKV  130

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DL++YNTY  L DAL  MFSSFT G      M DFMNE KLMDLLN S+YVPTYEDKDGD
Sbjct  131  DLRMYNTYKDLYDALGKMFSSFTIG------MKDFMNESKLMDLLNGSDYVPTYEDKDGD  184

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            WMLVGDVPW MFV+SCKRLRI+KG+EAIGLAPR MEKCK++
Sbjct  185  WMLVGDVPWGMFVESCKRLRIVKGTEAIGLAPRAMEKCKNR  225



>gb|AFK44192.1| unknown [Medicago truncatula]
Length=253

 Score =   244 bits (622),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 135/162 (83%), Gaps = 5/162 (3%)
 Frame = -2

Query  689  PPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK----SGNN-FVKVSMDGAPYLRKV  525
            P AKAQVVGWPPVRS+RKN++  HQKSN+  E D+      GN  FVKVSMDGAPYLRKV
Sbjct  92   PRAKAQVVGWPPVRSFRKNIVNVHQKSNSETEVDKSISGGGGNGAFVKVSMDGAPYLRKV  151

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LSDALA MFSSFT  N G+Q   DFMNE KL+DLLN S+YVPTYEDKDGD
Sbjct  152  DLKLYKSYQELSDALAKMFSSFTIDNCGSQVTKDFMNESKLIDLLNGSDYVPTYEDKDGD  211

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFV SCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  212  WMLVGDVPWEMFVQSCKRLRIMKGSEAIGLAPRAVEKCKNRS  253



>ref|XP_006298436.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
 gb|EOA31334.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
Length=241

 Score =   243 bits (621),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 140/180 (78%), Gaps = 18/180 (10%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQK-SNNGEEGDQKSGNN--------------  570
            KD +KPPAK QVVGWPPVRS+RKNVM+  +  + +  EG+ K+  +              
Sbjct  62   KDVVKPPAKTQVVGWPPVRSFRKNVMSGQKPITGDAVEGNDKTSGSSGATSSASACAAAA  121

Query  569  ---FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLM  399
               +VKVSMDGAPYLRK+DLK+Y TY  LSDAL+ MFSSFT GN G QGM DFMNE KL+
Sbjct  122  AAAYVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGNCGPQGMKDFMNESKLI  181

Query  398  DLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DLLN S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RI+KGSEAIGLAPR +EKCK+++
Sbjct  182  DLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  241



>ref|XP_010418365.1| PREDICTED: auxin-responsive protein IAA16 [Camelina sativa]
Length=232

 Score =   243 bits (620),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 139/174 (80%), Gaps = 15/174 (9%)
 Frame = -2

Query  695  IKPPAKAQVVGWPPVRSYRKNVMAHHQK-SNNGEEGDQKSGNN--------------FVK  561
            +KPPAK QVVGWPPVRS+RKNVM+  +  + +  EG+ K+  +              +VK
Sbjct  59   VKPPAKTQVVGWPPVRSFRKNVMSGQKPITGDAVEGNDKTSGSSGATSSASACAAAAYVK  118

Query  560  VSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSS  381
            VSMDGAPYLRK+DLK+Y TY  LS+AL+ MFSSFT GNYG QGM DFMNE KL+DLLN S
Sbjct  119  VSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGS  178

Query  380  EYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            +YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RI+KGSEAIGLAPR +EKCK+++
Sbjct  179  DYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  232



>ref|XP_009413916.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=244

 Score =   243 bits (620),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 138/165 (84%), Gaps = 4/165 (2%)
 Frame = -2

Query  701  DPIKPPA-KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS-GNNFVKVSMDGAPYLRK  528
            DP KP A KAQVVGWPPVRS+RKN+++ + +  + EEG++ S    FVKVSMDGAPYLRK
Sbjct  80   DPEKPSAPKAQVVGWPPVRSFRKNILSVNSEKGSKEEGEKSSISAAFVKVSMDGAPYLRK  139

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYEDK  354
            VDLK+Y +Y +L  AL  MF SFT GNYG+QG+   DFMNE K+MDLLN SEYVPTYEDK
Sbjct  140  VDLKMYRSYQELFMALQKMFISFTGGNYGSQGLSGRDFMNESKVMDLLNGSEYVPTYEDK  199

Query  353  DGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DGDWMLVGDVPWEMFVDSCKRLRI+KGSEAIGLAP+ MEKCK+++
Sbjct  200  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPKAMEKCKNRS  244



>ref|XP_007205640.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica]
 gb|EMJ06839.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica]
Length=299

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 135/162 (83%), Gaps = 2/162 (1%)
 Frame = -2

Query  701  DPIKPPA-KAQVVGWPPVRSYRKNVMAHHQKSNN-GEEGDQKSGNNFVKVSMDGAPYLRK  528
            DP KPPA KAQVVGWPPVRS+RKN+    +KS++ GE+ +      FVKVSMDGAPYLRK
Sbjct  137  DPSKPPASKAQVVGWPPVRSFRKNIATVQKKSSDEGEKSNSNISAAFVKVSMDGAPYLRK  196

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y +Y +LS AL  MFSSFT GN G+ GM DFMNE KL+DLLN S+YVPTYEDKDG
Sbjct  197  VDLKLYKSYQELSTALGKMFSSFTIGNCGSDGMKDFMNESKLIDLLNGSDYVPTYEDKDG  256

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DWMLVGDVPW MFVDSCKRLRI+KGSEAIGLAPR +EKCK++
Sbjct  257  DWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  298



>ref|XP_004495802.1| PREDICTED: auxin-responsive protein IAA16-like [Cicer arietinum]
Length=252

 Score =   243 bits (621),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 138/163 (85%), Gaps = 7/163 (4%)
 Frame = -2

Query  689  PPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS-----GNN-FVKVSMDGAPYLRK  528
            P AKAQVVGWPPVRS+RKN++ + QKSNN  E ++K+     GN  FVKVSMDGAPYLRK
Sbjct  91   PRAKAQVVGWPPVRSFRKNIV-NVQKSNNEVEAEKKTSGSGGGNGAFVKVSMDGAPYLRK  149

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y +Y +LSDALA MFSSFT GN G+Q   DFMNE KL+DLLN S+YVPTYEDKDG
Sbjct  150  VDLKLYKSYQELSDALAKMFSSFTIGNCGSQVTKDFMNESKLIDLLNGSDYVPTYEDKDG  209

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPWEMFV SCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  210  DWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAVEKCKNRS  252



>ref|XP_010485858.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa]
Length=232

 Score =   243 bits (619),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 138/174 (79%), Gaps = 15/174 (9%)
 Frame = -2

