BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF024K14

Length=716
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783807.1|  PREDICTED: 60S ribosomal protein L18-2-like        293   5e-97   Nicotiana sylvestris
ref|XP_009625475.1|  PREDICTED: 60S ribosomal protein L18-2-like        293   6e-97   Nicotiana tomentosiformis
ref|XP_009629074.1|  PREDICTED: 60S ribosomal protein L18-2             292   1e-96   Nicotiana tomentosiformis
ref|XP_009630920.1|  PREDICTED: 60S ribosomal protein L18-2-like        291   2e-96   Nicotiana tomentosiformis
gb|KDP28183.1|  hypothetical protein JCGZ_13954                         291   4e-96   Jatropha curcas
ref|XP_009772706.1|  PREDICTED: 60S ribosomal protein L18-2-like        289   3e-95   Nicotiana sylvestris
ref|XP_009796134.1|  PREDICTED: 60S ribosomal protein L18-2-like        288   5e-95   Nicotiana sylvestris
ref|NP_001237789.1|  uncharacterized protein LOC100500164               288   6e-95   Glycine max [soybeans]
gb|KJB41867.1|  hypothetical protein B456_007G127300                    288   9e-95   Gossypium raimondii
gb|KJB41866.1|  hypothetical protein B456_007G127300                    289   1e-94   Gossypium raimondii
ref|XP_008450608.1|  PREDICTED: 60S ribosomal protein L18-2             287   1e-94   Cucumis melo [Oriental melon]
ref|XP_002301485.1|  60S ribosomal protein L18                          287   1e-94   Populus trichocarpa [western balsam poplar]
gb|KGN66048.1|  hypothetical protein Csa_1G569250                       289   1e-94   Cucumis sativus [cucumbers]
gb|KJB45330.1|  hypothetical protein B456_007G301700                    287   2e-94   Gossypium raimondii
ref|XP_007031040.1|  Ribosomal protein L18                              286   2e-94   Theobroma cacao [chocolate]
ref|XP_006344694.1|  PREDICTED: 60S ribosomal protein L18-2-like        286   3e-94   Solanum tuberosum [potatoes]
ref|XP_010025256.1|  PREDICTED: 60S ribosomal protein L18-2             286   4e-94   Eucalyptus grandis [rose gum]
ref|XP_002523106.1|  60S ribosomal protein L18, putative                286   5e-94   Ricinus communis
gb|KJB82632.1|  hypothetical protein B456_013G206100                    285   6e-94   Gossypium raimondii
ref|XP_010088293.1|  60S ribosomal protein L18-3                        286   6e-94   
gb|KHN20393.1|  60S ribosomal protein L18-2                             288   6e-94   Glycine soja [wild soybean]
gb|KJB23303.1|  hypothetical protein B456_004G091200                    285   9e-94   Gossypium raimondii
ref|XP_008454015.1|  PREDICTED: 60S ribosomal protein L18-3             285   9e-94   Cucumis melo [Oriental melon]
ref|XP_006382454.1|  60S ribosomal protein L18                          285   1e-93   Populus trichocarpa [western balsam poplar]
ref|XP_011036896.1|  PREDICTED: 60S ribosomal protein L18-2             285   1e-93   Populus euphratica
ref|XP_010313195.1|  PREDICTED: 60S ribosomal protein L18-2-like        285   1e-93   Solanum lycopersicum
ref|NP_001236071.1|  uncharacterized protein LOC100499789               285   1e-93   Glycine max [soybeans]
ref|XP_003556523.1|  PREDICTED: 60S ribosomal protein L18-2-like        285   1e-93   Glycine max [soybeans]
gb|KHN43503.1|  60S ribosomal protein L18-2                             285   1e-93   Glycine soja [wild soybean]
gb|KHN20252.1|  60S ribosomal protein L18-3                             285   1e-93   Glycine soja [wild soybean]
ref|XP_004144773.1|  PREDICTED: 60S ribosomal protein L18-3-like        285   1e-93   Cucumis sativus [cucumbers]
ref|XP_007050976.1|  Ribosomal protein L18 isoform 3                    285   1e-93   
ref|XP_011042004.1|  PREDICTED: 60S ribosomal protein L18-2-like        284   2e-93   Populus euphratica
ref|XP_006359857.1|  PREDICTED: 60S ribosomal protein L18-2-like        284   2e-93   Solanum tuberosum [potatoes]
ref|XP_007050974.1|  Ribosomal protein L18 isoform 1                    284   2e-93   Theobroma cacao [chocolate]
ref|XP_002320999.1|  60S ribosomal protein L18                          284   2e-93   Populus trichocarpa [western balsam poplar]
gb|KHF98574.1|  60S ribosomal L18-2 -like protein                       284   2e-93   Gossypium arboreum [tree cotton]
ref|NP_001236701.1|  uncharacterized protein LOC100306301               284   3e-93   
ref|XP_006433453.1|  hypothetical protein CICLE_v10002597mg             283   4e-93   Citrus clementina [clementine]
ref|XP_010528904.1|  PREDICTED: 60S ribosomal protein L18-2             283   6e-93   Tarenaya hassleriana [spider flower]
ref|XP_004135776.1|  PREDICTED: uncharacterized protein LOC101207642    290   6e-93   
ref|XP_010094463.1|  60S ribosomal protein L18-2                        283   8e-93   
ref|XP_010043043.1|  PREDICTED: 60S ribosomal protein L18-2             282   1e-92   Eucalyptus grandis [rose gum]
ref|XP_004495692.1|  PREDICTED: 60S ribosomal protein L18-like          282   1e-92   Cicer arietinum [garbanzo]
ref|XP_007163123.1|  hypothetical protein PHAVU_001G208200g             282   1e-92   Phaseolus vulgaris [French bean]
ref|XP_009630742.1|  PREDICTED: 60S ribosomal protein L18-2-like        282   1e-92   Nicotiana tomentosiformis
gb|KDP23459.1|  hypothetical protein JCGZ_23292                         282   1e-92   Jatropha curcas
gb|KHG07157.1|  60S ribosomal L18-2 -like protein                       283   2e-92   Gossypium arboreum [tree cotton]
ref|XP_010104147.1|  60S ribosomal protein L18-2                        283   2e-92   
gb|ADD54595.1|  putative ribosomal protein L18                          280   2e-92   Linum usitatissimum
gb|KHN03962.1|  60S ribosomal protein L18-2                             281   3e-92   Glycine soja [wild soybean]
emb|CDO98841.1|  unnamed protein product                                283   4e-92   Coffea canephora [robusta coffee]
ref|XP_010659657.1|  PREDICTED: 60S ribosomal protein L18-2-like        280   5e-92   Vitis vinifera
ref|XP_003554636.2|  PREDICTED: 60S ribosomal protein L18-2-like        281   9e-92   Glycine max [soybeans]
gb|AFK49563.1|  unknown                                                 280   1e-91   Lotus japonicus
ref|XP_007144959.1|  hypothetical protein PHAVU_007G197900g             279   1e-91   Phaseolus vulgaris [French bean]
ref|XP_010546736.1|  PREDICTED: 60S ribosomal protein L18-3             279   2e-91   Tarenaya hassleriana [spider flower]
ref|XP_002270635.1|  PREDICTED: 60S ribosomal protein L18-2             279   2e-91   Vitis vinifera
ref|XP_002319502.1|  60S ribosomal protein L18                          279   3e-91   Populus trichocarpa [western balsam poplar]
ref|XP_010544997.1|  PREDICTED: 60S ribosomal protein L18-2-like        278   3e-91   Tarenaya hassleriana [spider flower]
emb|CDP17112.1|  unnamed protein product                                280   4e-91   Coffea canephora [robusta coffee]
ref|XP_007147006.1|  hypothetical protein PHAVU_006G088800g             278   4e-91   Phaseolus vulgaris [French bean]
ref|XP_006444385.1|  hypothetical protein CICLE_v10022435mg             278   4e-91   Citrus clementina [clementine]
ref|XP_008386678.1|  PREDICTED: 60S ribosomal protein L18-2-like        278   7e-91   
ref|XP_010559185.1|  PREDICTED: 60S ribosomal protein L18-2-like        278   7e-91   Tarenaya hassleriana [spider flower]
ref|XP_010684349.1|  PREDICTED: 60S ribosomal protein L18-2-like        277   9e-91   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010523956.1|  PREDICTED: 60S ribosomal protein L18-2-like        277   9e-91   Tarenaya hassleriana [spider flower]
emb|CBI39539.3|  unnamed protein product                                279   1e-90   Vitis vinifera
ref|XP_010674074.1|  PREDICTED: 60S ribosomal protein L18-2             277   1e-90   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011023716.1|  PREDICTED: 60S ribosomal protein L18-2             277   1e-90   Populus euphratica
ref|XP_009338229.1|  PREDICTED: 60S ribosomal protein L18-2-like        277   1e-90   Pyrus x bretschneideri [bai li]
ref|XP_008388515.1|  PREDICTED: 60S ribosomal protein L18-2-like        277   1e-90   Malus domestica [apple tree]
gb|ABK92688.1|  unknown                                                 277   2e-90   Populus trichocarpa [western balsam poplar]
ref|XP_010259492.1|  PREDICTED: 60S ribosomal protein L18-3             276   2e-90   Nelumbo nucifera [Indian lotus]
ref|XP_010931680.1|  PREDICTED: 60S ribosomal protein L18-2             276   2e-90   Elaeis guineensis
ref|NP_187210.1|  60S ribosomal protein L18-2                           276   2e-90   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009134833.1|  PREDICTED: 60S ribosomal protein L18-2             276   2e-90   Brassica rapa
ref|NP_001235897.1|  uncharacterized protein LOC100527681               276   2e-90   
ref|XP_009335702.1|  PREDICTED: 60S ribosomal protein L18-2             276   3e-90   Pyrus x bretschneideri [bai li]
ref|XP_007201344.1|  hypothetical protein PRUPE_ppa012001mg             276   3e-90   Prunus persica
emb|CBI22977.3|  unnamed protein product                                278   4e-90   Vitis vinifera
ref|XP_007205962.1|  hypothetical protein PRUPE_ppa012012mg             276   4e-90   Prunus persica
ref|XP_008369026.1|  PREDICTED: 60S ribosomal protein L18-2             276   4e-90   
ref|XP_011079632.1|  PREDICTED: 60S ribosomal protein L18-2             276   5e-90   Sesamum indicum [beniseed]
ref|XP_008370417.1|  PREDICTED: 60S ribosomal protein L18-2             276   5e-90   Malus domestica [apple tree]
ref|XP_006386732.1|  hypothetical protein POPTR_0002s20400g             275   5e-90   
emb|CDX74138.1|  BnaA03g29090D                                          276   5e-90   
gb|AAA69928.1|  cytoplasmic ribosomal protein L18                       275   6e-90   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002512455.1|  60S ribosomal protein L18, putative                279   7e-90   
ref|XP_011079633.1|  PREDICTED: 60S ribosomal protein L18-2-like        275   9e-90   Sesamum indicum [beniseed]
ref|XP_010938374.1|  PREDICTED: 60S ribosomal protein L18-2-like        274   1e-89   Elaeis guineensis
ref|XP_002882427.1|  hypothetical protein ARALYDRAFT_477850             274   2e-89   Arabidopsis lyrata subsp. lyrata
gb|KJB82634.1|  hypothetical protein B456_013G206100                    274   2e-89   Gossypium raimondii
ref|XP_002271179.1|  PREDICTED: 60S ribosomal protein L18-2             274   2e-89   Vitis vinifera
ref|XP_008775991.1|  PREDICTED: 60S ribosomal protein L18-2             273   3e-89   Phoenix dactylifera
emb|CDY18813.1|  BnaAnng02780D                                          276   3e-89   Brassica napus [oilseed rape]
ref|XP_009124870.1|  PREDICTED: 60S ribosomal protein L18-2-like        273   4e-89   Brassica rapa
ref|XP_004494383.1|  PREDICTED: 60S ribosomal protein L18-like          273   4e-89   Cicer arietinum [garbanzo]
ref|XP_010273829.1|  PREDICTED: 60S ribosomal protein L18-2-like        273   5e-89   Nelumbo nucifera [Indian lotus]
ref|XP_009402513.1|  PREDICTED: 60S ribosomal protein L18-2-like        273   5e-89   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK26512.1|  hypothetical protein AALP_AA8G258600                    272   1e-88   Arabis alpina [alpine rockcress]
ref|XP_009417724.1|  PREDICTED: 60S ribosomal protein L18-2             272   1e-88   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004984437.1|  PREDICTED: 60S ribosomal protein L18-2-like        272   1e-88   
emb|CDY40718.1|  BnaC03g34340D                                          273   1e-88   Brassica napus [oilseed rape]
gb|AFK45456.1|  unknown                                                 271   2e-88   Lotus japonicus
ref|XP_009384409.1|  PREDICTED: 60S ribosomal protein L18-2             271   2e-88   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002465302.1|  hypothetical protein SORBIDRAFT_01g035860          271   2e-88   Sorghum bicolor [broomcorn]
emb|CDY05183.1|  BnaC05g46200D                                          273   2e-88   
ref|XP_010269589.1|  PREDICTED: 60S ribosomal protein L18-3             271   3e-88   Nelumbo nucifera [Indian lotus]
ref|XP_006408052.1|  hypothetical protein EUTSA_v10021598mg             271   4e-88   Eutrema salsugineum [saltwater cress]
ref|XP_008810211.1|  PREDICTED: 60S ribosomal protein L18-2-like        271   4e-88   Phoenix dactylifera
ref|XP_009411663.1|  PREDICTED: 60S ribosomal protein L18-3-like        270   5e-88   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002874343.1|  60S ribosomal protein L18                          270   5e-88   Arabidopsis lyrata subsp. lyrata
ref|XP_006855263.1|  hypothetical protein AMTR_s00183p00048560          270   5e-88   Amborella trichopoda
ref|XP_010914484.1|  PREDICTED: 60S ribosomal protein L18-3             270   5e-88   Elaeis guineensis
ref|XP_008784768.1|  PREDICTED: 60S ribosomal protein L18-2-like        270   6e-88   Phoenix dactylifera
emb|CBI36879.3|  unnamed protein product                                274   6e-88   Vitis vinifera
ref|NP_198137.1|  60S ribosomal protein L18-3                           270   8e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429374.1|  PREDICTED: 60S ribosomal protein L18-3-like        270   9e-88   Camelina sativa [gold-of-pleasure]
ref|XP_006298640.1|  hypothetical protein CARUB_v10014730mg             270   1e-87   Capsella rubella
ref|XP_010486014.1|  PREDICTED: 60S ribosomal protein L18-3             270   1e-87   Camelina sativa [gold-of-pleasure]
ref|XP_009151179.1|  PREDICTED: 60S ribosomal protein L18-2             270   1e-87   Brassica rapa
ref|XP_002461201.1|  hypothetical protein SORBIDRAFT_02g042750          269   2e-87   Sorghum bicolor [broomcorn]
ref|XP_010464086.1|  PREDICTED: 60S ribosomal protein L18-3-like        269   2e-87   Camelina sativa [gold-of-pleasure]
emb|CDY66803.1|  BnaAnng22990D                                          270   2e-87   Brassica napus [oilseed rape]
gb|EMS45435.1|  60S ribosomal protein L18-2                             269   2e-87   Triticum urartu
ref|XP_004494578.1|  PREDICTED: 60S ribosomal protein L18-like          268   3e-87   
ref|XP_009111741.1|  PREDICTED: 60S ribosomal protein L18-2-like        268   5e-87   Brassica rapa
emb|CDY19736.1|  BnaA09g03890D                                          268   7e-87   Brassica napus [oilseed rape]
ref|XP_009129884.1|  PREDICTED: 60S ribosomal protein L18-2-like        269   8e-87   Brassica rapa
ref|XP_009381102.1|  PREDICTED: 60S ribosomal protein L18-2-like        267   1e-86   
ref|NP_001131538.1|  uncharacterized protein LOC100192878               267   1e-86   Zea mays [maize]
emb|CDX99969.1|  BnaC09g03320D                                          267   2e-86   
gb|EMT12638.1|  60S ribosomal protein L18-2                             266   2e-86   
gb|KFK37967.1|  hypothetical protein AALP_AA3G053100                    266   3e-86   Arabis alpina [alpine rockcress]
ref|XP_006394935.1|  hypothetical protein EUTSA_v10004865mg             266   7e-86   
ref|XP_007050975.1|  Ribosomal protein L18 isoform 2                    264   1e-85   
ref|XP_006288739.1|  hypothetical protein CARUB_v10002048mg             264   1e-85   Capsella rubella
ref|XP_010421566.1|  PREDICTED: 60S ribosomal protein L18-2-like        264   1e-85   Camelina sativa [gold-of-pleasure]
gb|ABK26318.1|  unknown                                                 264   1e-85   Picea sitchensis
ref|XP_010455077.1|  PREDICTED: 60S ribosomal protein L18-3-like ...    264   2e-85   Camelina sativa [gold-of-pleasure]
emb|CDX80616.1|  BnaC07g28280D                                          265   3e-85   
emb|CDY25018.1|  BnaC02g39900D                                          264   3e-85   Brassica napus [oilseed rape]
ref|XP_003562459.1|  PREDICTED: 60S ribosomal protein L18-3-like        263   4e-85   
ref|NP_001050069.1|  Os03g0341100                                       263   4e-85   
ref|XP_006650060.1|  PREDICTED: 60S ribosomal protein L18-3-like        263   4e-85   Oryza brachyantha
ref|XP_010228645.1|  PREDICTED: 60S ribosomal protein L18-2-like        263   5e-85   Brachypodium distachyon [annual false brome]
gb|ABK21809.1|  unknown                                                 262   8e-85   Picea sitchensis
ref|XP_004958675.1|  PREDICTED: 60S ribosomal protein L18-3-like        262   1e-84   Setaria italica
gb|AFC88843.1|  60S ribosomal protein L18-3-like protein                260   3e-84   Miscanthus sinensis
ref|XP_003591163.1|  Ribosomal protein L18                              261   3e-84   Medicago truncatula
ref|XP_008789961.1|  PREDICTED: uncharacterized protein LOC103707302    272   3e-84   
emb|CDY05559.1|  BnaA02g31320D                                          269   3e-84   
gb|EPS67068.1|  hypothetical protein M569_07709                         260   5e-84   Genlisea aurea
ref|XP_006658116.1|  PREDICTED: 60S ribosomal protein L18-3-like        260   5e-84   Oryza brachyantha
ref|XP_009629121.1|  PREDICTED: 60S ribosomal protein L18-2             260   5e-84   Nicotiana tomentosiformis
ref|XP_010921627.1|  PREDICTED: uncharacterized protein LOC105045157    267   8e-84   
ref|XP_004247404.1|  PREDICTED: 60S ribosomal protein L18-2             259   1e-83   Solanum lycopersicum
ref|NP_001132852.1|  uncharacterized protein LOC100194344               259   2e-83   Zea mays [maize]
gb|ABK22247.1|  unknown                                                 258   2e-83   Picea sitchensis
ref|XP_008656150.1|  PREDICTED: 60S ribosomal protein L18-3-like        260   2e-83   
ref|XP_003626231.1|  60S ribosomal protein L18                          258   4e-83   Medicago truncatula
gb|AGV54741.1|  60S ribosomal protein L18-3-like protein                259   5e-83   Phaseolus vulgaris [French bean]
ref|XP_010524859.1|  PREDICTED: 60S ribosomal protein L18-3             257   6e-83   Tarenaya hassleriana [spider flower]
ref|XP_002439318.1|  hypothetical protein SORBIDRAFT_09g004290          257   8e-83   Sorghum bicolor [broomcorn]
gb|AFC88838.1|  60S ribosomal protein L18-like protein                  257   1e-82   Miscanthus sinensis
gb|EMT18368.1|  60S ribosomal protein L18-2                             256   2e-82   
dbj|BAJ90421.1|  predicted protein                                      256   2e-82   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001781485.1|  predicted protein                                  256   2e-82   
ref|XP_001760902.1|  predicted protein                                  256   2e-82   
ref|NP_001060617.1|  Os07g0674700                                       256   3e-82   
ref|XP_006654064.1|  PREDICTED: 60S ribosomal protein L18-2-like        256   3e-82   Oryza brachyantha
ref|XP_009611670.1|  PREDICTED: 60S ribosomal protein L18-2-like        255   4e-82   Nicotiana tomentosiformis
dbj|BAJ93091.1|  predicted protein                                      256   4e-82   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004290808.1|  PREDICTED: 60S ribosomal protein L18-2             255   5e-82   Fragaria vesca subsp. vesca
ref|XP_003568896.1|  PREDICTED: 60S ribosomal protein L18-2-like        255   5e-82   Brachypodium distachyon [annual false brome]
ref|XP_010550997.1|  PREDICTED: 60S ribosomal protein L18-3-like ...    255   6e-82   Tarenaya hassleriana [spider flower]
pdb|3J61|Q  Chain Q, Localization Of The Large Subunit Ribosomal ...    255   6e-82   Triticum aestivum [Canadian hard winter wheat]
ref|XP_001751734.1|  predicted protein                                  254   8e-82   
gb|EMS65848.1|  60S ribosomal protein L18-2                             256   9e-82   Triticum urartu
gb|KEH24393.1|  60S ribosomal protein L18-3                             254   1e-81   Medicago truncatula
ref|XP_004977069.1|  PREDICTED: 60S ribosomal protein L18-2-like        253   2e-81   Setaria italica
gb|AFK34017.1|  unknown                                                 253   3e-81   Medicago truncatula
gb|EYU46738.1|  hypothetical protein MIMGU_mgv1a014520mg                253   5e-81   Erythranthe guttata [common monkey flower]
ref|NP_001054688.1|  Os05g0155100                                       252   7e-81   
sp|O65729.1|RL18_CICAR  RecName: Full=60S ribosomal protein L18         251   2e-80   Cicer arietinum [garbanzo]
gb|KIZ05100.1|  60S ribosomal protein L18-3                             251   2e-80   Monoraphidium neglectum
gb|KJB82633.1|  hypothetical protein B456_013G206100                    248   4e-80   Gossypium raimondii
gb|KJB23305.1|  hypothetical protein B456_004G091200                    248   5e-80   Gossypium raimondii
ref|XP_010550998.1|  PREDICTED: 60S ribosomal protein L18-2-like ...    248   1e-79   Tarenaya hassleriana [spider flower]
gb|KJB22517.1|  hypothetical protein B456_004G052100                    247   2e-79   Gossypium raimondii
ref|XP_005843726.1|  hypothetical protein CHLNCDRAFT_37334              247   9e-79   Chlorella variabilis
ref|XP_003081305.1|  ribosomal protein L18 (ISS)                        246   1e-78   
ref|XP_001690885.1|  ribosomal protein L18, component of cytosoli...    246   1e-78   Chlamydomonas reinhardtii
emb|CEF99132.1|  Ribosomal protein L18e, conserved site                 246   2e-78   Ostreococcus tauri
ref|XP_002948325.1|  component of cytosolic 80S ribosome and 60S ...    246   2e-78   Volvox carteri f. nagariensis
ref|XP_001785869.1|  predicted protein                                  244   1e-77   
ref|XP_001760959.1|  predicted protein                                  244   1e-77   
ref|XP_007510670.1|  predicted protein                                  244   8e-77   Bathycoccus prasinos
ref|XP_001419602.1|  Ribosomal protein L18, component of cytosoli...    241   2e-76   Ostreococcus lucimarinus CCE9901
sp|O22254.3|RL181_ARATH  RecName: Full=Putative 60S ribosomal pro...    239   1e-75   Arabidopsis thaliana [mouse-ear cress]
gb|EYU21621.1|  hypothetical protein MIMGU_mgv1a014504mg                238   2e-75   Erythranthe guttata [common monkey flower]
ref|XP_002976425.1|  hypothetical protein SELMODRAFT_267976             238   2e-75   Selaginella moellendorffii
ref|XP_002985888.1|  hypothetical protein SELMODRAFT_181978             238   2e-75   Selaginella moellendorffii
ref|XP_006298641.1|  hypothetical protein CARUB_v10014730mg             235   6e-75   
gb|ACR35483.1|  unknown                                                 235   7e-75   Zea mays [maize]
gb|ACJ85943.1|  unknown                                                 236   7e-75   Medicago truncatula
ref|XP_005643635.1|  ribosomal protein L18 component of cytosolic...    234   5e-74   Coccomyxa subellipsoidea C-169
gb|KFK32338.1|  hypothetical protein AALP_AA6G228700                    234   1e-73   Arabis alpina [alpine rockcress]
ref|XP_010455078.1|  PREDICTED: 60S ribosomal protein L18-2-like ...    231   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_007143771.1|  hypothetical protein PHAVU_007G100200g             231   6e-73   Phaseolus vulgaris [French bean]
gb|ACN41161.1|  unknown                                                 229   2e-72   Picea sitchensis
ref|XP_001745439.1|  hypothetical protein                               229   5e-72   Monosiga brevicollis MX1
gb|ACF83096.1|  unknown                                                 227   1e-71   Zea mays [maize]
gb|ABR23470.1|  60s ribosomal protein L18                               227   4e-71   Ornithodoros parkeri
ref|XP_003626232.1|  60S ribosomal protein L18                          225   4e-71   Medicago truncatula
ref|XP_001640445.1|  predicted protein                                  226   1e-70   Nematostella vectensis
ref|XP_009775352.1|  PREDICTED: 60S ribosomal protein L18-2             226   1e-70   Nicotiana sylvestris
ref|XP_002400316.1|  ribosomal protein L18, putative                    226   1e-70   Ixodes scapularis [blacklegged tick]
gb|AAO46881.1|  60S ribosomal protein                                   223   2e-70   Medicago sativa [alfalfa]
ref|XP_011255380.1|  PREDICTED: 60S ribosomal protein L18               225   3e-70   Camponotus floridanus
ref|XP_968042.1|  PREDICTED: 60S ribosomal protein L18                  224   6e-70   Tribolium castaneum [rust-red flour beetle]
gb|ADV03044.1|  ribosomal protein L18                                   223   1e-69   Amphidinium carterae
ref|XP_011351685.1|  PREDICTED: 60S ribosomal protein L18               223   1e-69   Ooceraea biroi
ref|XP_004991895.1|  ribosomal protein l18                              223   2e-69   Salpingoeca rosetta
emb|CBK22327.2|  unnamed protein product                                223   2e-69   Blastocystis hominis
ref|XP_006677675.1|  hypothetical protein BATDEDRAFT_87003              223   2e-69   Batrachochytrium dendrobatidis JAM81