Query  695  IKPPAKAQVVGWPPVRSYRKNVMAHHQK-SNNGEEGDQKS--------------GNNFVK  561
            +KPPAK QVVGWPPVRS+RKNVM+  +  + +  EG+ K+                 +VK
Sbjct  59   VKPPAKTQVVGWPPVRSFRKNVMSGQKPITGDAVEGNDKTPGSSGATSSASACAAAAYVK  118

Query  560  VSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSS  381
            VSMDGAPYLRK+DLK+Y TY  LS+AL+ MFSSFT GNYG QGM DF+NE KL+DLLN S
Sbjct  119  VSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFLNESKLIDLLNGS  178

Query  380  EYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            +YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RI+KGSEAIGLAPR +EKCK+++
Sbjct  179  DYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  232



>ref|XP_009124981.1| PREDICTED: auxin-responsive protein IAA16-like [Brassica rapa]
 emb|CDY21111.1| BnaA01g33420D [Brassica napus]
Length=236

 Score =   242 bits (618),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 138/173 (80%), Gaps = 15/173 (9%)
 Frame = -2

Query  695  IKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNG--EEGDQKSGNN-------------FVK  561
            +KPPAKAQVVGWPPVRS+RKNVM+  + +     +  ++ SG+N             +VK
Sbjct  63   VKPPAKAQVVGWPPVRSFRKNVMSGPKPTTGDAVQATEKTSGSNGATSSASIGATAAYVK  122

Query  560  VSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSS  381
            VSMDGAPYLRK+DLK+Y TY  LSDAL+ MFSSFT G+YG QGM D +NE KL+DLLN S
Sbjct  123  VSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGSYGPQGMKDIVNEGKLIDLLNGS  182

Query  380  EYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            +YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RI+KGSEAIGLAPR +EKCK++
Sbjct  183  DYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  235



>dbj|BAG55005.1| auxin-responsive Aux/IAA gene family member [Ipomoea nil]
Length=225

 Score =   242 bits (617),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 131/161 (81%), Gaps = 4/161 (2%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVD  522
            D  KPPAKAQVVGWPPVRSYRKN+++  + +     G    G   VKVS+DGAPYLRKVD
Sbjct  69   DSTKPPAKAQVVGWPPVRSYRKNILSGQKAAGESSGG----GAALVKVSVDGAPYLRKVD  124

Query  521  LKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  342
            LK+Y +Y++LS+AL  MFSSFT GN G  G  DFMNE KL+DLLN S+YVPTYEDKDGDW
Sbjct  125  LKMYKSYHELSEALGKMFSSFTIGNCGTHGFKDFMNESKLIDLLNGSDYVPTYEDKDGDW  184

Query  341  MLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            MLVGDVPW MFVDSCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  185  MLVGDVPWNMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  225



>ref|XP_009119323.1| PREDICTED: auxin-responsive protein IAA17-like [Brassica rapa]
Length=224

 Score =   242 bits (617),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 135/163 (83%), Gaps = 6/163 (4%)
 Frame = -2

Query  704  KDPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            KDP KPPAKAQVVGWPPVRSYRKNVM   QKSN   E        FVKVSMDGAPYLRKV
Sbjct  67   KDPTKPPAKAQVVGWPPVRSYRKNVMGSCQKSNGVTETAV-----FVKVSMDGAPYLRKV  121

Query  524  DLKVYNTYNQLSDALANMFSSFTTG-NYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            DLK+Y +Y++LS+AL+NMF SFT G N G +GMIDFMNERK+ DL+NS +YVP+YEDKDG
Sbjct  122  DLKMYKSYDELSNALSNMFGSFTMGKNGGEEGMIDFMNERKVRDLVNSWDYVPSYEDKDG  181

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
             WMLVGDVPW MFVD+CKRLR++KGS+AIGLAPR M KCKS+ 
Sbjct  182  VWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMGKCKSRT  224



>gb|KEH43017.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=253

 Score =   243 bits (619),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 135/162 (83%), Gaps = 5/162 (3%)
 Frame = -2

Query  689  PPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK----SGNN-FVKVSMDGAPYLRKV  525
            P AKAQVVGWPPVRS+RKN++  HQKSN+  E D+      GN  FVKVSMDGAPYLRKV
Sbjct  92   PRAKAQVVGWPPVRSFRKNIVNVHQKSNSETEVDKSISGGGGNGAFVKVSMDGAPYLRKV  151

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LSDALA MFSSFT  N G+Q   DFMNE KL+DLLN S+YVPTYEDKDGD
Sbjct  152  DLKLYKSYQELSDALAKMFSSFTIDNCGSQVTKDFMNESKLIDLLNGSDYVPTYEDKDGD  211

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFV SCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  212  WMLVGDVPWEMFVQSCKRLRIMKGSEAIGLAPRAVEKCKNRS  253



>gb|AGV54230.1| auxin-induced protein AUX28 [Phaseolus vulgaris]
Length=245

 Score =   242 bits (618),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 134/162 (83%), Gaps = 3/162 (2%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN-NFVKVSMDGAPYLRKV  525
            DP KPPAK QVVGWPPVRS+RKN+ A  +  +  EE ++ S N +FVKVSMDGAPYLRKV
Sbjct  86   DPAKPPAKEQVVGWPPVRSFRKNMFAAQK--SMVEESEKNSPNASFVKVSMDGAPYLRKV  143

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y  Y +LSDAL  MFSSFT GN  +QG  DFMNE KLMD LNSS+ VPTYED+DGD
Sbjct  144  DLKMYKNYPELSDALGKMFSSFTIGNCESQGFKDFMNESKLMDFLNSSDCVPTYEDRDGD  203

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFV+SCKRLRI+KG EAIGLAPR MEKCK+++
Sbjct  204  WMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNRS  245



>emb|CDY41894.1| BnaC05g47100D [Brassica napus]
Length=231

 Score =   241 bits (616),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 139/169 (82%), Gaps = 10/169 (6%)
 Frame = -2

Query  695  IKPPAKAQVVGWPPVRSYRKNVMAHHQ-KSNNGEEGDQKSGNN---------FVKVSMDG  546
            +KPPAKAQVVGWPPVRS+RKNVM+  +  + +  EG +K+ ++         +VKVS+DG
Sbjct  63   VKPPAKAQVVGWPPVRSFRKNVMSGQKPTAGDAAEGTEKTSSSNAATSSAAAYVKVSLDG  122

Query  545  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPT  366
            APYLRK+DLK+Y TY  LSDAL+ MFSSFT GN G QGM DFMNE +L+DLLN S+YVPT
Sbjct  123  APYLRKIDLKLYKTYQDLSDALSKMFSSFTIGNCGPQGMKDFMNESRLIDLLNGSDYVPT  182

Query  365  YEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            YEDKDGDWMLVGDVPW MFVDSCKR+RI+KGSEAIGLAPR +EKCK+++
Sbjct  183  YEDKDGDWMLVGDVPWGMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  231