emb|CBK22442.2|  unnamed protein product                                223   3e-69   Blastocystis hominis
ref|XP_003707499.1|  PREDICTED: 60S ribosomal protein L18-like          224   3e-69   
emb|CBK21900.2|  Ribosomal protein L18e                                 223   3e-69   Blastocystis hominis
ref|XP_011135288.1|  PREDICTED: 60S ribosomal protein L18               222   3e-69   Harpegnathos saltator
gb|AAX48850.1|  L18                                                     222   4e-69   Suberites domuncula
gb|EFN87206.1|  60S ribosomal protein L18                               222   5e-69   Harpegnathos saltator
ref|XP_006561192.1|  PREDICTED: 60S ribosomal protein L18-like          221   7e-69   Apis mellifera [bee]
ref|XP_003056676.1|  predicted protein                                  221   7e-69   Micromonas pusilla CCMP1545
ref|XP_003691391.1|  PREDICTED: 60S ribosomal protein L18-like          221   1e-68   Apis florea [dwarf honeybee]
ref|XP_011015181.1|  PREDICTED: 60S ribosomal protein L18-2-like        219   1e-68   Populus euphratica
ref|XP_011497333.1|  PREDICTED: 60S ribosomal protein L18               220   2e-68   Ceratosolen solmsi marchali
gb|KDR14978.1|  60S ribosomal protein L18                               220   3e-68   Zootermopsis nevadensis
ref|XP_011062886.1|  PREDICTED: 60S ribosomal protein L18               221   5e-68   Acromyrmex echinatior
ref|XP_009012591.1|  hypothetical protein HELRODRAFT_156470             219   6e-68   Helobdella robusta
emb|CAJ17294.1|  ribosomal protein L18e                                 219   7e-68   Hister sp. APV-2005
ref|XP_011396696.1|  60S ribosomal protein L18-3                        219   7e-68   Auxenochlorella protothecoides
ref|XP_011351645.1|  PREDICTED: 60S ribosomal protein L18-like          219   8e-68   Ooceraea biroi
ref|XP_008546759.1|  PREDICTED: 60S ribosomal protein L18               219   9e-68   Microplitis demolitor
ref|XP_004345091.2|  ribosomal protein L18e                             218   1e-67   Capsaspora owczarzaki ATCC 30864
gb|KJE95959.1|  ribosomal protein L18e                                  218   2e-67   Capsaspora owczarzaki ATCC 30864
gb|AAN73381.1|  ribosomal protein L18                                   218   3e-67   Branchiostoma lanceolatum [common lancelet]
ref|XP_008201914.1|  PREDICTED: 60S ribosomal protein L18               218   3e-67   Nasonia vitripennis
ref|XP_002506220.1|  ribosomal protein L18                              224   3e-67   Micromonas commoda
ref|XP_002161036.1|  PREDICTED: 60S ribosomal protein L18-like          217   3e-67   
gb|KCW85063.1|  hypothetical protein EUGRSUZ_B01908                     216   3e-67   Eucalyptus grandis [rose gum]
gb|EFZ15690.1|  hypothetical protein SINV_04174                         217   4e-67   
gb|KHG01788.1|  60S ribosomal L18-2 -like protein                       214   6e-67   Gossypium arboreum [tree cotton]
ref|XP_003393579.1|  PREDICTED: hypothetical protein LOC100643724       223   1e-66   
ref|XP_003485273.1|  PREDICTED: hypothetical protein LOC100746406       223   1e-66   
sp|Q4GXG7.1|RL18_TIMBA  RecName: Full=60S ribosomal protein L18         216   1e-66   Timarcha balearica
gb|ADV03016.1|  ribosomal protein L18                                   215   2e-66   Karlodinium veneficum
ref|XP_008547226.1|  PREDICTED: 60S ribosomal protein L18-like          215   2e-66   Microplitis demolitor
gb|KJB26287.1|  hypothetical protein B456_004G239000                    212   2e-66   Gossypium raimondii
ref|XP_011163555.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    217   3e-66   
ref|XP_011313252.1|  PREDICTED: 60S ribosomal protein L18               215   3e-66   Fopius arisanus
gb|EPZ37075.1|  60S ribosomal protein L18-2                             214   3e-66   Rozella allomycis CSF55
emb|CAD91422.1|  ribosomal protein L18                                  214   4e-66   Crassostrea gigas
ref|XP_011449585.1|  PREDICTED: 60S ribosomal protein L18-like          214   4e-66   
gb|EKC43150.1|  60S ribosomal protein L18                               214   5e-66   Crassostrea gigas
ref|XP_005787945.1|  hypothetical protein EMIHUDRAFT_433854             214   7e-66   Emiliania huxleyi CCMP1516
gb|ABW90395.1|  putative ribosomal protein L18                          213   1e-65   Barentsia elongata
sp|Q0PXY6.1|RL18_DIACI  RecName: Full=60S ribosomal protein L18         213   2e-65   Diaphorina citri
gb|ESA23412.1|  hypothetical protein GLOINDRAFT_342179                  213   2e-65   
emb|CBJ25909.1|  cytoplasmic ribosomal protein L18                      213   3e-65   Ectocarpus siliculosus
ref|XP_002595537.1|  hypothetical protein BRAFLDRAFT_275280             212   5e-65   Branchiostoma floridae
gb|AFJ91753.1|  ribosomal protein L18                                   211   5e-65   Ostrea edulis [Colchester native oyster]
dbj|BAN21088.1|  ribosomal protein L18                                  211   8e-65   Riptortus pedestris
ref|XP_009834317.1|  hypothetical protein H257_09702                    210   3e-64   Aphanomyces astaci
gb|EFX65754.1|  hypothetical protein DAPPUDRAFT_303528                  209   3e-64   Daphnia pulex
ref|XP_009036910.1|  hypothetical protein AURANDRAFT_37496              209   6e-64   Aureococcus anophagefferens
ref|XP_002733428.1|  PREDICTED: 60S ribosomal protein L18-like          209   6e-64   Saccoglossus kowalevskii
ref|XP_008876054.1|  hypothetical protein H310_11242                    209   8e-64   Aphanomyces invadans
emb|CAX72134.1|  ribosomal protein L18                                  209   8e-64   
gb|AAW25981.1|  SJCHGC06655 protein                                     209   8e-64   
emb|CAX79061.1|  ribosomal protein L18                                  207   2e-63   
gb|ERG81080.1|  60s ribosomal protein l18                               208   2e-63   
ref|NP_566104.1|  putative 60S ribosomal protein L18-1                  206   2e-63   
gb|EJD73862.1|  hypothetical protein, variant                           207   3e-63   
gb|ERG80123.1|  60s ribosomal protein l18                               208   3e-63   
sp|Q56FG8.1|RL18_LYSTE  RecName: Full=60S ribosomal protein L18         207   3e-63   
ref|XP_007779084.1|  60S ribosomal protein L18-B                        207   3e-63   
emb|CCD58684.1|  60S ribosomal protein L18, putative                    207   4e-63   
sp|Q4PM04.1|RL18_IXOSC  RecName: Full=60S ribosomal protein L18         207   5e-63   
ref|XP_003977661.1|  PREDICTED: 60S ribosomal protein L18-like          206   6e-63   
ref|XP_001209532.1|  60S ribosomal protein L18                          206   7e-63   
ref|XP_007722189.1|  large subunit ribosomal protein L18e               206   7e-63   
ref|XP_002423194.1|  60S ribosomal protein L18, putative                206   1e-62   
ref|XP_009158973.1|  50S ribosomal protein L18e                         206   1e-62   
gb|KFH61892.1|  60S ribosomal protein L18-B                             205   1e-62   
gb|AGH70165.1|  60S ribosomal protein L18                               205   2e-62   
ref|XP_003385450.1|  PREDICTED: 60S ribosomal protein L18-like          205   2e-62   
ref|XP_008607735.1|  60S ribosomal protein                              205   2e-62   
ref|XP_002130217.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    205   2e-62   
emb|CEI89354.1|  Putative 60S ribosomal protein L18-A                   205   2e-62   
gb|EJW88057.1|  50S ribosomal protein L18                               205   2e-62   
gb|EYE97298.1|  ribosomal protein L18e                                  206   2e-62   
ref|XP_002771969.1|  60S ribosomal protein L18, putative                205   3e-62   
emb|CEG66137.1|  Putative 60S ribosomal protein L18-A                   205   3e-62   
gb|AEE61752.1|  unknown                                                 204   3e-62   
gb|ACD65168.1|  putative 60S ribosomal protein RPL18                    203   4e-62   
ref|XP_003142248.1|  hypothetical protein LOAG_06664                    205   4e-62   
ref|XP_005822438.1|  large subunit ribosomal protein L18e, cytopl...    204   5e-62   
gb|EPS29111.1|  hypothetical protein PDE_04060                          204   5e-62   
ref|NP_648091.1|  ribosomal protein L18, isoform A                      204   5e-62   
ref|XP_009049705.1|  hypothetical protein LOTGIDRAFT_205248             203   6e-62   
ref|XP_001897286.1|  60S ribosomal protein L18                          204   7e-62   
gb|ABZ04231.1|  ribosomal protein rpl18                                 204   7e-62   
emb|CBN08626.1|  ribosomal protein L18                                  203   8e-62   
ref|XP_002047296.1|  GJ13360                                            203   1e-61   
ref|XP_004526749.1|  PREDICTED: 60S ribosomal protein L18-like          203   1e-61   
ref|XP_004358287.1|  eukaryotic ribosomal protein L18, putative         203   1e-61   
ref|XP_005190752.1|  PREDICTED: 60S ribosomal protein L18               203   1e-61   
ref|XP_002035667.1|  GM13785                                            202   2e-61   
emb|CEJ01696.1|  Putative 50S ribosomal protein L18e                    202   2e-61   
gb|KHN77912.1|  60S ribosomal protein L18                               203   2e-61   
gb|KEQ70149.1|  ribosomal protein L18e                                  202   2e-61   
gb|KIW75160.1|  60S ribosomal protein L18-A                             202   2e-61   
ref|XP_002109185.1|  expressed hypothetical protein                     202   2e-61   
ref|XP_007677109.1|  hypothetical protein BAUCODRAFT_122987             202   2e-61   
ref|XP_008085192.1|  Ribosomal proteins L15p and L18e                   202   3e-61   
ref|XP_002094010.1|  GE20435                                            202   3e-61   
gb|KIY03022.1|  60S ribosomal protein L18-A                             202   3e-61   
ref|XP_001550924.1|  60S ribosomal protein L18                          202   3e-61   
ref|XP_002371723.1|  60S ribosomal protein L18, putative                202   3e-61   
ref|XP_010786834.1|  PREDICTED: 60S ribosomal protein L18               202   3e-61   
ref|XP_008888411.1|  ribosomal protein RPL18                            202   4e-61   
gb|KIW89279.1|  60S ribosomal protein L18-A                             201   5e-61   
gb|KIN06517.1|  hypothetical protein OIDMADRAFT_24819                   201   5e-61   
ref|XP_009053775.1|  hypothetical protein LOTGIDRAFT_70408              200   5e-61   
ref|XP_007742086.1|  large subunit ribosomal protein L18e               201   6e-61   
ref|XP_011184309.1|  PREDICTED: 60S ribosomal protein L18               201   6e-61   
gb|EMR82472.1|  putative 60s ribosomal protein l18 protein              202   7e-61   
dbj|GAA55611.1|  large subunit ribosomal protein L18e                   202   7e-61   
ref|XP_007879935.1|  hypothetical protein PFL1_04221                    201   8e-61   
gb|KIJ70376.1|  hypothetical protein HYDPIDRAFT_143674                  201   9e-61   
gb|KIW61527.1|  hypothetical protein PV05_01638                         201   9e-61   
ref|XP_009176548.1|  hypothetical protein T265_11593                    201   1e-60   
gb|KIW69267.1|  hypothetical protein PV04_05151                         201   1e-60   
gb|KIW11507.1|  60S ribosomal protein L18-A                             201   1e-60   
emb|CDP94036.1|  Protein BM-RPL-18, isoform b                           202   1e-60   
ref|XP_008714847.1|  hypothetical protein HMPREF1541_02269              201   1e-60   
ref|XP_001971483.1|  GG14989                                            200   1e-60   
gb|KIV82136.1|  60S ribosomal protein L18-A                             200   1e-60   
ref|XP_007804599.1|  hypothetical protein EPUS_07572                    210   1e-60   
ref|XP_005312106.1|  PREDICTED: 60S ribosomal protein L18               200   2e-60   
gb|KDD74971.1|  hypothetical protein H632_c955p1                        199   2e-60   
gb|ELT99918.1|  hypothetical protein CAPTEDRAFT_159560                  200   2e-60   
ref|XP_006735598.1|  PREDICTED: ribosomal protein L18-like              202   2e-60   
gb|KDN61013.1|  putative eukaryotic ribosomal protein L18               200   2e-60   
ref|XP_008843215.1|  PREDICTED: 60S ribosomal protein L18 isoform X2    199   2e-60   
emb|CCF75175.1|  unnamed protein product                                199   2e-60   
gb|KIL00482.1|  hypothetical protein PAXRUDRAFT_821678                  199   3e-60   
gb|KIW28110.1|  60S ribosomal protein L18-A                             199   3e-60   
emb|CCQ18599.1|  60S ribosomal protein L18                              199   3e-60   
emb|CCU77907.1|  putative 60S ribosomal protein L18                     199   3e-60   
ref|XP_008843214.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    199   3e-60   
ref|NP_001011030.1|  60S ribosomal protein L18                          199   3e-60   
gb|KJB41868.1|  hypothetical protein B456_007G127300                    190   3e-60   
ref|XP_003886070.1|  Ribosomal protein L18, related                     199   3e-60   
gb|ELW47918.1|  60S ribosomal protein L18                               199   3e-60   
ref|XP_002722941.1|  PREDICTED: 60S ribosomal protein L18               199   4e-60   
gb|KIW43484.1|  60S ribosomal protein L18-B                             201   4e-60   
ref|XP_005336693.1|  PREDICTED: 60S ribosomal protein L18               199   4e-60   
gb|KJB45331.1|  hypothetical protein B456_007G301700                    189   4e-60   
ref|XP_008727056.1|  hypothetical protein G647_04492                    199   4e-60   
gb|ABD77159.1|  ribosomal protein L18                                   198   5e-60   
ref|XP_001588139.1|  60S ribosomal protein L18                          199   5e-60   
gb|ABW23172.1|  ribosomal protein rpl18                                 199   6e-60   
ref|XP_007862613.1|  60S ribosomal protein L18                          199   6e-60   
gb|AEE62646.1|  unknown                                                 199   6e-60   
ref|XP_004061142.1|  PREDICTED: 60S ribosomal protein L18               199   6e-60   
dbj|GAN01748.1|  60S ribosomal protein L18                              200   6e-60   
gb|KIJ19828.1|  hypothetical protein PAXINDRAFT_166053                  198   6e-60   
gb|AAN73382.1|  ribosomal protein L18                                   199   7e-60   
ref|XP_009543935.1|  hypothetical protein HETIRDRAFT_472767             198   7e-60   
gb|EMD40971.1|  hypothetical protein CERSUDRAFT_80614                   198   7e-60   
emb|CCI45423.1|  unnamed protein product                                199   8e-60   
ref|XP_011387324.1|  ribosomal 60S subunit protein L18                  199   8e-60   
ref|NP_112364.1|  60S ribosomal protein L18                             198   8e-60   
ref|XP_006229223.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    199   8e-60   
gb|ABD77166.1|  ribosomal protein L18                                   197   8e-60   
gb|EFQ34059.1|  eukaryotic ribosomal protein L18                        198   9e-60   
emb|CCV00013.1|  unnamed protein product                                199   9e-60   
ref|XP_010277700.1|  PREDICTED: uncharacterized protein LOC104612082    207   9e-60   
gb|KIO03112.1|  hypothetical protein M404DRAFT_15806                    198   9e-60   
gb|KIK20716.1|  hypothetical protein PISMIDRAFT_576002                  198   9e-60   
ref|XP_008567503.1|  PREDICTED: 60S ribosomal protein L18               198   1e-59   
ref|XP_003851550.1|  60S ribosomal protein L18                          198   1e-59   
ref|XP_011125411.1|  hypothetical protein AOL_s00112g79                 198   1e-59   
ref|NP_001003432.1|  60S ribosomal protein L18                          197   1e-59   
ref|XP_003801570.1|  PREDICTED: ribosomal protein L18-like              198   1e-59   
gb|AAS49555.1|  ribosomal protein L18                                   197   1e-59   
gb|KHJ35313.1|  putative 60s ribosomal protein l18                      197   2e-59   
dbj|GAN04379.1|  60S ribosomal protein L18                              197   2e-59   
gb|EST06100.1|  armadillo                                               197   2e-59   
ref|XP_006160253.1|  PREDICTED: 60S ribosomal protein L18               197   2e-59   
ref|XP_007756404.1|  60S ribosomal protein L18-B                        197   2e-59   
ref|NP_001018228.1|  60S ribosomal protein L18                          197   2e-59   
ref|NP_001257419.1|  60S ribosomal protein L18 isoform 2                196   2e-59   
emb|CEP17694.1|  hypothetical protein                                   197   2e-59   
gb|KFM61778.1|  60S ribosomal protein L18                               197   2e-59   
emb|CCX32543.1|  Similar to 60S ribosomal protein L18-B; acc. no....    197   2e-59   
ref|XP_004440285.1|  PREDICTED: ribosomal protein L18-like isoform 2    196   2e-59   
ref|XP_007074184.1|  PREDICTED: ribosomal protein L18-like              197   2e-59   
ref|XP_010385886.1|  PREDICTED: 60S ribosomal protein L18               197   2e-59   
gb|ABD77165.1|  ribosomal protein L18                                   196   2e-59   
gb|ABD77155.1|  ribosomal protein L18                                   196   3e-59   
gb|ETS62502.1|  hypothetical protein PaG_03132                          198   3e-59   
emb|CCA16204.1|  60S ribosomal protein L182 putative                    197   3e-59   
gb|ABD77169.1|  ribosomal protein L18                                   196   3e-59   
gb|ABD77176.1|  ribosomal protein L18                                   196   3e-59   
gb|ABD77168.1|  ribosomal protein L18                                   196   3e-59   
gb|EPB81859.1|  50S ribosomal protein L18e                              197   3e-59   
gb|ABD77170.1|  ribosomal protein L18                                   196   3e-59   
ref|NP_000970.1|  60S ribosomal protein L18 isoform 1                   197   3e-59   
gb|ABD77171.1|  ribosomal protein L18                                   196   3e-59   
ref|XP_004089423.1|  PREDICTED: 60S ribosomal protein L18               197   3e-59   
ref|XP_007731348.1|  large subunit ribosomal protein L18e               196   3e-59   
dbj|GAC74605.1|  armadillo                                              197   3e-59   
ref|XP_006157526.1|  PREDICTED: 60S ribosomal protein L18-like          198   3e-59   
gb|KJB23304.1|  hypothetical protein B456_004G091200                    187   4e-59   
ref|XP_005589842.1|  PREDICTED: uncharacterized LOC101867006 isof...    197   4e-59   
gb|EFB23978.1|  hypothetical protein PANDA_006316                       197   4e-59   
gb|ABD77156.1|  ribosomal protein L18                                   196   4e-59   
ref|NP_001182442.1|  60S ribosomal protein L18                          196   4e-59   
gb|ELR09673.1|  hypothetical protein GMDG_04159                         197   4e-59   
emb|CDI57167.1|  probable 60S ribosomal protein L18                     196   5e-59   
ref|XP_007536290.1|  PREDICTED: 60S ribosomal protein L18               196   5e-59   
gb|ABD77157.1|  ribosomal protein L18                                   196   5e-59   
emb|CEP15166.1|  hypothetical protein                                   197   5e-59   
ref|XP_004451162.1|  PREDICTED: ribosomal protein L18-like              196   6e-59   
emb|CDO74156.1|  hypothetical protein BN946_scf185043.g207              196   6e-59   
ref|XP_002558988.1|  Pc13g05540                                         196   6e-59   
ref|XP_006109734.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    196   7e-59   
ref|XP_004694311.1|  PREDICTED: 60S ribosomal protein L18               196   7e-59   
gb|EPB85693.1|  50S ribosomal protein L18e                              196   8e-59   
gb|ESZ97529.1|  60S ribosomal protein L18                               196   8e-59   
ref|XP_008046838.1|  PREDICTED: 60S ribosomal protein L18 isoform X2    195   8e-59   
emb|CCF54530.1|  probable 60S ribosomal protein L18                     196   8e-59   
ref|XP_001614193.1|  60S ribosomal protein L18                          196   8e-59   
gb|ABD77175.1|  ribosomal protein L18                                   195   9e-59   
ref|XP_008815721.1|  60S ribosomal protein L18                          196   9e-59   
gb|EPB87658.1|  60S ribosomal protein L18-A                             196   9e-59   
emb|CEP19927.1|  hypothetical protein                                   196   9e-59   
ref|XP_006266602.1|  PREDICTED: 60S ribosomal protein L18               197   9e-59   
gb|EPT03125.1|  hypothetical protein FOMPIDRAFT_1022488                 196   9e-59   
emb|CAM91786.1|  hypothetical protein                                   194   1e-58   
gb|ABD77172.1|  ribosomal protein L18                                   195   1e-58   
ref|XP_010366954.1|  PREDICTED: 60S ribosomal protein L18               196   1e-58   
ref|XP_008046837.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    195   1e-58   
ref|NP_001187045.1|  60S ribosomal protein L18                          195   1e-58   
dbj|GAN11649.1|  60S ribosomal protein L18                              197   1e-58   
ref|XP_004223602.1|  60S ribosomal protein L18                          195   1e-58   
gb|ELR56635.1|  60S ribosomal protein L18                               195   1e-58   
ref|NP_001015556.1|  60S ribosomal protein L18                          195   1e-58   
ref|XP_011211055.1|  PREDICTED: 60S ribosomal protein L18               195   1e-58   
ref|XP_007847122.1|  60s ribosomal protein l18                          195   1e-58   
gb|KEF62683.1|  large subunit ribosomal protein L18e                    195   2e-58   
ref|XP_002184066.1|  predicted protein                                  195   2e-58   
dbj|GAC96920.1|  60S ribosomal protein L18                              199   2e-58   
ref|XP_011372891.1|  PREDICTED: 60S ribosomal protein L18               195   2e-58   
gb|AAH21743.1|  Ribosomal protein L18                                   195   2e-58   
ref|XP_007381758.1|  60S ribosomal protein L18                          195   2e-58   
ref|XP_008152619.1|  PREDICTED: 60S ribosomal protein L18               195   2e-58   
ref|XP_007392123.1|  hypothetical protein PHACADRAFT_181562             195   2e-58   
gb|KEQ99810.1|  hypothetical protein AUEXF2481DRAFT_76387               195   2e-58   
ref|NP_001082683.1|  60S ribosomal protein L18-B                        195   2e-58   
ref|XP_004271136.1|  PREDICTED: 60S ribosomal protein L18 isoform 2     194   2e-58   
emb|CDI82997.1|  60S ribosomal protein L18, putative                    195   2e-58   
ref|XP_004780465.1|  PREDICTED: ribosomal protein L18-like              194   2e-58   
ref|XP_007364417.1|  60S ribosomal protein L18                          194   2e-58   
gb|EWM27599.1|  Ribosomal protein L18e/L15P                             194   2e-58   
ref|NP_001155681.1|  60S ribosomal protein L18-like                     194   3e-58   
gb|EHH30225.1|  hypothetical protein EGK_10844                          194   3e-58   
gb|KII96054.1|  hypothetical protein PLICRDRAFT_48977                   194   3e-58   
ref|XP_007315262.1|  hypothetical protein SERLADRAFT_381487             194   3e-58   
dbj|GAK64966.1|  60S ribosomal protein L18                              199   4e-58   
ref|XP_004271135.1|  PREDICTED: 60S ribosomal protein L18 isoform 1     194   4e-58   
ref|XP_006026818.1|  PREDICTED: 60S ribosomal protein L18               194   5e-58   
emb|CDH60299.1|  60s ribosomal protein l18                              193   5e-58   
gb|KIP09821.1|  hypothetical protein PHLGIDRAFT_18483                   194   5e-58   
ref|XP_008622469.1|  60S ribosomal protein L18                          194   5e-58   
ref|XP_010559184.1|  PREDICTED: 60S ribosomal protein L18-2-like        181   6e-58   
gb|KIL67232.1|  hypothetical protein M378DRAFT_22860                    194   6e-58   
ref|XP_005561217.1|  PREDICTED: 60S ribosomal protein L18-like          194   6e-58   
emb|CAA24700.1|  ribosomal protein L14                                  192   6e-58   
dbj|GAM85744.1|  hypothetical protein ANO11243_037520                   193   7e-58   
ref|XP_006868227.1|  PREDICTED: ribosomal protein L18-like              193   7e-58   
ref|XP_009519518.1|  hypothetical protein PHYSODRAFT_284882             194   7e-58   
ref|XP_002809060.1|  60S ribosomal protein L18-2, putative              193   7e-58   
ref|XP_005875781.1|  PREDICTED: 60S ribosomal protein L18-like          193   7e-58   
gb|ETW40547.1|  hypothetical protein PFNF135_04853                      193   7e-58   
gb|ACO51847.1|  60S ribosomal protein L18                               193   7e-58   



>ref|XP_009783807.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score =   293 bits (750),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 141/153 (92%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLIS+T GKEDKIAV+VG++TDDVRAYEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISYTKGKEDKIAVIVGSVTDDVRAYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P L VCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAV+HFGPA
Sbjct  95   PTLMVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVRHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+R SRGYKV
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRKSRGYKV  187


 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGK+K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_009625475.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   293 bits (750),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 141/153 (92%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLIS+  GKEDKIAV+VGTITDDVRAY+V
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISYAKGKEDKIAVIVGTITDDVRAYDV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKVCAL+FTKTARARIEKAGGECLTFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPA
Sbjct  95   PTLKVCALKFTKTARARIEKAGGECLTFDQLALRAPLGQNTLLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+R SRGYKV
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRKSRGYKV  187


 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_009629074.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana tomentosiformis]
 ref|XP_009788537.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana sylvestris]
Length=187

 Score =   292 bits (748),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLIS+  GKEDK+ V+VGTITDDVRAYEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINKPPLSLSRLISYAKGKEDKVVVIVGTITDDVRAYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPA
Sbjct  95   PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTLLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PGVPHSHTKP+VR+KGRKFERARG+RNSRGYK
Sbjct  155  PGVPHSHTKPFVRSKGRKFERARGRRNSRGYK  186


 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_009630920.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   291 bits (746),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/153 (92%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFN VILKRLFMSKTNKPPLSLSRLIS+T GKEDKIAV+VG++TDDVRAYEV
Sbjct  35   FLVRRTGSKFNTVILKRLFMSKTNKPPLSLSRLISYTKGKEDKIAVIVGSVTDDVRAYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P L VCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAV+HFGPA
Sbjct  95   PTLMVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVRHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+R SRGYKV
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRKSRGYKV  187


 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGK+K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>gb|KDP28183.1| hypothetical protein JCGZ_13954 [Jatropha curcas]
Length=187

 Score =   291 bits (745),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/153 (92%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLISFT GKEDKIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINKPPLSLSRLISFTKGKEDKIAVVVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187


 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_009772706.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
 ref|XP_009772708.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score =   289 bits (739),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/153 (92%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTG KFNAVILKRLFMSKTNKPPLSLSRLIS+  GKE KIAV+VGTITDDVRAY+V
Sbjct  35   FLVRRTGCKFNAVILKRLFMSKTNKPPLSLSRLISYAKGKEGKIAVIVGTITDDVRAYDV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPA
Sbjct  95   PTLKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTLLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+R SRGYKV
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRKSRGYKV  187


 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_009796134.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score =   288 bits (738),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLV+RTGSKFN VILK LFMSKTNKPPLSLSRLIS+  GKEDKI V+VGTITDDVRAY+V
Sbjct  35   FLVQRTGSKFNTVILKWLFMSKTNKPPLSLSRLISYAKGKEDKIVVIVGTITDDVRAYDV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPA
Sbjct  95   PTLKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTILLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+R SRGYKV
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRKSRGYKV  187


 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 40/50 (80%), Gaps = 7/50 (14%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  539
            MGIDLKAGGKSK+TKRTAPKSDDVYLKL+VKLYRF        VQR  S+
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLIVKLYRFL-------VQRTGSK  43



>ref|NP_001237789.1| uncharacterized protein LOC100500164 [Glycine max]
 gb|ACU15099.1| unknown [Glycine max]
 gb|KHN16096.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score =   288 bits (737),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI +T GKEDKIAV+VG ITDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIKYTKGKEDKIAVVVGNITDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  187


 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>gb|KJB41867.1| hypothetical protein B456_007G127300 [Gossypium raimondii]
Length=187

 Score =   288 bits (736),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLI F  GKEDKIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLIQFMKGKEDKIAVVVGAVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFERARG+RNS+G++V
Sbjct  155  PGVPHSHTKPYVRAKGRKFERARGRRNSKGFRV  187


 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>gb|KJB41866.1| hypothetical protein B456_007G127300, partial [Gossypium raimondii]
Length=227

 Score =   289 bits (739),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLI F  GKEDKIAV+VG +TDD+R YEV
Sbjct  75   FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLIQFMKGKEDKIAVVVGAVTDDIRVYEV  134

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  135  PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  194

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFERARG+RNS+G++V
Sbjct  195  PGVPHSHTKPYVRAKGRKFERARGRRNSKGFRV  227


 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -2

Query  685  GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            GIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  42   GIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  76



>ref|XP_008450608.1| PREDICTED: 60S ribosomal protein L18-2 [Cucumis melo]
Length=187

 Score =   287 bits (735),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI F  GKE KIAV+VGTITDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIQFMKGKESKIAVVVGTITDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  95   PALKVAALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVR+KGRKFERARGKRNSRGY+V
Sbjct  155  PGVPHSHSKPYVRSKGRKFERARGKRNSRGYRV  187


 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKR APKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRVAPKSDDIYLKLLVKLYRFL  36



>ref|XP_002301485.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|EEE80758.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   287 bits (735),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI+F  GKEDKIAV+VGTITDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINKPPLSLSRLITFMKGKEDKIAVVVGTITDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPY+R+KGRKFE+ARGKRNS+G++V
Sbjct  155  PGVPHSHTKPYIRSKGRKFEKARGKRNSKGFRV  187


 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>gb|KGN66048.1| hypothetical protein Csa_1G569250 [Cucumis sativus]
Length=244

 Score =   289 bits (740),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/153 (92%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI FT GKE KIAV+VGTITDD+R YEV
Sbjct  92   FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIQFTKGKESKIAVVVGTITDDIRVYEV  151

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  152  PALKVAALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  211

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVR+KGRKFERARGKRNSRGY+V
Sbjct  212  PGVPHSHSKPYVRSKGRKFERARGKRNSRGYRV  244


 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  703  QRRSTMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            +R   MGIDL AGGKSK+TKR APKSDD+YLKLLVKLYRF 
Sbjct  53   RRAFVMGIDLVAGGKSKKTKRVAPKSDDIYLKLLVKLYRFL  93



>gb|KJB45330.1| hypothetical protein B456_007G301700 [Gossypium raimondii]
Length=187

 Score =   287 bits (734),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GKEDKIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRK+ERARG+RNS+G++V
Sbjct  155  PGVPHSHTKPYVRSKGRKYERARGRRNSKGFRV  187


 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_007031040.1| Ribosomal protein L18 [Theobroma cacao]
 gb|EOY11542.1| Ribosomal protein L18 [Theobroma cacao]
Length=187

 Score =   286 bits (733),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GKEDKIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+RNS+G++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRNSKGFRV  187


 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_006344694.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum tuberosum]
Length=187