>ref|NP_001236693.1| auxin-induced protein AUX28 [Glycine max]
 sp|P13089.1|AUX28_SOYBN RecName: Full=Auxin-induced protein AUX28 [Glycine max]
 gb|AAA33945.1| auxin-regulated protein (Aux28) [Glycine max]
Length=243

 Score =   242 bits (617),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 137/165 (83%), Gaps = 6/165 (4%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRK  528
            DP KPPAK QVVGWPPVRS+RKN++A  +  + GEE ++ S  N  FVKVSMDGAPYLRK
Sbjct  81   DPAKPPAKTQVVGWPPVRSFRKNMLAVQK--SVGEESEKNSSPNASFVKVSMDGAPYLRK  138

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y +Y +LSD+L  MFSSFT GN  +QGM DFMNE KL DLLNSS+YVPTYEDKDG
Sbjct  139  VDLKMYKSYRELSDSLGKMFSSFTFGNCESQGMKDFMNESKLNDLLNSSDYVPTYEDKDG  198

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAI--GLAPRVMEKCKSKN  219
            DWMLVGDVPWEMFV+SCKRLRI+KG EAI  GLAPR M KCK+++
Sbjct  199  DWMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKCKNRS  243



>gb|KHN02537.1| Auxin-induced protein AUX28 [Glycine soja]
Length=252

 Score =   242 bits (617),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 137/165 (83%), Gaps = 6/165 (4%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRK  528
            DP KPPAK QVVGWPPVRS+RKN++A  +  + GEE ++ S  N  FVKVSMDGAPYLRK
Sbjct  90   DPAKPPAKTQVVGWPPVRSFRKNMLAVQK--SVGEESEKNSSPNASFVKVSMDGAPYLRK  147

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y +Y +LSD+L  MFSSFT GN  +QGM DFMNE KL DLLNSS+YVPTYEDKDG
Sbjct  148  VDLKMYKSYRELSDSLGKMFSSFTFGNCESQGMKDFMNESKLNDLLNSSDYVPTYEDKDG  207

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAI--GLAPRVMEKCKSKN  219
            DWMLVGDVPWEMFV+SCKRLRI+KG EAI  GLAPR M KCK+++
Sbjct  208  DWMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKCKNRS  252



>ref|XP_006605305.1| PREDICTED: uncharacterized protein LOC100499872 isoform X1 [Glycine 
max]
 gb|KHN04928.1| Auxin-induced protein AUX28 [Glycine soja]
Length=227

 Score =   241 bits (615),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 135/161 (84%), Gaps = 9/161 (6%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVD  522
            DP KPPAKAQVVGWPPVRS+RKN++   Q+++N EE ++ + N FVKVSMDGAPYLRKVD
Sbjct  76   DPAKPPAKAQVVGWPPVRSFRKNIV---QRNSNEEEAEKSTKNAFVKVSMDGAPYLRKVD  132

Query  521  LKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  342
            +K+Y +Y +LSDALA MFSSFT    G+QGM DFMNE       N S+YVPTYEDKDGDW
Sbjct  133  IKLYKSYQELSDALAKMFSSFTIEKCGSQGMKDFMNE------TNGSDYVPTYEDKDGDW  186

Query  341  MLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            MLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  187  MLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNRS  227



>ref|XP_010923478.1| PREDICTED: auxin-responsive protein IAA30-like isoform X1 [Elaeis 
guineensis]
Length=250

 Score =   242 bits (617),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 137/165 (83%), Gaps = 4/165 (2%)
 Frame = -2

Query  701  DPIKPPA-KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN-NFVKVSMDGAPYLRK  528
            DP KP A KAQVVGWPPVRS+RKN++A H    +  EG++ S +   VKVSMDGAPYLRK
Sbjct  86   DPEKPSAPKAQVVGWPPVRSFRKNILATHSDKGSKVEGEKSSNSVALVKVSMDGAPYLRK  145

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYEDK  354
            VDLK+Y +Y +LS AL  MFSSFT+GN G+QGM   DFMNE KLMDLLN SEYVPTYEDK
Sbjct  146  VDLKMYRSYQELSMALEKMFSSFTSGNCGSQGMSGRDFMNESKLMDLLNGSEYVPTYEDK  205

Query  353  DGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DGD MLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR MEKCK+++
Sbjct  206  DGDLMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  250



>gb|KJB11146.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=285

 Score =   243 bits (619),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 130/150 (87%), Gaps = 2/150 (1%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVD  522
            DP KPPAKAQVVGWPPVRS+RKN++A   + ++ EE  +K+    VKVSMDGAPYLRKVD
Sbjct  95   DPAKPPAKAQVVGWPPVRSFRKNMLAATTQKSSSEESGEKAA--LVKVSMDGAPYLRKVD  152

Query  521  LKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  342
            L++Y +Y+QLSDALA MFSSFT GN G+QG+ DFMNE KLMDLLN S+YVPTYEDKDGDW
Sbjct  153  LRMYTSYHQLSDALAKMFSSFTIGNCGSQGIKDFMNESKLMDLLNGSDYVPTYEDKDGDW  212

Query  341  MLVGDVPWEMFVDSCKRLRIIKGSEAIGLA  252
            MLVGDVPWEMFV+SCKRLRI+KG+EAIGL 
Sbjct  213  MLVGDVPWEMFVESCKRLRIMKGTEAIGLG  242



>ref|XP_009364490.1| PREDICTED: auxin-responsive protein IAA16 [Pyrus x bretschneideri]
Length=252

 Score =   241 bits (616),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 139/164 (85%), Gaps = 5/164 (3%)
 Frame = -2

Query  701  DPIKPPA-KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSG--NNFVKVSMDGAPYLR  531
            +P KPPA KAQ VGWPPVRS+RKN++A  +  N  EEG++ +     FVKVS+DGAPYLR
Sbjct  90   NPTKPPAAKAQAVGWPPVRSFRKNILAVQK--NGSEEGEKTNSITAAFVKVSVDGAPYLR  147

Query  530  KVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD  351
            KVDLK+Y +Y +LS AL+ MFSSFT GN G+QGM DF+NE KL+DLL+ SEYVP+YEDKD
Sbjct  148  KVDLKLYKSYQELSTALSKMFSSFTIGNCGSQGMKDFVNESKLIDLLSGSEYVPSYEDKD  207

Query  350  GDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            GDWMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  208  GDWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAVEKCKNRS  251



>ref|XP_006838867.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
 gb|ERN01436.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
Length=238

 Score =   241 bits (614),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 137/164 (84%), Gaps = 4/164 (2%)
 Frame = -2

Query  701  DPIKPPA-KAQVVGWPPVRSYRKNVMAHHQK--SNNGEEGDQKSGNNFVKVSMDGAPYLR  531
            DP KPPA KAQVVGWPPVRS+R+N++A      +N  EEG++ +G  +VKVSMDGAPYLR
Sbjct  76   DPAKPPAHKAQVVGWPPVRSFRRNMLATQSSKGNNRSEEGEKNAGATYVKVSMDGAPYLR  135

Query  530  KVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD  351
            KVDL +Y +Y  LS++L  MFS FT G  G+QG I+F+NE KLMDLLN SEYVPTYED+D
Sbjct  136  KVDLNMYKSYQDLSNSLEKMFSCFTMGQCGSQG-INFLNESKLMDLLNGSEYVPTYEDRD  194

Query  350  GDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            GDWMLVGDVPWEMFVDSC+RLRI+KGSEAIGLAPR +EKCK+++
Sbjct  195  GDWMLVGDVPWEMFVDSCRRLRIMKGSEAIGLAPRAVEKCKNRS  238



>ref|XP_010038039.1| PREDICTED: auxin-induced protein AUX28-like [Eucalyptus grandis]
 gb|KCW49838.1| hypothetical protein EUGRSUZ_K03313 [Eucalyptus grandis]
Length=280

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 134/162 (83%), Gaps = 6/162 (4%)
 Frame = -2

Query  698  PIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN--NFVKVSMDGAPYLRKV  525
            P+KPPAKAQVVGWPPVRS+RKN++A  + S      D  SG   +FVKVSMDGAPYLRKV
Sbjct  123  PVKPPAKAQVVGWPPVRSFRKNMVAAQKSSTE----DMSSGGAASFVKVSMDGAPYLRKV  178

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LS+AL  M SSFT G   +QG+ DFM+E KL DLLN S+YVPTYEDKDGD
Sbjct  179  DLKMYKSYQELSEALCKMLSSFTIGRCESQGVKDFMSESKLRDLLNGSDYVPTYEDKDGD  238

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFV+SCKRLRI+KG+EA+GLAPR MEKCKS++
Sbjct  239  WMLVGDVPWEMFVESCKRLRIMKGTEAVGLAPRAMEKCKSRS  280



>gb|ACU21378.1| unknown [Glycine max]
Length=252

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 136/165 (82%), Gaps = 6/165 (4%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRK  528
            DP KPPAK QVVGWPPVRS+RKN++A  +  + GEE ++ S  N  FVKVSMDG PYLRK
Sbjct  90   DPAKPPAKTQVVGWPPVRSFRKNMLAVQK--SVGEESEKNSSPNASFVKVSMDGTPYLRK  147

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y +Y +LSD+L  MFSSFT GN  +QGM DFMNE KL DLLNSS+YVPTYEDKDG
Sbjct  148  VDLKMYKSYRELSDSLGKMFSSFTFGNCESQGMKDFMNESKLNDLLNSSDYVPTYEDKDG  207

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAI--GLAPRVMEKCKSKN  219
            DWMLVGDVPWEMFV+SCKRLRI+KG EAI  GLAPR M KCK+++
Sbjct  208  DWMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKCKNRS  252



>ref|XP_010463960.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa]
Length=232

 Score =   239 bits (611),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 135/178 (76%), Gaps = 23/178 (13%)
 Frame = -2

Query  695  IKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN------------------  570
            +KPPAK QVVGWPPVRS+RKNVM+  +       GD   GN+                  
Sbjct  59   VKPPAKTQVVGWPPVRSFRKNVMSGQKPIT----GDTVEGNDKTSGSSGATSSASACAAA  114

Query  569  -FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDL  393
             +VKVSMDGAPYLRK+DLK+Y TY  LS+AL+ MFSSFT GNYG QGM DFMNE KL+DL
Sbjct  115  AYVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDL  174

Query  392  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            LN S+ VPTYEDKDGDWMLVGDVPWEMFVDSCKR+RI+KGSEAIGLAPR +EKCK+++
Sbjct  175  LNGSDCVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  232



>ref|NP_001267662.1| auxin-induced protein AUX28-like [Cucumis sativus]
 dbj|BAA81687.1| unnamed protein product [Cucumis sativus]
 gb|KGN44763.1| hypothetical protein Csa_7G378520 [Cucumis sativus]
Length=230

 Score =   239 bits (609),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 129/162 (80%), Gaps = 18/162 (11%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVD  522
            DP KPPAKAQVVGWPPVRS+RKN M                   FVKVSMDGAPYLRKVD
Sbjct  86   DPAKPPAKAQVVGWPPVRSFRKNNMLA-----------------FVKVSMDGAPYLRKVD  128

Query  521  LKVYNTYNQLSDALANMFSSFTT-GNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            LK+Y +Y QLSDALA MF SFTT GN G+Q M DFMNE KLMDLL+ S+YVPTYEDKDGD
Sbjct  129  LKMYKSYKQLSDALAAMFGSFTTIGNCGSQEMKDFMNESKLMDLLSGSDYVPTYEDKDGD  188

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFV+SCKRLRI+KG EAIGLAPR MEKCK+++
Sbjct  189  WMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNRS  230



>ref|XP_010917600.1| PREDICTED: auxin-responsive protein IAA30 isoform X1 [Elaeis 
guineensis]
Length=246

 Score =   239 bits (609),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 137/172 (80%), Gaps = 13/172 (8%)
 Frame = -2

Query  701  DPIKPPA-KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKV  525
            DP KPPA KAQVVGWPPVRS+RKN+M+      N EEG++ +   FVKVSMDGAPYLRK+
Sbjct  77   DPEKPPAPKAQVVGWPPVRSFRKNIMSVQSDKGNKEEGEKSA--TFVKVSMDGAPYLRKI  134

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYEDKD  351
            DLK+Y +Y +LS AL  MFSSFT GN  +QG+   DFMNE KLMDL+N SEYVPTYEDKD
Sbjct  135  DLKMYRSYQELSVALEKMFSSFTIGNCSSQGIKGRDFMNESKLMDLINGSEYVPTYEDKD  194

Query  350  GDWMLVGDVPWE--------MFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            GDWMLVGDVPW+        MF+DSCKRLRI+KGSEAIGLAP+ MEKCK+K+
Sbjct  195  GDWMLVGDVPWDDLLSIKFRMFIDSCKRLRIMKGSEAIGLAPKAMEKCKNKS  246



>ref|XP_003521268.1| PREDICTED: auxin-induced protein AUX28-like [Glycine max]
 gb|KHN10705.1| Auxin-induced protein AUX28 [Glycine soja]
Length=254