 Score =   286 bits (732),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FL RRTGSKFNAVILKRLFMSK NKPPLSLSRLIS+  GK DK  VLVGT+TDDVRAYEV
Sbjct  35   FLARRTGSKFNAVILKRLFMSKINKPPLSLSRLISYAEGKGDKTVVLVGTVTDDVRAYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKVCAL+FTKTARARIEKAGGECLTFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPA
Sbjct  95   PKLKVCALKFTKTARARIEKAGGECLTFDQLALRAPLGQNTLLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFERARGKR SRGYKV
Sbjct  155  PGVPHSHTKPYVRAKGRKFERARGKRKSRGYKV  187


 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_010025256.1| PREDICTED: 60S ribosomal protein L18-2 [Eucalyptus grandis]
 gb|KCW61872.1| hypothetical protein EUGRSUZ_H04551 [Eucalyptus grandis]
Length=187

 Score =   286 bits (732),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAV+LKRLFMSK NKPPLSLSRLI +T GKEDKIAV+VGTITDD+R +EV
Sbjct  35   FLVRRTGSKFNAVVLKRLFMSKVNKPPLSLSRLIRYTQGKEDKIAVVVGTITDDIRVHEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187


 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_002523106.1| 60S ribosomal protein L18, putative [Ricinus communis]
 gb|EEF39291.1| 60S ribosomal protein L18, putative [Ricinus communis]
Length=187

 Score =   286 bits (731),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI+F  GKE+KIAV+VGT+TDDVR YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINKAPLSLSRLITFMKGKENKIAVIVGTVTDDVRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  187


 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKSDD+YLKL+VKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLIVKLYRFL  36



>gb|KJB82632.1| hypothetical protein B456_013G206100 [Gossypium raimondii]
Length=187

 Score =   285 bits (730),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GKEDKIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR++GRKFERARG+RNS+G++V
Sbjct  155  PGVPHSHTKPYVRSRGRKFERARGRRNSKGFRV  187


 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVK+YRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKIYRFL  36



>ref|XP_010088293.1| 60S ribosomal protein L18-3 [Morus notabilis]
 gb|EXB33518.1| 60S ribosomal protein L18-3 [Morus notabilis]
Length=197

 Score =   286 bits (731),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAV+LKRLFMSK NKPPLSLSRLI F  GKEDK+AV+VGT+TDD+R YEV
Sbjct  45   FLVRRTGSNFNAVVLKRLFMSKVNKPPLSLSRLIRFMKGKEDKVAVVVGTVTDDIRVYEV  104

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  105  PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  164

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARGKRNSRG++V
Sbjct  165  PGVPHSHTKPYVRSKGRKFERARGKRNSRGFRV  197


 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -2

Query  685  GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            GIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRF 
Sbjct  12   GIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFL  46



>gb|KHN20393.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=274

 Score =   288 bits (738),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GKEDKIAV+VG +TDD+R YEV
Sbjct  122  FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIRYTKGKEDKIAVVVGAVTDDIRVYEV  181

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  182  PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  241

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFERARGKRNSRG++V
Sbjct  242  PGVPHSHTKPYVRAKGRKFERARGKRNSRGFRV  274


 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  694  STMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            S MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  86   SAMGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  123



>gb|KJB23303.1| hypothetical protein B456_004G091200 [Gossypium raimondii]
Length=187

 Score =   285 bits (729),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GKEDKIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARI+KAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIDKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+RNS+G++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRNSKGFRV  187


 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDD+YLKL+VKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLIVKLYRFL  36



>ref|XP_008454015.1| PREDICTED: 60S ribosomal protein L18-3 [Cucumis melo]
Length=187

 Score =   285 bits (729),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMSK NKPP+SLSRLI +  GKE KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPISLSRLIKYMKGKEAKIAVVVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARGKRNSRGY+V
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGKRNSRGYRV  187


 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_006382454.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|ABK93398.1| unknown [Populus trichocarpa]
 gb|ABK93783.1| unknown [Populus trichocarpa]
 gb|ERP60251.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   285 bits (728),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS+FNAVILKRLFMSK NK PLSLSRLI+F  GKEDKIAVLVGT+TDD+R YEV
Sbjct  35   FLVRRTGSRFNAVILKRLFMSKINKAPLSLSRLITFMKGKEDKIAVLVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKP+VRAKGRKFE+ARGKRNSRG++V
Sbjct  155  PGVPHSHTKPFVRAKGRKFEKARGKRNSRGFRV  187


 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLK GGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKRGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_011036896.1| PREDICTED: 60S ribosomal protein L18-2 [Populus euphratica]
Length=187

 Score =   285 bits (728),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS+FNAVILKRLFMSK NK PLSLSRLI+F  GKEDKIAVLVGT+TDD+R YEV
Sbjct  35   FLVRRTGSRFNAVILKRLFMSKINKAPLSLSRLITFMKGKEDKIAVLVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKP+VRAKGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSHTKPFVRAKGRKFERARGRRNSRGFRV  187


 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLK GGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKRGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_010313195.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum lycopersicum]
Length=187

 Score =   285 bits (728),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FL RRTGSKFNAVILKRLFMSK NKPPLSLSRLIS+  GK DK  VLVGT+TDDVRAYEV
Sbjct  35   FLARRTGSKFNAVILKRLFMSKINKPPLSLSRLISYAEGKGDKTVVLVGTVTDDVRAYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKVCAL+FTKTARARIEKAGGECLTFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPA
Sbjct  95   PKLKVCALKFTKTARARIEKAGGECLTFDQLALRAPLGQNTLLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PGVPHSHTKPYVRAKGRKFERARGKR SRGYK
Sbjct  155  PGVPHSHTKPYVRAKGRKFERARGKRKSRGYK  186


 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|NP_001236071.1| uncharacterized protein LOC100499789 [Glycine max]
 gb|ACU13660.1| unknown [Glycine max]
Length=187

 Score =   285 bits (728),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +  GKEDKIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIRYAKGKEDKIAVVVGAVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFERARGKRNSRG++V
Sbjct  155  PGVPHSHTKPYVRAKGRKFERARGKRNSRGFRV  187


 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_003556523.1| PREDICTED: 60S ribosomal protein L18-2-like [Glycine max]
Length=187

 Score =   285 bits (728),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GKEDKIAV+VG+ITDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIKYTKGKEDKIAVVVGSITDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PPLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  187


 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>gb|KHN43503.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score =   285 bits (728),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAV+LKRLFMSK NKPPLSLSRLI +T GKEDKIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTGSNFNAVVLKRLFMSKVNKPPLSLSRLIRYTKGKEDKIAVVVGAVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  187


 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>gb|KHN20252.1| 60S ribosomal protein L18-3, partial [Glycine soja]
Length=187

 Score =   285 bits (728),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GKEDKIAV+VG+ITDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIKYTKGKEDKIAVVVGSITDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PPLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  187


 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = -2

Query  685  GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            GIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  2    GIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_004144773.1| PREDICTED: 60S ribosomal protein L18-3-like [Cucumis sativus]
 ref|XP_004158733.1| PREDICTED: 60S ribosomal protein L18-3-like [Cucumis sativus]
 gb|KGN60965.1| hypothetical protein Csa_2G032220 [Cucumis sativus]
Length=187

 Score =   285 bits (728),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMSK NKPP+SLSRLI + +GKE +IAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPISLSRLIKYMNGKEGRIAVIVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARGKRNSRGY+V
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGKRNSRGYRV  187


 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_007050976.1| Ribosomal protein L18 isoform 3 [Theobroma cacao]
 gb|EOX95133.1| Ribosomal protein L18 isoform 3 [Theobroma cacao]
Length=186

 Score =   285 bits (728),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F   KEDKIAV+VGT+TDD+R YEV
Sbjct  34   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKCKEDKIAVVVGTVTDDIRVYEV  93

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  94   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  153

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+RNS+G++V
Sbjct  154  PGVPHSHTKPYVRSKGRKFERARGRRNSKGFRV  186


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 1/36 (3%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK++KRTAPKSDD+YLKLL +LYRF 
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLL-QLYRFL  35



>ref|XP_011042004.1| PREDICTED: 60S ribosomal protein L18-2-like [Populus euphratica]
Length=187

 Score =   284 bits (727),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLI++  GKE KIAV+VGTITDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLITYMKGKEGKIAVVVGTITDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PAIKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPY+R+KGRKFE+ARGKRNS+G++V
Sbjct  155  PGVPHSHTKPYIRSKGRKFEKARGKRNSKGFRV  187


 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_006359857.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum tuberosum]
Length=187

 Score =   284 bits (727),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FL RRTGSKFNAVILKRLFMSK NK PLSLSRL+++ +GKED IAV+VGT+TDDVRAYEV
Sbjct  35   FLARRTGSKFNAVILKRLFMSKINKAPLSLSRLVTYMTGKEDNIAVIVGTVTDDVRAYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P +KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG A
Sbjct  95   PKIKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV
Sbjct  155  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  187


 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKR APKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRIAPKSDDVYLKLLVKLYRFL  36



>ref|XP_007050974.1| Ribosomal protein L18 isoform 1 [Theobroma cacao]
 gb|EOX95131.1| Ribosomal protein L18 isoform 1 [Theobroma cacao]
Length=187

 Score =   284 bits (727),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F   KEDKIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKCKEDKIAVVVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+RNS+G++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRNSKGFRV  187


 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_002320999.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|ABK93820.1| unknown [Populus trichocarpa]
 gb|EEE99314.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   284 bits (726),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSKTNKPPL+LSRLI++  GKE KIAV+VGTITDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKTNKPPLALSRLITYMKGKEGKIAVVVGTITDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPY+R+KGRKFE+ARGKRNS+G++V
Sbjct  155  PGVPHSHTKPYIRSKGRKFEKARGKRNSKGFRV  187


 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>gb|KHF98574.1| 60S ribosomal L18-2 -like protein [Gossypium arboreum]
 gb|KJB22518.1| hypothetical protein B456_004G052100 [Gossypium raimondii]
Length=187

 Score =   284 bits (726),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI +  GKEDKIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIQYMKGKEDKIAVVVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+ GRKFERARG+RNS+G++V
Sbjct  155  PGVPHSHTKPYVRSNGRKFERARGRRNSKGFRV  187


 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|NP_001236701.1| uncharacterized protein LOC100306301 [Glycine max]
 gb|ACU14418.1| unknown [Glycine max]
Length=187

 Score =   284 bits (726),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAV+LKRLFMSK NKPPLSLSRLI +T GKEDKIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTGSNFNAVVLKRLFMSKVNKPPLSLSRLIRYTKGKEDKIAVVVGAVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFERARG++NSRG++V
Sbjct  155  PGVPHSHTKPYVRAKGRKFERARGRKNSRGFRV  187


 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_006433453.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
 ref|XP_006472133.1| PREDICTED: 60S ribosomal protein L18-3-like [Citrus sinensis]
 gb|ESR46693.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
Length=187

 Score =   283 bits (725),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FN VILKRLFMSK NKPPLSLSRLI+F  GKEDKIAV+VGT+TDD+RAYEV
Sbjct  35   FLVRRTDSNFNKVILKRLFMSKVNKPPLSLSRLINFMKGKEDKIAVVVGTVTDDIRAYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187


 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 39/50 (78%), Gaps = 7/50 (14%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  539
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRF        V+R DS 
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFL-------VRRTDSN  43



>ref|XP_010528904.1| PREDICTED: 60S ribosomal protein L18-2 [Tarenaya hassleriana]
Length=187

 Score =   283 bits (724),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMSK NK P+SLSRL+ F  GKEDK+AV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSSFNAVILKRLFMSKVNKAPISLSRLVRFMQGKEDKVAVIVGTVTDDLRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFERARG+RNSRG+KV
Sbjct  155  PGVPHSHTKPYVRAKGRKFERARGRRNSRGFKV  187


 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKR APKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRVAPKSDDVYLKLLVKLYRFL  36



>ref|XP_004135776.1| PREDICTED: uncharacterized protein LOC101207642 [Cucumis sativus]
 ref|XP_004169487.1| PREDICTED: uncharacterized protein LOC101228164 [Cucumis sativus]
Length=389

 Score =   290 bits (742),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 140/153 (92%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI FT GKE KIAV+VGTITDD+R YEV
Sbjct  237  FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIQFTKGKESKIAVVVGTITDDIRVYEV  296

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  297  PALKVAALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  356

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVR+KGRKFERARGKRNSRGY+V
Sbjct  357  PGVPHSHSKPYVRSKGRKFERARGKRNSRGYRV  389


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  703  QRRSTMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            +R   MGIDL AGGKSK+TKR APKSDD+YLKLLVKLYRF 
Sbjct  198  RRAFVMGIDLVAGGKSKKTKRVAPKSDDIYLKLLVKLYRFL  238



>ref|XP_010094463.1| 60S ribosomal protein L18-2 [Morus notabilis]
 gb|EXB56096.1| 60S ribosomal protein L18-2 [Morus notabilis]
Length=198

 Score =   283 bits (724),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GKE KIAV+VGT+TDD+R Y+V
Sbjct  46   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIRFMQGKESKIAVVVGTVTDDIRVYDV  105

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLAL+APLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  106  PALKVTALRFTETARARIEKAGGECLTFDQLALKAPLGQNTVLLRGPKNAREAVKHFGPA  165

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARGKRNSRG++V
Sbjct  166  PGVPHSHTKPYVRSKGRKFERARGKRNSRGFRV  198


 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -2

Query  685  GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            GID+ AGGKSK++KRTAPKSDD+YLKLLVKLYRF 
Sbjct  13   GIDIVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFL  47



>ref|XP_010043043.1| PREDICTED: 60S ribosomal protein L18-2 [Eucalyptus grandis]
 gb|KCW85064.1| hypothetical protein EUGRSUZ_B01908 [Eucalyptus grandis]
Length=187

 Score =   282 bits (722),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI +T GKEDKIAV+VGT+TDD+R Y+V
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKAPLSLSRLIRYTQGKEDKIAVVVGTVTDDIRVYDV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+T RARIEKAGGECLTFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETVRARIEKAGGECLTFDQLALRAPLGQNTILLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187


 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_004495692.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score =   282 bits (722),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GKE KIAV+VG ITDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIKYTKGKEGKIAVVVGAITDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PAIKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFE+ARGKRNSRG++V
Sbjct  155  PGVPHSHTKPYVRAKGRKFEKARGKRNSRGFRV  187


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK++KRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKSKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_007163123.1| hypothetical protein PHAVU_001G208200g [Phaseolus vulgaris]
 gb|ESW35117.1| hypothetical protein PHAVU_001G208200g [Phaseolus vulgaris]
Length=187

 Score =   282 bits (722),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GKE+KIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIRYTKGKENKIAVVVGAVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVRAKGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSHSKPYVRAKGRKFERARGRRNSRGFRV  187


 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_009630742.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   282 bits (721),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            F VRRT SKFNAVILKRLFMSKTNKPPLSLSRLIS+  GKE+KIAV+VGTITDDVRAY+V
Sbjct  35   FFVRRTESKFNAVILKRLFMSKTNKPPLSLSRLISYVKGKENKIAVIVGTITDDVRAYDV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNT+LL+GPKN+REAVKHFGPA
Sbjct  95   PTLKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTLLLKGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPY+ +KGRKFERARG R SRGYKV
Sbjct  155  PGVPHSHTKPYMHSKGRKFERARGIRKSRGYKV  187


 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MG+DLK GGKSK+TKRT PKSDDVYLKLLVKLYRFF
Sbjct  1    MGVDLKVGGKSKKTKRTTPKSDDVYLKLLVKLYRFF  36



>gb|KDP23459.1| hypothetical protein JCGZ_23292 [Jatropha curcas]
Length=187

 Score =   282 bits (721),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI F  GKE KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKTPLSLSRLIRFMKGKESKIAVVVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187


 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>gb|KHG07157.1| 60S ribosomal L18-2 -like protein [Gossypium arboreum]
Length=207

 Score =   283 bits (723),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFM K NKPPLSLSRLI F  GKEDKIAV+VGT+TDD+R YEV
Sbjct  55   FLVRRTGSKFNAVILKRLFMCKVNKPPLSLSRLIEFMKGKEDKIAVVVGTVTDDIRIYEV  114

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFTKTARARI+KAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  115  PALKVTALRFTKTARARIDKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  174

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+K RKFERARG+RNS+G++V
Sbjct  175  PGVPHSHTKPYVRSKARKFERARGRRNSKGFRV  207


 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  712  PPLQRRSTMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            P +     MGIDL AGGKSK+TKRTAPKSDD+YLKL+VKLYRF 
Sbjct  13   PLVSASQAMGIDLVAGGKSKKTKRTAPKSDDIYLKLIVKLYRFL  56



>ref|XP_010104147.1| 60S ribosomal protein L18-2 [Morus notabilis]
 gb|EXB98712.1| 60S ribosomal protein L18-2 [Morus notabilis]
Length=209

 Score =   283 bits (723),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GKE KIAV+VGT+TDD+R Y+V
Sbjct  57   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIRFMQGKESKIAVVVGTVTDDIRVYDV  116

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLAL+APLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  117  PALKVTALRFTETARARIEKAGGECLTFDQLALKAPLGQNTVLLRGPKNAREAVKHFGPA  176

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARGKRNSRG++V
Sbjct  177  PGVPHSHTKPYVRSKGRKFERARGKRNSRGFRV  209


 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -2

Query  685  GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            GID+ AGGKSK++KRTAPKSDD+YLKLLVKLYRF 
Sbjct  24   GIDIVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFL  58



>gb|ADD54595.1| putative ribosomal protein L18 [Linum usitatissimum]
Length=154

 Score =   280 bits (717),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI FT GKE KIAV+VGTITDD+R Y+V
Sbjct  2    FLVRRTGSSFNAVILKRLFMSKVNKPPLSLSRLIRFTKGKEGKIAVVVGTITDDIRVYDV  61

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  62   PAMKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  121

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  122  PGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  154



>gb|KHN03962.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score =   281 bits (719),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMSK NKPP+SLSRLI +T GKEDKIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPISLSRLIKYTKGKEDKIAVIVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALK+ AL+FT+ ARARIEKAGGECLTFD+LALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKITALKFTERARARIEKAGGECLTFDELALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  187


 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>emb|CDO98841.1| unnamed protein product [Coffea canephora]
Length=243

 Score =   283 bits (724),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS+FNAV+LKRLFMSKTNKPPLSLSRL+ F  GKEDKIAVLVGT+TDD R YEV
Sbjct  91   FLVRRTGSRFNAVLLKRLFMSKTNKPPLSLSRLVKFMEGKEDKIAVLVGTVTDDTRVYEV  150

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  151  PTLKVAALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  210

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRA GRKFERARG+RNSRG++V
Sbjct  211  PGVPHSHTKPYVRATGRKFERARGRRNSRGFRV  243


 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGK K+TKRTAPKS D+YLKLLVKLYRF 
Sbjct  57   MGIDLKAGGKVKKTKRTAPKSHDIYLKLLVKLYRFL  92



>ref|XP_010659657.1| PREDICTED: 60S ribosomal protein L18-2-like [Vitis vinifera]
 emb|CAN65685.1| hypothetical protein VITISV_022459 [Vitis vinifera]
Length=187

 Score =   280 bits (717),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRL+ +  GKE KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLVRYMGGKEGKIAVVVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG A
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187


 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_003554636.2| PREDICTED: 60S ribosomal protein L18-2-like [Glycine max]
 gb|KHN43312.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=214

 Score =   281 bits (719),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FNAVILKRLFMSK NKPP+SLSRLI +T GKEDKIAV+VGT+TDD+R YEV
Sbjct  62   FLVRRTDSNFNAVILKRLFMSKVNKPPISLSRLIKYTKGKEDKIAVVVGTVTDDIRVYEV  121

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALK+ AL+FT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  122  PALKITALKFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  181

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFERARG+RNSRG++V
Sbjct  182  PGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  214


 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 7/52 (13%)
 Frame = -2

Query  694  STMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  539
            + MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF        V+R DS 
Sbjct  26   AAMGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL-------VRRTDSN  70



>gb|AFK49563.1| unknown [Lotus japonicus]
Length=187

 Score =   280 bits (715),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMSK NKPP+SLSRLI +  GKEDK+ V+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPISLSRLIKYAKGKEDKVVVIVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE ARGKRNS+G++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFEMARGKRNSKGFRV  187


 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKR APKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRIAPKSNDIYLKLLVKLYRFL  36



>ref|XP_007144959.1| hypothetical protein PHAVU_007G197900g [Phaseolus vulgaris]
 gb|ESW16953.1| hypothetical protein PHAVU_007G197900g [Phaseolus vulgaris]
Length=187

 Score =   279 bits (714),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GKE KIAV+VGTITDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIKYTKGKEGKIAVVVGTITDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P+LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PSLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHS+TKPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  155  PGVPHSNTKPYVRSKGRKFEKARGRRNSRGFRV  187


 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_010546736.1| PREDICTED: 60S ribosomal protein L18-3 [Tarenaya hassleriana]
Length=187

 Score =   279 bits (714),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMSK NK PLSLSRL+ F  GKED+I V+VGT+TDDVR YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKAPLSLSRLVRFMQGKEDQIGVIVGTVTDDVRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+R SRG+KV
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRKSRGFKV  187


 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_002270635.1| PREDICTED: 60S ribosomal protein L18-2 [Vitis vinifera]
Length=187

 Score =   279 bits (713),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPP+SLSRLI +  GKEDKIAVLVGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINKPPMSLSRLIRYMQGKEDKIAVLVGTVTDDLRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFG A
Sbjct  95   PTLKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187


 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_002319502.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|EEE95425.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   279 bits (713),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRLI++T GKE KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTQSKFNAVILKRLFMSKINKAPLSLSRLITYTKGKEGKIAVVVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PTLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFE+ARGKRNS+G++V
Sbjct  155  PGVPHSHTKPYVRAKGRKFEKARGKRNSKGFRV  187


 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_010544997.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score =   278 bits (712),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI +  GKED+I V+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIRYMQGKEDQIGVIVGTVTDDARVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALK+ ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKITALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+R SRG+KV
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRKSRGFKV  187


 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>emb|CDP17112.1| unnamed protein product [Coffea canephora]
Length=234

 Score =   280 bits (716),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFN VILKRLFMSK NKP LSLSRLI++T GKEDKIAV+VGT+TDD R YEV
Sbjct  82   FLVRRTGSKFNVVILKRLFMSKINKPALSLSRLITYTKGKEDKIAVVVGTVTDDTRVYEV  141

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P+LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  142  PSLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  201

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHS+TKPYVR+ GRKFERARG+RNSRG++V
Sbjct  202  PGVPHSNTKPYVRSSGRKFERARGRRNSRGFRV  234


 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 42/53 (79%), Gaps = 7/53 (13%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSEASV  530
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF        V+R  S+ +V
Sbjct  48   MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL-------VRRTGSKFNV  93



>ref|XP_007147006.1| hypothetical protein PHAVU_006G088800g [Phaseolus vulgaris]
 gb|ESW19000.1| hypothetical protein PHAVU_006G088800g [Phaseolus vulgaris]
Length=187

 Score =   278 bits (712),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GKEDKIAV+VGTITDD+R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIRYTKGKEDKIAVVVGTITDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LK+ AL+FT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PQLKITALKFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  155  PGVPHSHSKPYVRSKGRKFEKARGRRNSRGFRV  187


 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_006444385.1| hypothetical protein CICLE_v10022435mg [Citrus clementina]
 ref|XP_006479993.1| PREDICTED: 60S ribosomal protein L18-3-like [Citrus sinensis]
 gb|ESR57625.1| hypothetical protein CICLE_v10022435mg [Citrus clementina]
 gb|KDO87175.1| hypothetical protein CISIN_1g029841mg [Citrus sinensis]
 gb|KDO87176.1| hypothetical protein CISIN_1g029841mg [Citrus sinensis]
Length=187

 Score =   278 bits (712),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S F+ VILKRLFMSK NKPP+SLSRL  F  GKEDKIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTDSNFDKVILKRLFMSKVNKPPMSLSRLTKFMKGKEDKIAVVVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARGKRNSRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGKRNSRGFRV  187


 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 7/50 (14%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  539
            MGIDL AGGKSK++KRTAPKS+D+YLKLLVKLYRF        V+R DS 
Sbjct  1    MGIDLIAGGKSKKSKRTAPKSNDIYLKLLVKLYRFL-------VRRTDSN  43



>ref|XP_008386678.1| PREDICTED: 60S ribosomal protein L18-2-like [Malus domestica]
Length=187

 Score =   278 bits (710),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI + +GKE KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKAPLSLSRLIKYMTGKEGKIAVVVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPA
Sbjct  95   PCLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTILLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187


 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_010559185.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score =   278 bits (710),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI +  GK+DKI V+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIRYMQGKKDKIGVIVGTVTDDARVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALK+ ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKITALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+R SRG+KV
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRKSRGFKV  187


 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_010684349.1| PREDICTED: 60S ribosomal protein L18-2-like [Beta vulgaris subsp. 
vulgaris]
Length=187

 Score =   277 bits (709),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAV+LKRLFMSK NK PLSLSRL+ +  GK+ +IAVLVGTITDD+R YEV
Sbjct  35   FLVRRTGSKFNAVVLKRLFMSKINKAPLSLSRLVKYMEGKDGRIAVLVGTITDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P +KVCALRFT+TARARIEKAGGEC+TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG A
Sbjct  95   PTMKVCALRFTETARARIEKAGGECITFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRA GRKFERARG+RNSRGY+V
Sbjct  155  PGVPHSHTKPYVRANGRKFERARGRRNSRGYRV  187


 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKS+DVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDVYLKLLVKLYRFL  36



>ref|XP_010523956.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score =   277 bits (709),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI +  GKED I V+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIRYMEGKEDNIGVIVGTVTDDARVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALK+ ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKITALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+R SRG+KV
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRKSRGFKV  187


 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>emb|CBI39539.3| unnamed protein product [Vitis vinifera]
Length=249

 Score =   279 bits (714),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRL+ +  GKE KIAV+VGT+TDD+R YEV
Sbjct  97   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLVRYMGGKEGKIAVVVGTVTDDIRVYEV  156

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG A
Sbjct  157  PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGKA  216

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  217  PGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  249


 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  691  TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            TMGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  62   TMGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  98



>ref|XP_010674074.1| PREDICTED: 60S ribosomal protein L18-2 [Beta vulgaris subsp. 
vulgaris]
Length=187

 Score =   277 bits (708),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FN V+LKRLFMSK NK PLSLSRLI++  GKEDKIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTGSSFNGVVLKRLFMSKINKAPLSLSRLITYMKGKEDKIAVIVGAVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFG A
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRA GRKFERARG+RNSRGY+V
Sbjct  155  PGVPHSHTKPYVRANGRKFERARGRRNSRGYRV  187


 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKS+DVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDVYLKLLVKLYRFL  36



>ref|XP_011023716.1| PREDICTED: 60S ribosomal protein L18-2 [Populus euphratica]
Length=187

 Score =   277 bits (708),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRLI++T GKE KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTQSKFNAVILKRLFMSKINKAPLSLSRLITYTKGKEGKIAVVVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFG A
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGRA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFE+ARGKRNS+G++V
Sbjct  155  PGVPHSHTKPYVRAKGRKFEKARGKRNSKGFRV  187


 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_009338229.1| PREDICTED: 60S ribosomal protein L18-2-like [Pyrus x bretschneideri]
Length=187

 Score =   277 bits (708),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI +  GK++KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKAPLSLSRLIKYMQGKDNKIAVVVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P +KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQN VLLRGPKNSREAVKHFGPA
Sbjct  95   PQMKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNVVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187


 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_008388515.1| PREDICTED: 60S ribosomal protein L18-2-like [Malus domestica]
Length=187

 Score =   277 bits (708),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI +  GK+ KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKAPLSLSRLIKYMQGKDSKIAVVVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQN VLLRGPKNSREAVKHFGPA
Sbjct  95   PQLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNVVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187


 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>gb|ABK92688.1| unknown [Populus trichocarpa]
Length=187

 Score =   277 bits (708),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRLI++T GKE KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTQSKFNAVILKRLFMSKINKAPLSLSRLITYTKGKEGKIAVVVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PTLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPH HTKPYVRAKGRKFE+ARGKRNS+G++V
Sbjct  155  PGVPHGHTKPYVRAKGRKFEKARGKRNSKGFRV  187


 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_010259492.1| PREDICTED: 60S ribosomal protein L18-3 [Nelumbo nucifera]
Length=187

 Score =   276 bits (707),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMS+ NK P+SLSRLISF  GKEDKIAV+VGT+TDD R YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSRVNKAPMSLSRLISFMKGKEDKIAVIVGTVTDDTRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARI KAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFG A
Sbjct  95   PALKVTALRFTETARARILKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187


 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_010931680.1| PREDICTED: 60S ribosomal protein L18-2 [Elaeis guineensis]
Length=187

 Score =   276 bits (707),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPP+SL RLI F  GKEDKIAV+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINKPPISLKRLIRFMEGKEDKIAVIVGTVTDDKRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARI +AGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PAMKVTALRFTETARARILQAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  187


 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG+SK+ +RTAP+SDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRSKKARRTAPRSDDVYLKLLVKLYRFL  36



>ref|NP_187210.1| 60S ribosomal protein L18-2 [Arabidopsis thaliana]
 sp|P42791.2|RL182_ARATH RecName: Full=60S ribosomal protein L18-2 [Arabidopsis thaliana]
 gb|AAF26138.1|AC011620_14 putative 60S ribosomal protein L18 [Arabidopsis thaliana]
 gb|AAK59824.1| AT3g05590/F18C1_14 [Arabidopsis thaliana]
 gb|AAL31164.1| AT3g05590/F18C1_14 [Arabidopsis thaliana]
 gb|AEE74263.1| 60S ribosomal protein L18-2 [Arabidopsis thaliana]
Length=187

 Score =   276 bits (707),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFN VILKRLFMSK NK PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+
Sbjct  35   FLVRRTNSKFNGVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  95   PAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  155  PGVPHSHSKPYVRAKGRKFEKARGKRKSRGFKV  187


 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  36



>ref|XP_009134833.1| PREDICTED: 60S ribosomal protein L18-2 [Brassica rapa]
Length=187

 Score =   276 bits (707),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+
Sbjct  35   FLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  95   PAIKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  155  PGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  187


 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  36



>ref|NP_001235897.1| uncharacterized protein LOC100527681 [Glycine max]
 gb|ACU16823.1| unknown [Glycine max]
Length=187

 Score =   276 bits (706),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  582  LVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVP  403
            LVRRTGS FNAVILKRLFMSK NKPP+SLSRLI +T GKEDKIAV+VGT+TDD+R YEVP
Sbjct  36   LVRRTGSNFNAVILKRLFMSKVNKPPISLSRLIKYTKGKEDKIAVIVGTVTDDIRVYEVP  95

Query  402  ALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAP  223
            ALK+ AL+ T+ ARARIEKAGGECLTFD+LALRAPLGQNTVLLRGPKN+REAVKHFGPAP
Sbjct  96   ALKITALKSTERARARIEKAGGECLTFDELALRAPLGQNTVLLRGPKNAREAVKHFGPAP  155

Query  222  GVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            GVPHSHTKPYVRAKGRKFERARG+RNSRG++V
Sbjct  156  GVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  187


 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYR  587
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYR
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYR  34



>ref|XP_009335702.1| PREDICTED: 60S ribosomal protein L18-2 [Pyrus x bretschneideri]
 ref|XP_009335725.1| PREDICTED: 60S ribosomal protein L18-2 [Pyrus x bretschneideri]
Length=187

 Score =   276 bits (706),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI + +GKE KIAV+VGT+TDD+R Y+V
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKAPLSLSRLIKYMTGKEGKIAVVVGTVTDDIRVYDV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPA
Sbjct  95   PCLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTILLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187


 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_007201344.1| hypothetical protein PRUPE_ppa012001mg [Prunus persica]
 ref|XP_008235116.1| PREDICTED: 60S ribosomal protein L18-2 [Prunus mume]
 gb|EMJ02543.1| hypothetical protein PRUPE_ppa012001mg [Prunus persica]
Length=187

 Score =   276 bits (706),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKF+AVILKRLFMSK NK PLSLSRLI + +GK+ KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFSAVILKRLFMSKVNKAPLSLSRLIRYMNGKDGKIAVVVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187


 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>emb|CBI22977.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   278 bits (712),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPP+SLSRLI +  GKEDKIAVLVGT+TDD+R YEV
Sbjct  102  FLVRRTGSKFNAVILKRLFMSKINKPPMSLSRLIRYMQGKEDKIAVLVGTVTDDLRVYEV  161

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFG A
Sbjct  162  PTLKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKA  221

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  222  PGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  254


 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 38/59 (64%), Gaps = 15/59 (25%)
 Frame = -2

Query  712  PPLQRRSTMG---------------IDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            PPL+ R   G               IDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  45   PPLESRLVRGSPLAVGGGAAAAAMGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  103



>ref|XP_007205962.1| hypothetical protein PRUPE_ppa012012mg [Prunus persica]
 ref|XP_008245548.1| PREDICTED: 60S ribosomal protein L18-2 [Prunus mume]
 gb|EMJ07161.1| hypothetical protein PRUPE_ppa012012mg [Prunus persica]
Length=187

 Score =   276 bits (705),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI +  GK++KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKAPLSLSRLIRYMQGKDNKIAVVVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQN VLLRGPKN+REAVKHFGPA
Sbjct  95   PQLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNVVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187


 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_008369026.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
 ref|XP_008345218.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
 ref|XP_008355492.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
Length=187

 Score =   276 bits (705),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRLI + +GKE KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTSSKFNAVILKRLFMSKVNKAPLSLSRLIKYMTGKEGKIAVVVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPA
Sbjct  95   PCLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTILLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187


 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_011079632.1| PREDICTED: 60S ribosomal protein L18-2 [Sesamum indicum]
 ref|XP_011084062.1| PREDICTED: 60S ribosomal protein L18-2 [Sesamum indicum]
Length=187

 Score =   276 bits (705),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS+FNAV+LKRLFMS+ N+PPLSLSRLIS  +GKEDKIAVLVG++TDD+R +EV
Sbjct  35   FLVRRTGSRFNAVVLKRLFMSRVNRPPLSLSRLISLMNGKEDKIAVLVGSVTDDIRVHEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRG + +REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGSRKAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFERARG+RNS+G++V
Sbjct  155  PGVPHSHTKPYVRAKGRKFERARGRRNSKGFRV  187


 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_008370417.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
Length=187

 Score =   276 bits (705),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRLI +  GK++KIAV+VGTITDD+R YEV
Sbjct  35   FLVRRTASKFNAVILKRLFMSKVNKAPLSLSRLIKYMQGKDNKIAVVVGTITDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P +KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQN VLLRGPKNSREAVKHFGPA
Sbjct  95   PQMKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNVVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187


 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_006386732.1| hypothetical protein POPTR_0002s20400g [Populus trichocarpa]
 gb|ERP64529.1| hypothetical protein POPTR_0002s20400g [Populus trichocarpa]
Length=184

 Score =   275 bits (704),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 3/153 (2%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI+F  GK   IAV+VGTITDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINKPPLSLSRLITFMKGK---IAVVVGTITDDIRVYEV  91

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  92   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  151

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPY+R+KGRKFE+ARGKRNS+G++V
Sbjct  152  PGVPHSHTKPYIRSKGRKFEKARGKRNSKGFRV  184


 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>emb|CDX74138.1| BnaA03g29090D [Brassica napus]
Length=213

 Score =   276 bits (707),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+
Sbjct  61   FLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEI  120

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  121  PAIKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  180

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  181  PGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  213


 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  694  STMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            +TMGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  25   ATMGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  62



>gb|AAA69928.1| cytoplasmic ribosomal protein L18 [Arabidopsis thaliana]
Length=187

 Score =   275 bits (704),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFN VILKRLFMSK N+ PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+
Sbjct  35   FLVRRTNSKFNGVILKRLFMSKVNRAPLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  95   PAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  155  PGVPHSHSKPYVRAKGRKFEKARGKRKSRGFKV  187


 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  36



>ref|XP_002512455.1| 60S ribosomal protein L18, putative [Ricinus communis]
 gb|EEF49907.1| 60S ribosomal protein L18, putative [Ricinus communis]
Length=403

 Score =   279 bits (714),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI+F  GKE K AV+VGT+TDD+R YEV
Sbjct  251  FLVRRTGSKFNAVILKRLFMSKINKAPLSLSRLITFMKGKESKTAVVVGTVTDDIRVYEV  310

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV AL+FT+TARARIEKAGGECLTFDQLA+RAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  311  PALKVTALKFTETARARIEKAGGECLTFDQLAMRAPLGQNTVLLRGPKNAREAVKHFGPA  370

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  371  PGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  403


 Score = 79.3 bits (194),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -2

Query  709  PLQRRSTMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            P  RR++MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  210  PTSRRASMGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  252



>ref|XP_011079633.1| PREDICTED: 60S ribosomal protein L18-2-like [Sesamum indicum]
Length=187

 Score =   275 bits (703),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS+FNAV+LKRLFMS+ N+PPLSLSRLIS  +GKEDKIAVLVG++TDD+R +EV
Sbjct  35   FLVRRTGSRFNAVVLKRLFMSRVNRPPLSLSRLISLMNGKEDKIAVLVGSVTDDMRVHEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRG + +REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGSRKAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFERARG+RNS+G++V
Sbjct  155  PGVPHSHTKPYVRAKGRKFERARGRRNSKGFRV  187


 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_010938374.1| PREDICTED: 60S ribosomal protein L18-2-like [Elaeis guineensis]
Length=187

 Score =   274 bits (701),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS+FNAVIL+RLFMSK NKPPLSL RL++F  GKEDKIAV+VGT+TDD R YEV
Sbjct  35   FLVRRTGSRFNAVILRRLFMSKVNKPPLSLKRLVTFMQGKEDKIAVIVGTVTDDKRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARI KAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFG A
Sbjct  95   PAMKVTALRFTETARARIVKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  187


 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGG+SK+ +RTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGRSKKARRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_002882427.1| hypothetical protein ARALYDRAFT_477850 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58686.1| hypothetical protein ARALYDRAFT_477850 [Arabidopsis lyrata subsp. 
lyrata]
Length=187

 Score =   274 bits (701),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVLVGT+TDD+R +E+
Sbjct  35   FLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVLVGTVTDDLRVHEI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  95   PAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVR KGRKFE+ARG+R SRG+KV
Sbjct  155  PGVPHSHSKPYVRGKGRKFEKARGRRKSRGFKV  187


 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  36



>gb|KJB82634.1| hypothetical protein B456_013G206100 [Gossypium raimondii]
Length=184

 Score =   274 bits (700),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 144/153 (94%), Gaps = 3/153 (2%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GK   IAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKGK---IAVVVGTVTDDIRVYEV  91

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  92   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  151

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR++GRKFERARG+RNS+G++V
Sbjct  152  PGVPHSHTKPYVRSRGRKFERARGRRNSKGFRV  184


 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVK+YRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKIYRFL  36



>ref|XP_002271179.1| PREDICTED: 60S ribosomal protein L18-2 [Vitis vinifera]
Length=187