 Score =   239 bits (609),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 134/164 (82%), Gaps = 3/164 (2%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN-NFVKVSMDGAPYLRKV  525
            DP KPPAKAQVVGWPPVRS+RKN++A  +      E +  S N +FVKVSMDGAPYLRKV
Sbjct  91   DPAKPPAKAQVVGWPPVRSFRKNMLAVQKSVGEENEKNSSSPNASFVKVSMDGAPYLRKV  150

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +LSD+L  MFSSFT GN  +QGM DFMNE KL DLLNSS+YVPTYEDKDGD
Sbjct  151  DLKMYKSYRELSDSLGKMFSSFTIGNCESQGMKDFMNESKLNDLLNSSDYVPTYEDKDGD  210

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAI--GLAPRVMEKCKSKN  219
            WMLVGDVPWEMFV+SCKRLRI+KG EAI  GLAPR M K K+++
Sbjct  211  WMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKSKNRS  254



>ref|XP_008451270.1| PREDICTED: auxin-induced protein AUX28-like [Cucumis melo]
Length=230

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 129/162 (80%), Gaps = 18/162 (11%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVD  522
            DP KPPAKAQVVGWPPVRS+RKN M                   FVKVSMDGAPYLRKVD
Sbjct  86   DPAKPPAKAQVVGWPPVRSFRKNNMLA-----------------FVKVSMDGAPYLRKVD  128

Query  521  LKVYNTYNQLSDALANMFSSFTT-GNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            LK+Y +Y QLSDALA MF SFTT GN G+Q M DFMNE KLMDLL+ S+YVPTYEDKDGD
Sbjct  129  LKMYKSYKQLSDALAAMFGSFTTIGNCGSQEMKDFMNESKLMDLLSGSDYVPTYEDKDGD  188

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFV+SCKR+RI+KG EAIGLAPR MEKCK+++
Sbjct  189  WMLVGDVPWEMFVESCKRVRIMKGKEAIGLAPRAMEKCKNRS  230



>ref|XP_009417112.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=247

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 133/164 (81%), Gaps = 4/164 (2%)
 Frame = -2

Query  701  DPIKP-PAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSG-NNFVKVSMDGAPYLRK  528
            DP KP P KAQVVGWPPVRS+RKN+++ H +    EEG++ S     VKVSMDGAPYLRK
Sbjct  83   DPEKPSPPKAQVVGWPPVRSFRKNILSVHSEKGRKEEGEKSSSLAALVKVSMDGAPYLRK  142

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYEDK  354
            VDLK + +Y +L  AL  MF SFTTG+YG+QGM   DFMNERK+ DLL+ SEYVPTYEDK
Sbjct  143  VDLKTHRSYQELFVALQKMFDSFTTGDYGSQGMSGRDFMNERKVKDLLHGSEYVPTYEDK  202

Query  353  DGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            DGDWMLVGDVPWEMFV SCKRL I+KGSEAIGLAPR MEKCK+K
Sbjct  203  DGDWMLVGDVPWEMFVASCKRLSIMKGSEAIGLAPRAMEKCKNK  246



>emb|CDY30017.1| BnaC01g39910D [Brassica napus]
Length=237

 Score =   236 bits (602),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 133/174 (76%), Gaps = 16/174 (9%)
 Frame = -2

Query  695  IKPPAKAQVVGWPPVRSYRKNVMA-------------HHQKSNNGEEGDQKSGNN--FVK  561
            +KPPAKAQVVGWPPVRS+RKNVM+              +  S+NG       G    +VK
Sbjct  63   VKPPAKAQVVGWPPVRSFRKNVMSGPKPTTGDAFQATENTSSSNGATSSASIGATAAYVK  122

Query  560  VSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLM-DLLNS  384
            +SMDGAPYLRK+DLK+Y  Y  LSD L+ MFSSFT G+YG QGM D +NE KLM DLLN 
Sbjct  123  ISMDGAPYLRKIDLKLYKAYQDLSDTLSKMFSSFTIGSYGPQGMKDIVNEGKLMIDLLNG  182

Query  383  SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RI+KGSEAIGLAPR +EKCK++
Sbjct  183  SDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  236



>ref|XP_003521753.1| PREDICTED: auxin-responsive protein IAA16-like [Glycine max]
Length=243

 Score =   236 bits (603),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 133/162 (82%), Gaps = 11/162 (7%)
 Frame = -2

Query  680  KAQVVGWPPVRSYRKNVMAHHQKSNN--GEEGDQKSGNN------FVKVSMDGAPYLRKV  525
            KAQVVGWPPVRS+RKN++   Q+SNN  GE+    S NN      FVKVSMDGAPYLRKV
Sbjct  85   KAQVVGWPPVRSFRKNIV---QRSNNNEGEKAATSSSNNVNTGAAFVKVSMDGAPYLRKV  141

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +L DALA MFSSFT    G+QGM DFMNE KL+DLLN S+YVPTYEDKD D
Sbjct  142  DLKLYKSYQELLDALAKMFSSFTIDKCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDAD  201

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  202  WMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNRS  243



>ref|XP_010522504.1| PREDICTED: auxin-responsive protein IAA17-like [Tarenaya hassleriana]
Length=235

 Score =   236 bits (602),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 131/163 (80%), Gaps = 11/163 (7%)
 Frame = -2

Query  692  KPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVDLKV  513
            KPPAKAQVVGWPPVR+YRKN+M          EG++ + N FVKVS+DGAPYLRKVDLK 
Sbjct  77   KPPAKAQVVGWPPVRTYRKNMMGR-----TSSEGEKATANAFVKVSIDGAPYLRKVDLKT  131

Query  512  YNTYNQLSDALANMFSSFTTGNYGAQG------MIDFMNERKLMDLLNSSEYVPTYEDKD  351
            Y++Y+ LS AL+ MFSSFT       G      MIDFM+ERKLMDLLNSSEYVPTYEDKD
Sbjct  132  YSSYDDLSTALSTMFSSFTNTGNYGGGGGGGEGMIDFMSERKLMDLLNSSEYVPTYEDKD  191

Query  350  GDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            GDWMLVGDVPW MFV+SCKRLRI+KGSEAIGLAPR MEKCK++
Sbjct  192  GDWMLVGDVPWLMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  234



>gb|KHN31465.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=243

 Score =   236 bits (602),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 133/162 (82%), Gaps = 11/162 (7%)
 Frame = -2

Query  680  KAQVVGWPPVRSYRKNVMAHHQKSNN--GEEGDQKSGNN------FVKVSMDGAPYLRKV  525
            KAQVVGWPPVRS+RKN++   Q+SNN  GE+    S NN      FVKVSMDGAPYLRKV
Sbjct  85   KAQVVGWPPVRSFRKNIV---QRSNNNEGEKAATSSSNNVNTGAAFVKVSMDGAPYLRKV  141