 Score =   274 bits (700),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRL+ +  GKE KIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLVRYMDGKEGKIAVVVGTVTDDLRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFG A
Sbjct  95   PCLKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187


 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKRTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_008775991.1| PREDICTED: 60S ribosomal protein L18-2 [Phoenix dactylifera]
Length=187

 Score =   273 bits (699),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK N+PP+SL +LI+F  GKEDKIAVLVGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINRPPISLKKLITFMEGKEDKIAVLVGTVTDDKRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+ V ALRFT+TARARI KAGGEC TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PAMTVTALRFTETARARILKAGGECWTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  187


 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG+SK+ KRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRSKKAKRTAPKSDDVYLKLLVKLYRFL  36



>emb|CDY18813.1| BnaAnng02780D [Brassica napus]
Length=249

 Score =   276 bits (705),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+
Sbjct  97   FLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEI  156

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  157  PAIKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  216

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  217  PGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  249


 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  706  LQRRSTMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            + R + MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  57   IPREAIMGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  98



>ref|XP_009124870.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=187

 Score =   273 bits (699),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+
Sbjct  35   FLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL +PLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  95   PAIKVTALRFTERARARIEKAGGECLTFDQLALSSPLGQNTVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  155  PGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  187


 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  36



>ref|XP_004494383.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score =   273 bits (698),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FNAVILKRLFMSK NKPPLSLSRLI F  GKE KIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTESSFNAVILKRLFMSKVNKPPLSLSRLIRFMKGKEGKIAVVVGAVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PAIKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARG+R SRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV  187


 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_010273829.1| PREDICTED: 60S ribosomal protein L18-2-like [Nelumbo nucifera]
Length=187

 Score =   273 bits (698),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMS+ NKPP+SLSRLI F  GKEDKIAV+VG +TDD R YE+
Sbjct  35   FLVRRTGSKFNAVILKRLFMSRVNKPPISLSRLIKFMKGKEDKIAVVVGAVTDDTRVYEL  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARI KAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFG A
Sbjct  95   PALKVTALRFTETARARILKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGY  133
            PGVPHSHTKPYVR+KGRKFERARG+RNSRG+
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRNSRGF  185


 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_009402513.1| PREDICTED: 60S ribosomal protein L18-2-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   273 bits (698),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVIL+RLFMSK N+PP+SL RLI+F  GK+DKIAV+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILRRLFMSKINRPPISLKRLITFMQGKDDKIAVIVGTVTDDKRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARI KAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFG A
Sbjct  95   PAMKVTALRFTETARARILKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRK+ERARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKYERARGRRNSRGFRV  187


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG+SK+ +RTA +SDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRSKKARRTASRSDDVYLKLLVKLYRFL  36



>gb|KFK26512.1| hypothetical protein AALP_AA8G258600 [Arabis alpina]
Length=187

 Score =   272 bits (695),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRR+ SKFNAVILKRLFMSK NK PLSLSRL  F  GKEDKIAVLVGTITDD+R +E+
Sbjct  35   FLVRRSDSKFNAVILKRLFMSKVNKAPLSLSRLAEFLKGKEDKIAVLVGTITDDLRVHEI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  95   PALKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVR+KGRKFE+ARG+R SRG+KV
Sbjct  155  PGVPHSHSKPYVRSKGRKFEKARGRRKSRGFKV  187


 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 40/50 (80%), Gaps = 7/50 (14%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  539
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF        V+R DS+
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL-------VRRSDSK  43



>ref|XP_009417724.1| PREDICTED: 60S ribosomal protein L18-2 [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   272 bits (695),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK N+PP+SL RLI+F +GK+DKIAV+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINRPPISLKRLITFMNGKDDKIAVIVGTVTDDKRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARI KAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFG A
Sbjct  95   PAMKVTALRFTETARARILKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+R SRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRKSRGFRV  187


 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGID+ AGG+SK+ +RTAP+SDDVYLKLLVKLYRF 
Sbjct  1    MGIDIVAGGRSKKARRTAPRSDDVYLKLLVKLYRFL  36



>ref|XP_004984437.1| PREDICTED: 60S ribosomal protein L18-2-like [Setaria italica]
Length=187

 Score =   272 bits (695),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FNAVILKRLFMSKTN+PPLSL RL++F  GKE++IAV+VGT+TDD R YEV
Sbjct  35   FLVRRTKSDFNAVILKRLFMSKTNRPPLSLRRLVNFMKGKENQIAVIVGTVTDDKRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PAMKVAALRFTETARARIVNAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFE+ARG+RNSRG+KV
Sbjct  155  PGVPHSHTKPYVRAKGRKFEKARGRRNSRGFKV  187


 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>emb|CDY40718.1| BnaC03g34340D [Brassica napus]
Length=227

 Score =   273 bits (699),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+
Sbjct  75   FLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEI  134

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG A
Sbjct  135  PAIKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGRA  194

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  195  PGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  227


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  694  STMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            +TMGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  39   ATMGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  76



>gb|AFK45456.1| unknown [Lotus japonicus]
Length=187

 Score =   271 bits (694),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FN+VILKRLFMSK NK PLSLSRLI +T GKE KIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTGSNFNSVILKRLFMSKVNKAPLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLAL APLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVAALRFTETARARIEKAGGECLTFDQLALIAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+ GRKFE+ARGKRNS+G++V
Sbjct  155  PGVPHSHTKPYVRSNGRKFEKARGKRNSKGFRV  187


 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_009384409.1| PREDICTED: 60S ribosomal protein L18-2 [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   271 bits (694),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK N+PP+SL RLI+F +GK++KIAV+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINRPPISLKRLITFMNGKDNKIAVIVGTVTDDKRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARI KAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAV+HFG A
Sbjct  95   PALKVTALRFTETARARILKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVRHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPY+R+KGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYIRSKGRKFERARGRRNSRGFRV  187


 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG+SK+ +RTAP+SDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRSKKARRTAPRSDDVYLKLLVKLYRFL  36



>ref|XP_002465302.1| hypothetical protein SORBIDRAFT_01g035860 [Sorghum bicolor]
 gb|EER92300.1| hypothetical protein SORBIDRAFT_01g035860 [Sorghum bicolor]
Length=187

 Score =   271 bits (694),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FNAVILKRLFMSKTN+PPLSL RL++F  GKE++IAV+VGT+TDD R YEV
Sbjct  35   FLVRRTKSNFNAVILKRLFMSKTNRPPLSLRRLVNFMEGKENQIAVIVGTVTDDKRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PAMKVAALRFTETARARIVNAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187


 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>emb|CDY05183.1| BnaC05g46200D [Brassica napus]
Length=223

 Score =   273 bits (697),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+
Sbjct  71   FLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEI  130

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARA IEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  131  PAIKVTALRFTERARASIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  190

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  191  PGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  223


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -2

Query  685  GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            GIDL AGGKSK+TKRTAPKSDDVYL      YRF 
Sbjct  38   GIDLIAGGKSKKTKRTAPKSDDVYLSSPESFYRFL  72



>ref|XP_010269589.1| PREDICTED: 60S ribosomal protein L18-3 [Nelumbo nucifera]
Length=187

 Score =   271 bits (693),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMS+ NK P+SLSRLI +  GKE+KIAVLVGT+TDD R Y+V
Sbjct  35   FLVRRTGSNFNAVILKRLFMSRVNKAPMSLSRLIRYMEGKENKIAVLVGTVTDDTRVYDV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARI KAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFG A
Sbjct  95   PALKVTALRFTETARARILKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187


 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_006408052.1| hypothetical protein EUTSA_v10021598mg [Eutrema salsugineum]
 gb|ESQ49505.1| hypothetical protein EUTSA_v10021598mg [Eutrema salsugineum]
Length=187

 Score =   271 bits (692),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FL RRT SKFN VILKRLFMSK NK PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+
Sbjct  35   FLFRRTNSKFNGVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  95   PAIKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVR+ GRKFE+ARGKR SRG+KV
Sbjct  155  PGVPHSHSKPYVRSTGRKFEKARGKRKSRGFKV  187


 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  36



>ref|XP_008810211.1| PREDICTED: 60S ribosomal protein L18-2-like [Phoenix dactylifera]
Length=187

 Score =   271 bits (692),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK N+PP+SL RLI F  GKEDKI V+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINRPPISLKRLIRFMEGKEDKIVVIVGTVTDDKRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFG A
Sbjct  95   PAMKVTALRFTETARARILNAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGLA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187


 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRSKKARRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_009411663.1| PREDICTED: 60S ribosomal protein L18-3-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   270 bits (691),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK N+PP+SL RLI+F +GK++KIAV+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINRPPISLKRLITFMNGKDNKIAVIVGTVTDDKRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARI KAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFG A
Sbjct  95   PALKVTALRFTETARARILKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHS+TKPYVR+KGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSNTKPYVRSKGRKFERARGRRNSRGFRV  187


 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGID+ AGG+SK+ +RTAP+SDDVYLKLLVKLYRF 
Sbjct  1    MGIDIVAGGRSKKARRTAPRSDDVYLKLLVKLYRFL  36



>ref|XP_002874343.1| 60S ribosomal protein L18 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50602.1| 60S ribosomal protein L18 [Arabidopsis lyrata subsp. lyrata]
Length=187

 Score =   270 bits (691),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRR+ SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+
Sbjct  35   FLVRRSESKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL+APLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  95   PAIKVTALRFTERARARIEKAGGECLTFDQLALKAPLGQNTVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHS TKPYVR KGRKFE+ARGKR SRG+KV
Sbjct  155  PGVPHSSTKPYVRHKGRKFEKARGKRKSRGFKV  187


 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_006855263.1| hypothetical protein AMTR_s00183p00048560 [Amborella trichopoda]
 gb|ERN16730.1| hypothetical protein AMTR_s00183p00048560 [Amborella trichopoda]
Length=187

 Score =   270 bits (691),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI F +GKEDK+AV+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKAPLSLSRLIKFMAGKEDKVAVIVGTVTDDTRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+ ARARI KAGGECLTFD LALRAPLG+NTVLLRGPKN+REAVKHFG A
Sbjct  95   PALKVTALRFTERARARILKAGGECLTFDDLALRAPLGRNTVLLRGPKNAREAVKHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187


 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGID+ AGGKSK+T RTAPKS DVYLK+LVKLYRF 
Sbjct  1    MGIDIVAGGKSKKTHRTAPKSGDVYLKILVKLYRFL  36



>ref|XP_010914484.1| PREDICTED: 60S ribosomal protein L18-3 [Elaeis guineensis]
Length=187

 Score =   270 bits (691),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPP+SL RL  F  GK+DKIAV+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINKPPISLKRLAKFMEGKDDKIAVIVGTVTDDKRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+T RARI KAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PAMKVTALRFTETVRARILKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHS TKPYVR+KGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSRTKPYVRSKGRKFERARGRRNSRGFRV  187


 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRSKKARRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_008784768.1| PREDICTED: 60S ribosomal protein L18-2-like [Phoenix dactylifera]
Length=187

 Score =   270 bits (691),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK N+PP+SL RL++F  GK+DKIAV+VGT+TDD R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKINRPPISLKRLVTFMQGKDDKIAVIVGTVTDDKRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARI KAGGECLTFDQLAL++PLGQNTVLLRGPKN+REAVKHFG A
Sbjct  95   PAMKVTALRFTETARARILKAGGECLTFDQLALQSPLGQNTVLLRGPKNAREAVKHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  187


 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGRSKKARRTAPKSDDVYLKLLVKLYRFL  36



>emb|CBI36879.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   274 bits (701),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRL+ +  GKE KIAV+VGT+TDD+R YEV
Sbjct  145  FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLVRYMDGKEGKIAVVVGTVTDDLRVYEV  204

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFG A
Sbjct  205  PCLKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKA  264

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  265  PGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  297


 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRF 
Sbjct  111  MGIDLVAGGKSKRTKRTAPKSDDIYLKLLVKLYRFL  146



>ref|NP_198137.1| 60S ribosomal protein L18-3 [Arabidopsis thaliana]
 sp|Q940B0.1|RL183_ARATH RecName: Full=60S ribosomal protein L18-3 [Arabidopsis thaliana]
 gb|AAL07220.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AAM67529.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AAN31854.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AED93736.1| 60S ribosomal protein L18-3 [Arabidopsis thaliana]
Length=187

 Score =   270 bits (690),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRR+ S FNAVILKRLFMSK NK PLSLSRL+ F +GK+DKIAVLVGTITDD+R +E+
Sbjct  35   FLVRRSNSNFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKDDKIAVLVGTITDDLRVHEI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  95   PAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHS+TKPYVR KGRKFE+ARGKR SRG+KV
Sbjct  155  PGVPHSNTKPYVRHKGRKFEKARGKRKSRGFKV  187


 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_010429374.1| PREDICTED: 60S ribosomal protein L18-3-like [Camelina sativa]
Length=187

 Score =   270 bits (690),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFNAVILKRLFMSK NK P+SLSRL+ F SGKEDKIAVLVGTITDD+R +E+
Sbjct  35   FLVRRTQSKFNAVILKRLFMSKVNKAPISLSRLVEFMSGKEDKIAVLVGTITDDLRVHEI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNT+LLRGPKNSREAVKHFG A
Sbjct  95   PAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTILLRGPKNSREAVKHFGLA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHS TKPYVR KGRKFE+ARGKR SRG+KV
Sbjct  155  PGVPHSDTKPYVRHKGRKFEKARGKRKSRGFKV  187


 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+T+RTAPKSDDVYLKL VKLYRF 
Sbjct  1    MGIDLIAGGKSKKTRRTAPKSDDVYLKLTVKLYRFL  36



>ref|XP_006298640.1| hypothetical protein CARUB_v10014730mg [Capsella rubella]
 gb|EOA31538.1| hypothetical protein CARUB_v10014730mg [Capsella rubella]
Length=187

 Score =   270 bits (689),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F  GKEDKIAVLVGT+TDDVR +E+
Sbjct  35   FLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMEGKEDKIAVLVGTVTDDVRVHEI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNT+LLRGPKNSREAVKHFG A
Sbjct  95   PAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTILLRGPKNSREAVKHFGLA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHS TKPYVR KGRKFE+ARGKR SRG+KV
Sbjct  155  PGVPHSDTKPYVRHKGRKFEKARGKRKSRGFKV  187


 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  36



>ref|XP_010486014.1| PREDICTED: 60S ribosomal protein L18-3 [Camelina sativa]
Length=187

 Score =   270 bits (689),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F SGKEDKIAVLVGT+TDD+R +E+
Sbjct  35   FLVRRTESKFNAVILKRLFMSKVNKAPLSLSRLVEFMSGKEDKIAVLVGTVTDDLRVHEI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNT+LLRGPKNSREAVKHFG A
Sbjct  95   PAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTILLRGPKNSREAVKHFGLA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHS TKPYVR KGRKFE+ARGKR SRG+KV
Sbjct  155  PGVPHSDTKPYVRHKGRKFEKARGKRKSRGFKV  187


 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+T+RTAPKSDDVYLKL VKLYRF 
Sbjct  1    MGIDLIAGGKSKKTRRTAPKSDDVYLKLTVKLYRFL  36



>ref|XP_009151179.1| PREDICTED: 60S ribosomal protein L18-2 [Brassica rapa]
Length=187

 Score =   270 bits (689),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+
Sbjct  35   FLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  95   PAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLGQNTVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  155  PGVPHSHSKPYVRAKGRKFEKARGKRKSRGFKV  187


 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_002461201.1| hypothetical protein SORBIDRAFT_02g042750 [Sorghum bicolor]
 gb|EER97722.1| hypothetical protein SORBIDRAFT_02g042750 [Sorghum bicolor]
Length=187

 Score =   269 bits (688),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FNAVILKRLFMSKTN+PPLS+ RL+ F  GK D+IAV+VGT+TDD R  EV
Sbjct  35   FLVRRTKSNFNAVILKRLFMSKTNRPPLSMRRLVKFMEGKSDQIAVIVGTVTDDKRINEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KVCALRFT+TARARI  AGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PAMKVCALRFTETARARIINAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187


 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_010464086.1| PREDICTED: 60S ribosomal protein L18-3-like [Camelina sativa]
Length=187

 Score =   269 bits (688),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F SGKEDKIAVLVGT+TDD+R +E+
Sbjct  35   FLVRRTESKFNAVILKRLFMSKVNKAPLSLSRLVEFMSGKEDKIAVLVGTVTDDLRVHEI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+K+ ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNT+LLRGPKNSREAVKHFG A
Sbjct  95   PAMKITALRFTERARARIEKAGGECLTFDQLALRAPLGQNTILLRGPKNSREAVKHFGLA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHS TKPYVR KGRKFE+ARGKR SRG+KV
Sbjct  155  PGVPHSDTKPYVRHKGRKFEKARGKRKSRGFKV  187


 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+T+RTAPKSDDVYLKL VKLYRF 
Sbjct  1    MGIDLIAGGKSKKTRRTAPKSDDVYLKLTVKLYRFL  36



>emb|CDY66803.1| BnaAnng22990D, partial [Brassica napus]
Length=200

 Score =   270 bits (689),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F +GK+ KIAVLVGTITDD+R +E+
Sbjct  48   FLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMNGKDGKIAVLVGTITDDLRVHEI  107

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  108  PAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLGQNTVLLRGPKNSREAVKHFGPA  167

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  168  PGVPHSHSKPYVRAKGRKFEKARGKRKSRGFKV  200


 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  14   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  49



>gb|EMS45435.1| 60S ribosomal protein L18-2 [Triticum urartu]
Length=187

 Score =   269 bits (687),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S+FNAVILKRLFMSKTN+PPLS+ RL+ F  GKEDKIAV+VGTITDD R YE+
Sbjct  35   FLVRRTKSQFNAVILKRLFMSKTNRPPLSMRRLVRFMEGKEDKIAVIVGTITDDQRVYEI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLGQNT+LLRGPKN+REAV+HFG A
Sbjct  95   PAMKVAALRFTETARARIVNAGGECLTFDQLALRAPLGQNTLLLRGPKNAREAVRHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187


 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQ  554
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF     + Q  
Sbjct  1    MGIDLVAGGRNKRTKRTAPKSDDVYLKLLVKLYRFLVRRTKSQFN  45



>ref|XP_004494578.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score =   268 bits (686),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FNAVILKRLFMSK N+PPLSLSRLI +  GKE KI V+VG +TDD+R Y+V
Sbjct  35   FLVRRTDSNFNAVILKRLFMSKVNRPPLSLSRLIKYMQGKEGKIGVVVGAVTDDIRVYDV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PAIKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARG+R SRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV  187


 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 7/50 (14%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  539
            MGIDLKAGGK+K+TKRT+PKS+D+YLKLLVKLYRF        V+R DS 
Sbjct  1    MGIDLKAGGKNKKTKRTSPKSNDIYLKLLVKLYRFL-------VRRTDSN  43



>ref|XP_009111741.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=187

 Score =   268 bits (684),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+
Sbjct  35   FLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLGQNTVLLRGPKNSREAVKHFG A
Sbjct  95   PAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLGQNTVLLRGPKNSREAVKHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  155  PGVPHSHTKPYVRAKGRKFEKARGKRKSRGFKV  187


 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>emb|CDY19736.1| BnaA09g03890D [Brassica napus]
Length=215

 Score =   268 bits (686),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+
Sbjct  63   FLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEI  122

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLGQNTVLLRGPKNSREAVKHFG A
Sbjct  123  PAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLGQNTVLLRGPKNSREAVKHFGKA  182

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  183  PGVPHSHTKPYVRAKGRKFEKARGKRKSRGFKV  215


 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  29   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  64