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +L DALA MFSSFT    G+QGM DFMNE KL+DLLN S+YVPTYEDKD D
Sbjct  142  DLKLYKSYQELLDALAKMFSSFTIDKCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDAD  201

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR +EKCK+++
Sbjct  202  WMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNRS  243



>ref|XP_002306817.1| hypothetical protein POPTR_0005s23980g [Populus trichocarpa]
 gb|EEE93813.1| hypothetical protein POPTR_0005s23980g [Populus trichocarpa]
Length=229

 Score =   236 bits (601),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 128/152 (84%), Gaps = 2/152 (1%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRK  528
            DP KPPAKAQVVGWPPVRS+RKN++A  + S + E  D+  G N  FVKVSMDGAPYLRK
Sbjct  73   DPAKPPAKAQVVGWPPVRSFRKNMLAVQKSSTDQESTDKVPGGNATFVKVSMDGAPYLRK  132

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y TY++LSDAL  MFSSFT GN G+ GM DF+NE KL+DLLN ++YVPTYEDKDG
Sbjct  133  VDLKMYKTYHELSDALGKMFSSFTIGNCGSHGMKDFLNESKLIDLLNGTDYVPTYEDKDG  192

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLA  252
            DWMLVGDVPW+MFV+SCKRLRI+KG+EA GL 
Sbjct  193  DWMLVGDVPWDMFVESCKRLRIMKGTEATGLG  224



>gb|ACF88333.1| unknown [Zea mays]
 tpg|DAA55066.1| TPA: IAA30-auxin-responsive Aux/IAA family member [Zea mays]
Length=271

 Score =   237 bits (604),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 132/161 (82%), Gaps = 7/161 (4%)
 Frame = -2

Query  683  AKAQVVGWPPVRSYRKNVMA-HHQKSNNGEEGDQKS-----GNNFVKVSMDGAPYLRKVD  522
            AKAQVVGWPPVRS+RKN+M+    K      GD+ S     G  FVKVS+DGAPYLRKVD
Sbjct  112  AKAQVVGWPPVRSFRKNIMSVQSDKGAAAANGDKSSPAAGGGAAFVKVSLDGAPYLRKVD  171

Query  521  LKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  342
            LK+Y +Y QLS AL NMFSSFT G+ G+QGM + MNE KL+DLLN SEYVPTYEDKDGDW
Sbjct  172  LKMYRSYQQLSKALENMFSSFTIGSCGSQGM-NGMNESKLVDLLNGSEYVPTYEDKDGDW  230

Query  341  MLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            MLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR MEKCK+++
Sbjct  231  MLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  271



>ref|XP_008235328.1| PREDICTED: auxin-induced protein AUX28-like [Prunus mume]
Length=253

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 129/156 (83%), Gaps = 4/156 (3%)
 Frame = -2

Query  674  QVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN----FVKVSMDGAPYLRKVDLKVYN  507
            QVVGWPPVRS+RKN+    QKS + +E +   G +     VKVSMDGAPYLRKVDLK+Y 
Sbjct  98   QVVGWPPVRSFRKNMFTALQKSPSDKESEHSKGGSNAVTLVKVSMDGAPYLRKVDLKMYK  157

Query  506  TYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGD  327
            +Y +LSDALA MFSSFT GN G+QGM DFMNE KLMD+L  S+Y+PTYEDKDGDWMLVGD
Sbjct  158  SYPELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVLKGSDYIPTYEDKDGDWMLVGD  217

Query  326  VPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            VPWEMFV+SCKRLRI+KG EA+GLAPR MEKCK+++
Sbjct  218  VPWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS  253



>gb|ABD98055.1| auxin-regulated protein [Striga asiatica]
Length=248

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 132/163 (81%), Gaps = 6/163 (4%)
 Frame = -2

Query  692  KPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQ-----KSGNNFVKVSMDGAPYLRK  528
            +PPAKAQVVGWPPVRS+RKNVMA  +KS   E+ ++       G  FVKVSMDGAPYLRK
Sbjct  87   RPPAKAQVVGWPPVRSFRKNVMAVQKKSE-AEDAEKVAAASGGGAAFVKVSMDGAPYLRK  145

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDLK+Y  Y +L DAL  MFSSFT     ++GM+DFMNE KLMDLLN S+YVPTYEDKDG
Sbjct  146  VDLKMYKAYQELYDALGKMFSSFTMVKCDSEGMMDFMNESKLMDLLNGSDYVPTYEDKDG  205

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DWMLVGDVPW MFV+SCKRLRI+KG+EA GLAPR MEKCKS++
Sbjct  206  DWMLVGDVPWGMFVESCKRLRIMKGTEAKGLAPRAMEKCKSRS  248



>gb|ABI36487.1| AUX/IAA7 A [Malus domestica]
 gb|ABI36488.1| AUX/IAA7 B [Malus domestica]
Length=154

 Score =   231 bits (590),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 128/154 (83%), Gaps = 5/154 (3%)
 Frame = -2

Query  665  GWPPVRSYRKNVMAHHQKSNNGEEGDQ--KSGNN---FVKVSMDGAPYLRKVDLKVYNTY  501
            GWPPVRS+RKN+    QKS N  E +Q  K  NN    VKVSMDGAPYLRKVDLK+Y +Y
Sbjct  1    GWPPVRSFRKNMFTVVQKSTNDGESEQMNKGSNNNAVLVKVSMDGAPYLRKVDLKMYKSY  60

Query  500  NQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVP  321
             +LSDALA MFSSFT GN G+QGM DFMNERKLMD+LN S+Y+PTYEDKDGDWMLVGDVP
Sbjct  61   PELSDALAKMFSSFTIGNCGSQGMKDFMNERKLMDVLNGSDYIPTYEDKDGDWMLVGDVP  120

Query  320  WEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WEMFV+SCKRLRI+K  EA+GLAPR MEKCK+++
Sbjct  121  WEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNRS  154



>ref|NP_001237212.1| uncharacterized protein LOC100499872 [Glycine max]
 gb|ACU13989.1| unknown [Glycine max]
Length=228

 Score =   234 bits (596),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 129/155 (83%), Gaps = 9/155 (6%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVD  522
            DP KPPAKAQVVGWPPVRS+RKN++   Q+++N EE ++ + N FVKVSMDGAPYLRKVD
Sbjct  76   DPAKPPAKAQVVGWPPVRSFRKNIV---QRNSNEEEAEKSTKNAFVKVSMDGAPYLRKVD  132

Query  521  LKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  342
            +K+Y +Y +LSDALA MFSSFT    G+QGM DFMNE       N S+YVPTYEDKDGDW
Sbjct  133  IKLYKSYQELSDALAKMFSSFTIEKCGSQGMKDFMNE------TNGSDYVPTYEDKDGDW  186

Query  341  MLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVME  237
            MLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR +E
Sbjct  187  MLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVE  221



>gb|ADL70671.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=167

 Score =   231 bits (590),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 131/171 (77%), Gaps = 23/171 (13%)
 Frame = -2

Query  674  QVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-------------------FVKVSM  552
            QVVGWPPVRS+RKNVM+  + +     GD   GN+                   +VKVSM
Sbjct  1    QVVGWPPVRSFRKNVMSGQKPTT----GDATEGNDKTSGSSGATSSASACATVAYVKVSM  56

Query  551  DGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYV  372
            DGAPYLRK+DLK+Y TY  LS+AL+ MFSSFT GNYG QGM DFMNE KL+DLLN S+YV
Sbjct  57   DGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYV  116

Query  371  PTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            PTYEDKDGDWMLVGDVPWEMFVDSCKR+RI+KGSEAIGLAPR +EKCK+++
Sbjct  117  PTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  167



>ref|XP_007201400.1| hypothetical protein PRUPE_ppa010342mg [Prunus persica]
 gb|EMJ02599.1| hypothetical protein PRUPE_ppa010342mg [Prunus persica]
Length=253

 Score =   234 bits (597),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 129/156 (83%), Gaps = 4/156 (3%)
 Frame = -2

Query  674  QVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN----FVKVSMDGAPYLRKVDLKVYN  507
            QVVGWPPVRS+RKN+    QKS + +E +   G++     VKVSMDGAPYLRKVDLK+Y 
Sbjct  98   QVVGWPPVRSFRKNMFTALQKSPSDKESEHNKGSSNAVTLVKVSMDGAPYLRKVDLKMYK  157

Query  506  TYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGD  327
            +Y +LSDALA MFSSF  GN G+QGM DFMNE KLMD+L  S+Y+PTYEDKDGDWMLVGD
Sbjct  158  SYPELSDALAKMFSSFAIGNCGSQGMKDFMNESKLMDVLKGSDYIPTYEDKDGDWMLVGD  217

Query  326  VPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            VPWEMFV+SCKRLRI+KG EA+GLAPR MEKCK+++
Sbjct  218  VPWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS  253



>gb|ADL70672.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
 gb|ADL70675.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=166

 Score =   231 bits (589),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 130/170 (76%), Gaps = 23/170 (14%)
 Frame = -2

Query  674  QVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-------------------FVKVSM  552
            QVVGWPPVRS+RKNVM+  + +     GD   GN+                   +VKVSM
Sbjct  1    QVVGWPPVRSFRKNVMSGQKPTT----GDATEGNDKTSGSSGATSSASACATVAYVKVSM  56

Query  551  DGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYV  372
            DGAPYLRK+DLK+Y TY  LS+AL+ MFSSFT GNYG QGM DFMNE KL+DLLN S+YV
Sbjct  57   DGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYV  116

Query  371  PTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSK  222
            PTYEDKDGDWMLVGDVPWEMFVDSCKR+RI+KGSEAIGLAPR +EKCK++
Sbjct  117  PTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  166



>ref|XP_004963100.1| PREDICTED: auxin-responsive protein IAA30-like [Setaria italica]
Length=264

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 137/172 (80%), Gaps = 12/172 (7%)
 Frame = -2

Query  701  DPIKPP--AKAQVVGWPPVRSYRKNVMAHHQK----SNNGEEGDQKS-----GNNFVKVS  555
            DP + P   KAQVVGWPPVRS+RKN+M+   +    S +  +GD+ S     G  FVKVS
Sbjct  94   DPAEKPRAPKAQVVGWPPVRSFRKNIMSVQSEKGAGSKDATDGDKSSPAASGGAAFVKVS  153

Query  554  MDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEY  375
            +DGAPYLRKVDLK+Y +Y +LS AL  MFSSFT G+ G+QGM + MNE KL+DLLN SEY
Sbjct  154  LDGAPYLRKVDLKMYKSYQELSKALEKMFSSFTIGSCGSQGM-NGMNESKLVDLLNGSEY  212

Query  374  VPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            VPTYEDKDGDWMLVGDVPWEMFV+SCKRLRI+KGSEAIGLAPR MEKCK+++
Sbjct  213  VPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  264



>emb|CAN72026.1| hypothetical protein VITISV_014421 [Vitis vinifera]
Length=285

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 127/150 (85%), Gaps = 2/150 (1%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVD  522
            DP KPPAKAQVVGWPPVRS+RKN++   +  N+ EE    S   FVKVSMDGAPYLRKVD
Sbjct  80   DPAKPPAKAQVVGWPPVRSFRKNILTVQK--NSSEEEKASSSAAFVKVSMDGAPYLRKVD  137

Query  521  LKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  342
            LK+Y +Y +LSDAL  MFSSFT GN G+QGM DFMNE KL+DLLN S+YVPTYEDKDGDW
Sbjct  138  LKMYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDW  197

Query  341  MLVGDVPWEMFVDSCKRLRIIKGSEAIGLA  252
            MLVGDVPWEMFV+SCKRLRI+KGSEAIGLA
Sbjct  198  MLVGDVPWEMFVESCKRLRIMKGSEAIGLA  227



>ref|XP_006366663.1| PREDICTED: auxin-responsive protein IAA16-like [Solanum tuberosum]
Length=214

 Score =   231 bits (589),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 126/157 (80%), Gaps = 11/157 (7%)
 Frame = -2

Query  689  PPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVDLKVY  510
            P  K Q+VGWPPVRS+RKN++   +         Q+S N  VKVSMDGAPYLRKVDL +Y
Sbjct  68   PAVKTQIVGWPPVRSFRKNILTSQKLG-------QESDNILVKVSMDGAPYLRKVDLNMY  120

Query  509  NTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVG  330
             +Y +LSDALA MF+SFT      QGM DFMNERKLMDLLNSS+YVPTYEDKDGDWMLVG
Sbjct  121  KSYQELSDALAKMFNSFTI----VQGMKDFMNERKLMDLLNSSDYVPTYEDKDGDWMLVG  176

Query  329  DVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DVPW MFVDSCKRLRI+KG+EAIGLAPR MEKCK++N
Sbjct  177  DVPWGMFVDSCKRLRIMKGTEAIGLAPRAMEKCKNRN  213



>ref|XP_006408158.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
 gb|ESQ49611.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
Length=223

 Score =   231 bits (589),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 126/161 (78%), Gaps = 13/161 (8%)
 Frame = -2

Query  695  IKPPAKAQVVGWPPVRSYRKNVMAHHQKSNN----------GEEGDQKSGNN---FVKVS  555
            +KPPAK QVVGWPPVRS+RKNVM+  +++            G  G   S N    +VKVS
Sbjct  63   VKPPAKTQVVGWPPVRSFRKNVMSGQKQTTEVAAEGTEKTCGSSGATSSANAAVAYVKVS  122