>ref|XP_009129884.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=222

 Score =   269 bits (687),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+
Sbjct  70   FLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEI  129

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  130  PAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLGQNTVLLRGPKNSREAVKHFGPA  189

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  190  PGVPHSHSKPYVRAKGRKFEKARGKRKSRGFKV  222


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  36   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  71



>ref|XP_009381102.1| PREDICTED: 60S ribosomal protein L18-2-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   267 bits (682),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFNAVILKRLFMSK N+PP+SL RLI+F   K+DKIAV+VGT+TDD R Y+V
Sbjct  35   FLVRRTESKFNAVILKRLFMSKNNRPPISLKRLITFMERKDDKIAVIVGTVTDDKRVYDV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARI KAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFG A
Sbjct  95   PAMKVTALRFTETARARILKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187


 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG+SK+ +RTAP+SDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRSKKARRTAPRSDDVYLKLLVKLYRFL  36



>ref|NP_001131538.1| uncharacterized protein LOC100192878 [Zea mays]
 gb|ACG24841.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG31936.1| 60S ribosomal protein L18 [Zea mays]
 tpg|DAA64098.1| TPA: ribosomal protein L18 [Zea mays]
Length=187

 Score =   267 bits (682),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FNAVILKRLFMSKTN+PPLS+ RL+ F  GK D+IAV+VGT+TDD R  EV
Sbjct  35   FLVRRTKSNFNAVILKRLFMSKTNRPPLSMRRLVRFMEGKGDQIAVIVGTVTDDKRISEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KVCALRFT+TARARI  AGGECLTFDQLALRAPLGQNTVLLRGPKN+REAV+HFGPA
Sbjct  95   PAMKVCALRFTETARARIINAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVRHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187


 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>emb|CDX99969.1| BnaC09g03320D [Brassica napus]
Length=210

 Score =   267 bits (683),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+
Sbjct  58   FLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEI  117

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLGQNTVLLRGPKNSREAVKHFG A
Sbjct  118  PAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLGQNTVLLRGPKNSREAVKHFGKA  177

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  178  PGVPHSHTKPYVRAKGRKFEKARGKRKSRGFKV  210


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  24   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  59



>gb|EMT12638.1| 60S ribosomal protein L18-2 [Aegilops tauschii]
Length=187

 Score =   266 bits (681),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S+FNAVILKRLFMSKTN+PPLS+ RL+ F  GK DKIAV+VGTITDD R YE+
Sbjct  35   FLVRRTKSQFNAVILKRLFMSKTNRPPLSMRRLVRFMEGKADKIAVIVGTITDDQRVYEI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLGQNT+LLRGPKN+REAV+HFG A
Sbjct  95   PAMKVAALRFTETARARIVNAGGECLTFDQLALRAPLGQNTLLLRGPKNAREAVRHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187


 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQ  554
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF     + Q  
Sbjct  1    MGIDLVAGGRNKRTKRTAPKSDDVYLKLLVKLYRFLVRRTKSQFN  45



>gb|KFK37967.1| hypothetical protein AALP_AA3G053100 [Arabis alpina]
Length=187

 Score =   266 bits (680),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FN VILKRLFMSK NK PLSLSRL+   SGK+DKIAVLVGTITDDVR +++
Sbjct  35   FLVRRTQSNFNKVILKRLFMSKVNKAPLSLSRLVELMSGKDDKIAVLVGTITDDVRVHDI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARI KAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  95   PAIKVAALRFTERARARIVKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVR+KGRKFE+ARG+R SRG+KV
Sbjct  155  PGVPHSHSKPYVRSKGRKFEKARGRRKSRGFKV  187


 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  36



>ref|XP_006394935.1| hypothetical protein EUTSA_v10004865mg [Eutrema salsugineum]
 gb|ESQ32221.1| hypothetical protein EUTSA_v10004865mg [Eutrema salsugineum]
Length=230

 Score =   266 bits (681),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRR+GSKFNAVILKRLFMSK NK PLSLSRL++F  GKE KIAVLVGTITDD+R +E+
Sbjct  78   FLVRRSGSKFNAVILKRLFMSKVNKAPLSLSRLVTFMKGKEGKIAVLVGTITDDLRIHEI  137

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL+APLGQNTVLLRGPKNSREAVKHFG A
Sbjct  138  PAMKVTALRFTERARARIEKAGGECLTFDQLALKAPLGQNTVLLRGPKNSREAVKHFGLA  197

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHS+TKPYVR+KGRKFE+ARG+R SRG+KV
Sbjct  198  PGVPHSNTKPYVRSKGRKFEKARGRRKSRGFKV  230


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  44   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  79



>ref|XP_007050975.1| Ribosomal protein L18 isoform 2 [Theobroma cacao]
 gb|EOX95132.1| Ribosomal protein L18 isoform 2 [Theobroma cacao]
Length=180

 Score =   264 bits (675),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 139/153 (91%), Gaps = 7/153 (5%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F   KEDKIAV+VGT+TDD+R YEV
Sbjct  35   FLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKCKEDKIAVVVGTVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNT       NSREAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNT-------NSREAVKHFGPA  147

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+RNS+G++V
Sbjct  148  PGVPHSHTKPYVRSKGRKFERARGRRNSKGFRV  180


 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFL  36



>ref|XP_006288739.1| hypothetical protein CARUB_v10002048mg [Capsella rubella]
 gb|EOA21637.1| hypothetical protein CARUB_v10002048mg [Capsella rubella]
Length=187

 Score =   264 bits (675),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRR+ SKFNAVILKRLFMSK NK PLSLS+L+SF  GK+ KI VLVGTITDD+R  E+
Sbjct  35   FLVRRSNSKFNAVILKRLFMSKVNKAPLSLSKLVSFMEGKDGKIGVLVGTITDDLRIQEI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+K+ ALRFT+ ARARIEKAGGECLTFDQLAL+APLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  95   PAMKITALRFTERARARIEKAGGECLTFDQLALKAPLGQNTVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHS TKPYVRAKGRKFE+ARG+R SRG+KV
Sbjct  155  PGVPHSSTKPYVRAKGRKFEKARGRRKSRGFKV  187


 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_010421566.1| PREDICTED: 60S ribosomal protein L18-2-like [Camelina sativa]
Length=187

 Score =   264 bits (675),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRR+ SKFNAVILKRLFMSK NK PLSLS+L+SF +GK+ KI VLVGTITDD+R +++
Sbjct  35   FLVRRSESKFNAVILKRLFMSKVNKAPLSLSKLVSFMNGKDGKIGVLVGTITDDLRVHDI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+K+ ALRFT+ ARARIEKAGGECLTFDQLAL+APLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  95   PAMKITALRFTERARARIEKAGGECLTFDQLALKAPLGQNTVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVR KGRKFE+ARG+R SRG+KV
Sbjct  155  PGVPHSHSKPYVRGKGRKFEKARGRRKSRGFKV  187


 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>gb|ABK26318.1| unknown [Picea sitchensis]
Length=187

 Score =   264 bits (675),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S+FNAVILKRLFMSKTNKPPLSLSRL  +  GKEDKIAV+VGTITDD R YE+
Sbjct  35   FLVRRTSSRFNAVILKRLFMSKTNKPPLSLSRLARYMQGKEDKIAVVVGTITDDNRVYEL  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P +K+ ALRFT+TARARI KAGGECLTFDQLALRAPLGQNTVLLRGPK+ REAVKHFG A
Sbjct  95   PPVKITALRFTETARARILKAGGECLTFDQLALRAPLGQNTVLLRGPKSHREAVKHFGRA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRK+E ARG+RNSRG+KV
Sbjct  155  PGVPHSHTKPYVRSKGRKYEMARGRRNSRGFKV  187


 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSKQT+RTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKQTRRTAPKSEDIYLKLLVKLYRFL  36



>ref|XP_010455077.1| PREDICTED: 60S ribosomal protein L18-3-like isoform X1 [Camelina 
sativa]
Length=187

 Score =   264 bits (675),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRR+ SKFNAVILKRLFMSK NK PLSLS+L+SF +GK+ KI VLVGTITDD+R +++
Sbjct  35   FLVRRSESKFNAVILKRLFMSKVNKAPLSLSKLVSFMNGKDGKIGVLVGTITDDLRVHDI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+K+ ALRFT+ ARARIEKAGGECLTFDQLAL+APLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  95   PAMKITALRFTERARARIEKAGGECLTFDQLALKAPLGQNTVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR +GRKFE+ARG+R SRG+KV
Sbjct  155  PGVPHSHTKPYVRGRGRKFEKARGRRKSRGFKV  187


 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>emb|CDX80616.1| BnaC07g28280D [Brassica napus]
Length=232

 Score =   265 bits (677),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+
Sbjct  80   FLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEI  139

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLGQNTVLLRGPKNSREAVKHFG A
Sbjct  140  PAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLGQNTVLLRGPKNSREAVKHFGLA  199

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  200  PGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  232


 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  46   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  81



>emb|CDY25018.1| BnaC02g39900D [Brassica napus]
Length=197

 Score =   264 bits (674),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKF+AVILKRLFMSK NK PLSLS+L  F  GK+ KIAVLVGTITDD+R +E+
Sbjct  45   FLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLAEFMKGKDGKIAVLVGTITDDLRVHEI  104

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLGQNTVLLRGPKNSREAVKHFG A
Sbjct  105  PAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLGQNTVLLRGPKNSREAVKHFGLA  164

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  165  PGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  197


 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  11   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  46



>ref|XP_003562459.1| PREDICTED: 60S ribosomal protein L18-3-like [Brachypodium distachyon]
Length=187

 Score =   263 bits (672),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FNAVILKRLFMSKTN+PPLS+ RL+ F  GK D+IAV+VGTITDD R YE+
Sbjct  35   FLVRRTKSHFNAVILKRLFMSKTNRPPLSMRRLVRFMEGKGDQIAVIVGTITDDKRVYEI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLGQNT+LLRGPKN+REAV+HFG A
Sbjct  95   PAMKVAALRFTETARARIVNAGGECLTFDQLALRAPLGQNTLLLRGPKNAREAVRHFGAA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187


 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|NP_001050069.1| Os03g0341100 [Oryza sativa Japonica Group]
 gb|ABF95861.1| 60S ribosomal protein L18, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11983.1| Os03g0341100 [Oryza sativa Japonica Group]
 gb|EEC75232.1| hypothetical protein OsI_11506 [Oryza sativa Indica Group]
 gb|EEE59035.1| hypothetical protein OsJ_10788 [Oryza sativa Japonica Group]
Length=187

 Score =   263 bits (672),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FNAVIL+RLFMSKTN+PPLSL RL+ F  GKE++IAV+VGT+TDD R YEV
Sbjct  35   FLVRRTKSPFNAVILRRLFMSKTNRPPLSLRRLVRFMEGKENQIAVIVGTVTDDKRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARI   GGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PAMKVAALRFTETARARIVNTGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHS+TKPYVR+KGRKFE+ARG+RNS+G+KV
Sbjct  155  PGVPHSNTKPYVRSKGRKFEKARGRRNSKGFKV  187


 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++K+TKRTAPKSDDVYLKL+VKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLIVKLYRFL  36



>ref|XP_006650060.1| PREDICTED: 60S ribosomal protein L18-3-like [Oryza brachyantha]
Length=187

 Score =   263 bits (672),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FNAVIL+RLFMSKTN+PPLSL RL+ F  GKE++IAV+VGT+TDD R YEV
Sbjct  35   FLVRRTKSPFNAVILRRLFMSKTNRPPLSLRRLVRFMEGKENQIAVIVGTVTDDKRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+T RARI  AGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PAMKVAALRFTETVRARIVNAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHS+TKPYVR+KGRKFE+ARG+RNS+G+KV
Sbjct  155  PGVPHSNTKPYVRSKGRKFEKARGRRNSKGFKV  187


 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++K+TKRTAP+S+DVYLKL+VKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSEDVYLKLIVKLYRFL  36



>ref|XP_010228645.1| PREDICTED: 60S ribosomal protein L18-2-like [Brachypodium distachyon]
Length=187

 Score =   263 bits (671),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT + FNAVILKRLFMSKTN+PPLSL RL+ F  GKE++IAV+VGTITDD + YEV
Sbjct  35   FLVRRTKNHFNAVILKRLFMSKTNRPPLSLRRLVKFMEGKENQIAVIVGTITDDKKVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARI  AGGECLTFDQLAL APLGQNTVLLRGPKN+REAV+HFG A
Sbjct  95   PAMKVAALRFTETARARIVNAGGECLTFDQLALHAPLGQNTVLLRGPKNAREAVRHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187


 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>gb|ABK21809.1| unknown [Picea sitchensis]
 gb|ABK26564.1| unknown [Picea sitchensis]
Length=187

 Score =   262 bits (670),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FNAVILKRLFMSKTNKPPLSLSRL  +  GK+DKIAV+VGTITDD R YE+
Sbjct  35   FLVRRTSSSFNAVILKRLFMSKTNKPPLSLSRLARYMQGKDDKIAVVVGTITDDNRVYEL  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P +KV ALRFT+TARARI KAGGECLTFDQLALRAPLGQNTVLLRGPK+ REAVKHFG A
Sbjct  95   PPVKVTALRFTETARARILKAGGECLTFDQLALRAPLGQNTVLLRGPKSHREAVKHFGRA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRK+E ARG+RNSRG+KV
Sbjct  155  PGVPHSHTKPYVRSKGRKYEMARGRRNSRGFKV  187


 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSEDIYLKLLVKLYRFL  36



>ref|XP_004958675.1| PREDICTED: 60S ribosomal protein L18-3-like [Setaria italica]
Length=187

 Score =   262 bits (669),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FNAVILKRLFMSK N+ PLS+ RL+ F  GK D+IAV+VGT+TDD R  EV
Sbjct  35   FLVRRTKSPFNAVILKRLFMSKANRSPLSMRRLVKFMEGKGDQIAVIVGTVTDDKRITEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KVCALRFT+TARARI  AGGECLTFDQLALRAPLGQNTV+LRGPKN+REAVKHFGPA
Sbjct  95   PAMKVCALRFTETARARIINAGGECLTFDQLALRAPLGQNTVILRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187


 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>gb|AFC88843.1| 60S ribosomal protein L18-3-like protein, partial [Miscanthus 
sinensis]
Length=166

 Score =   260 bits (665),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FNAVILKRLFMSKTN+ PLS+ RL+ F  GK D+IAV+VGT+TDD R  EV
Sbjct  17   FLVRRTKSNFNAVILKRLFMSKTNRAPLSMRRLVKFMEGKGDQIAVIVGTVTDDKRINEV  76

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KVCALRFT+TARARI  AGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  77   PAMKVCALRFTETARARIINAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  136

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRG  136
            PGVPHSHTKPYVR+KGRKFE+ARG+RNSRG
Sbjct  137  PGVPHSHTKPYVRSKGRKFEKARGRRNSRG  166



>ref|XP_003591163.1| Ribosomal protein L18 [Medicago truncatula]
 gb|AES61414.1| 60S ribosomal protein L18-3 [Medicago truncatula]
Length=187

 Score =   261 bits (666),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T+GKE KIAV+VG ITDDVR  EV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIKYTNGKEGKIAVVVGAITDDVRVNEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIE AGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFG A
Sbjct  95   PAIKVTALRFTERARARIESAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGRA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVP SHTKPYVR K RK E+ARGKR SRG++V
Sbjct  155  PGVPQSHTKPYVRGKSRKIEKARGKRKSRGFRV  187


 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGK+K+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKNKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_008789961.1| PREDICTED: uncharacterized protein LOC103707302 [Phoenix dactylifera]
Length=988

 Score =   272 bits (696),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS+FNAVILKRLFMSK N+PP+SL RL++F  GKEDKIAV+VGT+TDD R YEV
Sbjct  836  FLVRRTGSRFNAVILKRLFMSKVNRPPISLKRLVTFMQGKEDKIAVIVGTVTDDKRVYEV  895

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARI KAGGEC TFDQLALR+PLGQNTVLLRGPKN+REAVKHFG A
Sbjct  896  PAMKVTALRFTETARARILKAGGECFTFDQLALRSPLGQNTVLLRGPKNAREAVKHFGKA  955

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  956  PGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  988


 Score = 67.8 bits (164),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG+SK+ KRTAPKSDDVYLKLLVKLYRF 
Sbjct  802  MGIDLIAGGRSKKAKRTAPKSDDVYLKLLVKLYRFL  837



>emb|CDY05559.1| BnaA02g31320D [Brassica napus]
Length=503

 Score =   269 bits (688),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+
Sbjct  70   FLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEI  129

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLGQNTVLLRGPKNSREAVKHFGPA
Sbjct  130  PAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLGQNTVLLRGPKNSREAVKHFGPA  189

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVRAKGRKFE+ARGKR SRG+K+
Sbjct  190  PGVPHSHSKPYVRAKGRKFEKARGKRKSRGFKL  222


 Score = 70.5 bits (171),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 37/43 (86%), Gaps = 3/43 (7%)
 Frame = -2

Query  700  RRST---MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            R ST   MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  29   RHSTAHAMGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  71



>gb|EPS67068.1| hypothetical protein M569_07709, partial [Genlisea aurea]
Length=186

 Score =   260 bits (665),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFN V+LKRLFMS+ N+PPL LSRLI+   GKEDKIAVLVGTITDD R +EV
Sbjct  34   FLVRRTESKFNGVVLKRLFMSRVNRPPLRLSRLIAHMKGKEDKIAVLVGTITDDNRIHEV  93

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKV ALRFT+T RARIEKAGGECLTFDQLALRAPLGQNTVLLRG +N+REAV+HFGPA
Sbjct  94   PPLKVTALRFTETVRARIEKAGGECLTFDQLALRAPLGQNTVLLRGSRNAREAVRHFGPA  153

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHS TKPYVR+KGRKFERARG+RNSRG++V
Sbjct  154  PGVPHSSTKPYVRSKGRKFERARGRRNSRGFRV  186


 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -2

Query  685  GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            GIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    GIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  35



>ref|XP_006658116.1| PREDICTED: 60S ribosomal protein L18-3-like [Oryza brachyantha]
Length=187

 Score =   260 bits (665),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FL RRT S FNAVILKRLFMSKTN+PPLS+ RL+ F  GK D+IAV+VGT+TDD R YEV
Sbjct  35   FLERRTKSHFNAVILKRLFMSKTNRPPLSMRRLVRFMEGKGDQIAVIVGTVTDDKRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TA+ARI  AGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PAMKVAALRFTETAKARIINAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHS+TKPYVR+KGRKFE+ARG+RNS+G+KV
Sbjct  155  PGVPHSNTKPYVRSKGRKFEKARGRRNSKGFKV  187


 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++K+TKRTAP+S+DVY+KLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSEDVYVKLLVKLYRFL  36



>ref|XP_009629121.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana tomentosiformis]
Length=187

 Score =   260 bits (664),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS+FNAVILKRLFMSK NK PLSLSRLI++  GKEDK+AV+VGT+TDDVRAYEV
Sbjct  35   FLVRRTGSQFNAVILKRLFMSKINKAPLSLSRLITYMKGKEDKVAVVVGTVTDDVRAYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P+LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG A
Sbjct  95   PSLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGRA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFERARGKR SRG+KV
Sbjct  155  PGVPHSHTKPYVRAKGRKFERARGKRKSRGFKV  187


 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_010921627.1| PREDICTED: uncharacterized protein LOC105045157 [Elaeis guineensis]
Length=398

 Score =   267 bits (682),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS+FNAVILKRLFMSK N+PP+SL RL++F  GK DKIAV+VGT+TDD R Y+V
Sbjct  246  FLVRRTGSRFNAVILKRLFMSKINRPPISLKRLVTFMEGKGDKIAVIVGTVTDDKRVYDV  305