Query  554  MDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEY  375
            MDGAPYLRK+DLK+Y TY  LSDAL+ MFSSFT GNYG QGM DFMNE KL+DLLN S+Y
Sbjct  123  MDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDY  182

Query  374  VPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLA  252
            VPTYEDKDGDWMLVGDVPW+MFVDSCKR+RI+KGSEAIGL 
Sbjct  183  VPTYEDKDGDWMLVGDVPWKMFVDSCKRIRIMKGSEAIGLG  223



>ref|XP_008462706.1| PREDICTED: auxin-responsive protein IAA16-like isoform X1 [Cucumis 
melo]
Length=232

 Score =   231 bits (589),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 133/167 (80%), Gaps = 9/167 (5%)
 Frame = -2

Query  698  PIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEE------GDQKSGN-NFVKVSMDGAP  540
            P  PPAK QV+GWPPV+S R+N++    K N  EE      GD   G   F+KVSM+GAP
Sbjct  68   PKPPPAKTQVIGWPPVKSLRRNIIG--PKKNKLEETKKSAVGDCSVGAVAFIKVSMEGAP  125

Query  539  YLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYE  360
            YLRKVDLK+Y +Y QL DAL+ MF SFTTGN GAQ M D+MNERKL D+LN S+YVPTYE
Sbjct  126  YLRKVDLKMYESYQQLFDALSKMFGSFTTGNCGAQKMKDYMNERKLKDVLNGSDYVPTYE  185

Query  359  DKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            DKDGDWMLVGDVPW+MFV+SCKRLRI+KGSEAIGLAPR +EKCK++N
Sbjct  186  DKDGDWMLVGDVPWDMFVNSCKRLRIMKGSEAIGLAPRALEKCKNRN  232



>emb|CDP06818.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   231 bits (590),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 128/155 (83%), Gaps = 2/155 (1%)
 Frame = -2

Query  677  AQVVGWPPVRSYRKNVMAHHQKSNNGEE--GDQKSGNNFVKVSMDGAPYLRKVDLKVYNT  504
             QVVGWPPVRS+RKN+++  + SN   E  G   +   FVKVS+DGAPYLRKVDLK + +
Sbjct  91   TQVVGWPPVRSFRKNILSVQKNSNTEAEKSGTGSAAAAFVKVSVDGAPYLRKVDLKNFKS  150

Query  503  YNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDV  324
            Y +LS AL+ MFSS T G+YG+Q   DFMNERKL+DLLN SEYVPTYEDKDGDWMLVGDV
Sbjct  151  YQELSQALSKMFSSSTIGSYGSQEFKDFMNERKLIDLLNGSEYVPTYEDKDGDWMLVGDV  210

Query  323  PWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            PWEMFVDSCKRLRI+KGSEA+GLAPR +EKCK+++
Sbjct  211  PWEMFVDSCKRLRIMKGSEAVGLAPRAVEKCKNRS  245



>ref|XP_004142529.1| PREDICTED: auxin-responsive protein IAA16-like [Cucumis sativus]
 ref|XP_004170021.1| PREDICTED: auxin-responsive protein IAA16-like [Cucumis sativus]
 gb|KGN66786.1| hypothetical protein Csa_1G690240 [Cucumis sativus]
Length=236

 Score =   231 bits (589),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 134/170 (79%), Gaps = 11/170 (6%)
 Frame = -2

Query  698  PIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS----------GNNFVKVSMD  549
            P  PPAKAQVVGWPPV+S R+N++   +K N  EE ++ +             F+KVSMD
Sbjct  68   PKPPPAKAQVVGWPPVKSLRRNIVGPPKK-NKLEETEKNAVISGGGCSVGAAAFIKVSMD  126

Query  548  GAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVP  369
            GAPYLRKVDLK+Y +Y +LSDAL  MF+SFT G  GAQ M D+MNERKL+D+ N S+YVP
Sbjct  127  GAPYLRKVDLKMYGSYQELSDALRKMFASFTAGQCGAQKMRDYMNERKLIDVSNGSDYVP  186

Query  368  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            TYEDKDGDWMLVGDVPW+MFVDSCKRLRI+KGSEAIGLAPR +EKCK++N
Sbjct  187  TYEDKDGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRALEKCKNRN  236



>gb|ACU19136.1| unknown [Glycine max]
Length=243

 Score =   231 bits (589),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 130/162 (80%), Gaps = 11/162 (7%)
 Frame = -2

Query  680  KAQVVGWPPVRSYRKNVMAHHQKSNN--GEEGDQKSGNN------FVKVSMDGAPYLRKV  525
            KAQVVGWPPVRS+RKN++   Q+SNN  GE+    S NN      FVKVSMDGAPYLRKV
Sbjct  85   KAQVVGWPPVRSFRKNIV---QRSNNNEGEKAATSSSNNVNTGAAFVKVSMDGAPYLRKV  141

Query  524  DLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  345
            DLK+Y +Y +L DALA MFSSFT    G+QGM DFMNE KL+D  N S+YVPTYEDKD D
Sbjct  142  DLKLYKSYQELLDALAKMFSSFTIDKCGSQGMKDFMNESKLIDFFNGSDYVPTYEDKDAD  201

Query  344  WMLVGDVPWEMFVDSCKRLRIIKGSEAIGLAPRVMEKCKSKN  219
            WMLVGDVPWEMFV+SCKRLRI+KG EAIGLAPR +EKCK+++
Sbjct  202  WMLVGDVPWEMFVESCKRLRIMKGFEAIGLAPRAVEKCKNRS  243



>emb|CAC84711.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=229

 Score =   230 bits (587),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 127/152 (84%), Gaps = 2/152 (1%)
 Frame = -2

Query  701  DPIKPPAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRK  528
            DP KPPAKAQVVGWPPVRS+RKN++A  + S + E  ++  G N  FVKVSMDGAPYLRK
Sbjct  73   DPAKPPAKAQVVGWPPVRSFRKNMLAVQKSSTDQESTNKVPGGNATFVKVSMDGAPYLRK  132

Query  527  VDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  348
            VDL +Y TY++LSDAL  MFSSFT GN G+ GM DF+NE KL+DLLN ++YVP+YEDKDG
Sbjct  133  VDLNMYKTYHELSDALGKMFSSFTIGNCGSHGMKDFLNESKLIDLLNGTDYVPSYEDKDG  192

Query  347  DWMLVGDVPWEMFVDSCKRLRIIKGSEAIGLA  252
            DWMLVGDVPW+MFV+SCKRLRI+KG+EA GL 
Sbjct  193  DWMLVGDVPWDMFVESCKRLRIMKGTEATGLG  224



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1206563851350