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARI KAGGECLTFD LALRAPLGQNTVLLRGPKN+REAVKHFG A
Sbjct  306  PALKVTALRFTETARARILKAGGECLTFDHLALRAPLGQNTVLLRGPKNAREAVKHFGKA  365

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  366  PGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  398


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  709  PLQRRSTMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            P + RS+ GIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRF 
Sbjct  205  PTRLRSSQGIDLIAGGRSKKARRTAPKSDDVYLKLLVKLYRFL  247



>ref|XP_004247404.1| PREDICTED: 60S ribosomal protein L18-2 [Solanum lycopersicum]
Length=187

 Score =   259 bits (662),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FL RRTGSKFNAVILKRLFMSK NK PLSLSRL+++ +GKED IAV+VGT+TDDVRAYEV
Sbjct  35   FLSRRTGSKFNAVILKRLFMSKINKAPLSLSRLVTYMTGKEDNIAVVVGTVTDDVRAYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P +KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG A
Sbjct  95   PKIKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PGVPHSHTKPYVRAKGRKFERARGKRNSRGYK
Sbjct  155  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  186


 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKR APKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRIAPKSDDVYLKLLVKLYRFL  36



>ref|NP_001132852.1| uncharacterized protein LOC100194344 [Zea mays]
 gb|ACG24961.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG34787.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG39589.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACR34137.1| unknown [Zea mays]
 gb|AFW77275.1| ribosomal protein L18 [Zea mays]
 gb|AFW81439.1| ribosomal protein L18 [Zea mays]
 gb|AGS43131.1| hypothetical protein [Zea mays]
Length=187

 Score =   259 bits (661),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FNAVILKRLFMSKTN+PP+S+ RL+ F  GKE  IAV+VGT+TDD R  EV
Sbjct  35   FLVRRTKSNFNAVILKRLFMSKTNRPPISMRRLVKFMEGKEKNIAVIVGTVTDDKRIQEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG+NTVLLRGPKN+REAV+HFG A
Sbjct  95   PAMKVTALRFTETARARIVNAGGECLTFDQLALRAPLGENTVLLRGPKNAREAVRHFGKA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187


 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>gb|ABK22247.1| unknown [Picea sitchensis]
Length=187

 Score =   258 bits (660),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S+FNAVILKRLFMSKTNKPPLSLSRL  +  GK+DK+AV+VGTITDD R YE+
Sbjct  35   FLVRRTSSRFNAVILKRLFMSKTNKPPLSLSRLARYMQGKDDKVAVVVGTITDDNRVYEL  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P +KV ALRFT+TARARI KAGGECLTFDQLAL APLGQNTVLLRGPK+ REAVKHFG A
Sbjct  95   PPVKVTALRFTETARARILKAGGECLTFDQLALCAPLGQNTVLLRGPKSHREAVKHFGRA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRK+E ARG+RNSRG+KV
Sbjct  155  PGVPHSHTKPYVRSKGRKYEMARGRRNSRGFKV  187


 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSKQTKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKQTKRTAPKSEDIYLKLLVKLYRFL  36



>ref|XP_008656150.1| PREDICTED: 60S ribosomal protein L18-3-like [Zea mays]
Length=222

 Score =   260 bits (664),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FNAVILKRLFMSKTN+PP+S+ RL+ F  GKE  IAV+VGT+TDD R  EV
Sbjct  70   FLVRRTKSNFNAVILKRLFMSKTNRPPISMRRLVKFMEGKEKNIAVIVGTVTDDKRIQEV  129

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG+NTVLLRGPKN+REAV+HFG A
Sbjct  130  PAMKVTALRFTETARARIVNAGGECLTFDQLALRAPLGENTVLLRGPKNAREAVRHFGKA  189

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  190  PGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  222


 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  694  STMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            + MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  34   AAMGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  71



>ref|XP_003626231.1| 60S ribosomal protein L18 [Medicago truncatula]
 gb|ACJ85938.1| unknown [Medicago truncatula]
 gb|AES82449.1| 60S ribosomal protein L18-3 [Medicago truncatula]
 gb|AFK48984.1| unknown [Medicago truncatula]
Length=187

 Score =   258 bits (659),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FNAVILKRLFMSK N+PP+SLS++I +  GK+ KI V+VG +TDD+R YEV
Sbjct  35   FLVRRTDSNFNAVILKRLFMSKVNRPPISLSKMIEYMKGKDGKIGVVVGAVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LK+ ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFG A
Sbjct  95   PVLKIAALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGRA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVR+KGRK E+ARGKR SRG++V
Sbjct  155  PGVPHSHSKPYVRSKGRKQEKARGKRKSRGFRV  187


 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 38/50 (76%), Gaps = 7/50 (14%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  539
            MGIDLKAGGKSK TKRT PKS+D+YLKLLVKLYRF        V+R DS 
Sbjct  1    MGIDLKAGGKSKNTKRTEPKSNDIYLKLLVKLYRFL-------VRRTDSN  43



>gb|AGV54741.1| 60S ribosomal protein L18-3-like protein [Phaseolus vulgaris]
Length=222

 Score =   259 bits (661),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 144/188 (77%), Gaps = 35/188 (19%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGK--------------------  466
            FLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GK                    
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIRYTKGKVCLSIFFTSCTGVASSHIVL  94

Query  465  ---------------EDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  331
                           EDKIAV+VGTITDD+R YEVP LK+ AL+FT+ ARARIEKAGGEC
Sbjct  95   LIIAYISTFYFCQMLEDKIAVVVGTITDDIRVYEVPQLKITALKFTERARARIEKAGGEC  154

Query  330  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  151
            LTFDQLALRAPLGQNTVL RGPKN+REAVKHFGPAPGVPHSH+KPYVR+KGRKFE+ARG+
Sbjct  155  LTFDQLALRAPLGQNTVLFRGPKNAREAVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGR  214

Query  150  RNSRGYKV  127
            RNSRG++V
Sbjct  215  RNSRGFRV  222


 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGID KAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDFKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_010524859.1| PREDICTED: 60S ribosomal protein L18-3 [Tarenaya hassleriana]
Length=187

 Score =   257 bits (657),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMSK NK PLSLSRL+ F  GKEDKI V+VGT+TDDVR YEV
Sbjct  35   FLVRRTGSNFNAVILKRLFMSKVNKAPLSLSRLVRFMQGKEDKIGVVVGTVTDDVRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFERARG+R SRG+KV
Sbjct  155  PGVPHSHTKPYVRSKGRKFERARGRRKSRGFKV  187


 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>ref|XP_002439318.1| hypothetical protein SORBIDRAFT_09g004290 [Sorghum bicolor]
 gb|EES17748.1| hypothetical protein SORBIDRAFT_09g004290 [Sorghum bicolor]
Length=188

 Score =   257 bits (657),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 140/154 (91%), Gaps = 1/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYE  409
            FLVRRT S FNAVILKRLFMSKTN+PP+SL RL+ F  GKE+K IAV+VGT+TDD R  E
Sbjct  35   FLVRRTKSNFNAVILKRLFMSKTNRPPISLRRLVKFMEGKEEKNIAVIVGTVTDDKRIQE  94

Query  408  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGP  229
            VPA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG+NTVLLRGPKN+REAV+HFG 
Sbjct  95   VPAMKVTALRFTETARARIVNAGGECLTFDQLALRAPLGENTVLLRGPKNAREAVRHFGK  154

Query  228  APGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  155  APGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188


 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>gb|AFC88838.1| 60S ribosomal protein L18-like protein [Miscanthus sinensis]
Length=188

 Score =   257 bits (656),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 140/154 (91%), Gaps = 1/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYE  409
            FLVRRT S FNAVILKRLFMSKTN+PP+SL RL+ F  GKE+K IAV+VGT+TDD R  E
Sbjct  35   FLVRRTKSNFNAVILKRLFMSKTNRPPISLRRLVKFMEGKEEKNIAVIVGTVTDDKRIQE  94

Query  408  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGP  229
            VPA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG+NTVL+RGPKN+REAV+HFG 
Sbjct  95   VPAMKVTALRFTETARARIVNAGGECLTFDQLALRAPLGENTVLMRGPKNAREAVRHFGK  154

Query  228  APGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  155  APGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188


 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>gb|EMT18368.1| 60S ribosomal protein L18-2 [Aegilops tauschii]
Length=188

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYE  409
            FLVRRT SKFNAVILKRLFMSKTN+PPLS+ RL +F  GKE+K IAV+VGTITDD+R  E
Sbjct  35   FLVRRTKSKFNAVILKRLFMSKTNRPPLSMRRLSNFMKGKEEKNIAVVVGTITDDMRIQE  94

Query  408  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGP  229
            VPA+KV ALRFT+TARARI  AGGECLTFDQLALRAP G+NT+LLRGPKN+REAV+HFG 
Sbjct  95   VPAMKVTALRFTETARARIINAGGECLTFDQLALRAPTGENTILLRGPKNAREAVRHFGK  154

Query  228  APGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  155  APGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188


 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++K+TKR APKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKRTKRVAPKSDDVYLKLLVKLYRFL  36



>dbj|BAJ90421.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88976.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=188

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYE  409
            FLVRRT SKFNAVILKRLFMSKTN+PPLS+ RL +F  GKE+K IAV+VGTITDD+R  E
Sbjct  35   FLVRRTKSKFNAVILKRLFMSKTNRPPLSMRRLSNFMKGKEEKNIAVVVGTITDDMRIQE  94

Query  408  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGP  229
            +PA+KV ALRFT+TARARI  AGGECLTFDQLALRAP G+NT+LLRGPKN+REAV+HFG 
Sbjct  95   IPAMKVTALRFTETARARIVNAGGECLTFDQLALRAPTGENTILLRGPKNAREAVRHFGK  154

Query  228  APGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  155  APGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188


 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++K+TKR APKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKRTKRVAPKSDDVYLKLLVKLYRFL  36



>ref|XP_001781485.1| predicted protein [Physcomitrella patens]
 gb|EDQ53665.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 140/153 (92%), Gaps = 1/153 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT + FN+V+LKRLFMS+TN+ PLS+SRL+ + +GKE KIAVLVGTITDDVR +EV
Sbjct  35   FLVRRTDAPFNSVVLKRLFMSRTNRAPLSMSRLVKYMTGKEGKIAVLVGTITDDVRQFEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKVCALRFT+TARARI KAGGECLTFDQLALRAP G NTVLLRGPKN+REAVKHFG A
Sbjct  95   PALKVCALRFTETARARILKAGGECLTFDQLALRAPTGSNTVLLRGPKNAREAVKHFG-A  153

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVP SH KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  154  PGVPQSHAKPYVRSKGRKFEKARGRRNSRGFKV  186


 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSQNVYLKLLVKLYRFL  36



>ref|XP_001760902.1| predicted protein [Physcomitrella patens]
 gb|EDQ74291.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 140/153 (92%), Gaps = 1/153 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT + FN+V+LKRLFMS+ N+ PLS+SRL+ + +GK+DKIAVLVGTITDDVR +EV
Sbjct  35   FLVRRTDAPFNSVVLKRLFMSRINRAPLSMSRLVKYMAGKDDKIAVLVGTITDDVRQFEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKVCALRFT+TARARI KAGGECLTFDQLALRAP G NTVLLRGPKN+REAVKHFG A
Sbjct  95   PALKVCALRFTETARARIVKAGGECLTFDQLALRAPTGANTVLLRGPKNAREAVKHFG-A  153

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVP SH KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  154  PGVPQSHAKPYVRSKGRKFEKARGRRNSRGFKV  186


 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSQNVYLKLLVKLYRFL  36



>ref|NP_001060617.1| Os07g0674700 [Oryza sativa Japonica Group]
 dbj|BAC83538.1| putative cytoplasmic ribosomal protein L18 [Oryza sativa Japonica 
Group]
 dbj|BAD31974.1| putative cytoplasmic ribosomal protein L18 [Oryza sativa Japonica 
Group]
 dbj|BAF22531.1| Os07g0674700 [Oryza sativa Japonica Group]
 gb|EAZ05118.1| hypothetical protein OsI_27311 [Oryza sativa Indica Group]
 dbj|BAG89915.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67806.1| hypothetical protein OsJ_25556 [Oryza sativa Japonica Group]
Length=195

 Score =   256 bits (654),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 141/161 (88%), Gaps = 8/161 (5%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGK--------EDKIAVLVGTIT  430
            FLVRRT S FNAVILKRLFMSKTN+PPLS+ RL+ F  GK         D+IAV+VGT+T
Sbjct  35   FLVRRTKSHFNAVILKRLFMSKTNRPPLSMRRLVRFMEGKVPDRHAISGDQIAVIVGTVT  94

Query  429  DDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSRE  250
            DD R YEVPA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLGQNTVLLRGPKN+RE
Sbjct  95   DDKRIYEVPAMKVAALRFTETARARIINAGGECLTFDQLALRAPLGQNTVLLRGPKNARE  154

Query  249  AVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            AVKHFGPAPGVPHS+TKPYVR+KGRKFE+ARG+RNS+G+KV
Sbjct  155  AVKHFGPAPGVPHSNTKPYVRSKGRKFEKARGRRNSKGFKV  195


 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++K+TKRTAP+S+DVYLKL+VKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSEDVYLKLIVKLYRFL  36



>ref|XP_006654064.1| PREDICTED: 60S ribosomal protein L18-2-like [Oryza brachyantha]
Length=188

 Score =   256 bits (653),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYE  409
            FL RRT SKFNAVILKRLFMSKTN+PPLSL RL  F  GKE+K IAV+VGT+TDD R  E
Sbjct  35   FLYRRTKSKFNAVILKRLFMSKTNRPPLSLRRLAKFMEGKEEKNIAVIVGTVTDDKRIQE  94

Query  408  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGP  229
            +PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG+NTVLLRGPKN+REAV+HFG 
Sbjct  95   IPAMKVTALRFTETARARIVNAGGECLTFDQLALRAPLGENTVLLRGPKNAREAVRHFGK  154

Query  228  APGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  155  APGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188


 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++K+TKRTAP+SDDVYLKL+VKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSDDVYLKLIVKLYRFL  36



>ref|XP_009611670.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   255 bits (652),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS+FNAVILKRLFMSK NK PLSLSRLI++  GKEDK+ V+VGT+TDDVRAYEV
Sbjct  35   FLVRRTGSQFNAVILKRLFMSKINKAPLSLSRLITYMKGKEDKVVVVVGTVTDDVRAYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P+LKV ALRFTKTARARIEKAGGECLTFDQLALRAPLGQN VLLRGPKNSREAVKHFG A
Sbjct  95   PSLKVTALRFTKTARARIEKAGGECLTFDQLALRAPLGQNMVLLRGPKNSREAVKHFGRA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVRAKGRKFERARGKR SRG+KV
Sbjct  155  PGVPHSHTKPYVRAKGRKFERARGKRKSRGFKV  187


 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TK TAPKS DVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKCTAPKSGDVYLKLLVKLYRFL  36



>dbj|BAJ93091.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=212

 Score =   256 bits (654),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYE  409
            FLVRRT SKFNAVILKRLFMSKTN+PPLS+ RL +F  GKE+K IAV+VGTITDD+R  E
Sbjct  59   FLVRRTKSKFNAVILKRLFMSKTNRPPLSMRRLSNFMKGKEEKNIAVVVGTITDDMRIQE  118

Query  408  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGP  229
            +PA+KV ALRFT+TARARI  AGGECLTFDQLALRAP G+NT+LLRGPKN+REAV+HFG 
Sbjct  119  IPAMKVTALRFTETARARIVNAGGECLTFDQLALRAPTGENTILLRGPKNAREAVRHFGK  178

Query  228  APGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  179  APGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  212



>ref|XP_004290808.1| PREDICTED: 60S ribosomal protein L18-2 [Fragaria vesca subsp. 
vesca]
Length=187

 Score =   255 bits (652),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  588  DFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYE  409
            DF+ RRT S F+ VI  RL MSK NK PLSLSRL  +  G EDKIAVLVGT+TDDVR  E
Sbjct  34   DFIHRRTKSHFSKVIRHRLCMSKVNKAPLSLSRLCRYMQGHEDKIAVLVGTVTDDVRIAE  93

Query  408  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGP  229
            VPALKV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNT+LLRGPKN+REAVKHFGP
Sbjct  94   VPALKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTMLLRGPKNAREAVKHFGP  153

Query  228  APGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            APGVPHSHTKPYVR+KGRKFE+ARGKRNSRG++V
Sbjct  154  APGVPHSHTKPYVRSKGRKFEKARGKRNSRGFRV  187


 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK T+RT+P+S D+YLKL VKLY F 
Sbjct  1    MGIDLVAGGKSKNTRRTSPRSQDIYLKLTVKLYDFI  36



>ref|XP_003568896.1| PREDICTED: 60S ribosomal protein L18-2-like [Brachypodium distachyon]
Length=188

 Score =   255 bits (652),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYE  409
            FLVRRT SKFNAVILKRLFMSKTN+PPLS+ RL +F  GK++K IAV+VGTITDD R  E
Sbjct  35   FLVRRTKSKFNAVILKRLFMSKTNRPPLSMRRLSNFMKGKDEKSIAVIVGTITDDKRIQE  94

Query  408  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGP  229
            +PA+KV ALRFT+TARARI  AGGECLTFDQLALRAP+G+NT+LLRGPKN+REAV+HFG 
Sbjct  95   IPAMKVTALRFTETARARIINAGGECLTFDQLALRAPMGENTILLRGPKNAREAVRHFGK  154

Query  228  APGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  155  APGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188


 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++K+TKRTAPKSDDVYL+LLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLRLLVKLYRFL  36



>ref|XP_010550997.1| PREDICTED: 60S ribosomal protein L18-3-like isoform X1 [Tarenaya 
hassleriana]
Length=187

 Score =   255 bits (651),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS FNAVILKRLFMSK NK PLSLSRL++F  GKEDKI V+VGT+TDDVR YEV
Sbjct  35   FLVRRTGSSFNAVILKRLFMSKVNKAPLSLSRLVNFMQGKEDKIGVVVGTVTDDVRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPA
Sbjct  95   PALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR  GRKFERARG+R SRG+KV
Sbjct  155  PGVPHSHTKPYVRYTGRKFERARGRRKSRGFKV  187


 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFL  36



>pdb|3J61|Q Chain Q, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAW50985.1| ribosomal protein L18 [Triticum aestivum]
Length=188

 Score =   255 bits (651),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 140/154 (91%), Gaps = 1/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYE  409
            FLVRRT SKFNAVILKRLFMSKTN+PPLS+ RL +F  GKE+K IAV+VGTITDD+R  E
Sbjct  35   FLVRRTKSKFNAVILKRLFMSKTNRPPLSMRRLSNFMKGKEEKNIAVVVGTITDDMRIQE  94

Query  408  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGP  229
            VPA+KV ALRFT+TARARI  AGGECLTFDQLALRAP G+NT+LLRGPKN+REAV+HFG 
Sbjct  95   VPAMKVTALRFTETARARIINAGGECLTFDQLALRAPTGENTILLRGPKNAREAVRHFGK  154

Query  228  APGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            APGVPHSHTKPYVR+KGRKFE+ RG+RNSRG+KV
Sbjct  155  APGVPHSHTKPYVRSKGRKFEKVRGRRNSRGFKV  188


 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++K+TKR APKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKRTKRVAPKSDDVYLKLLVKLYRFL  36



>ref|XP_001751734.1| predicted protein [Physcomitrella patens]
 gb|EDQ83169.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   254 bits (650),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 140/153 (92%), Gaps = 1/153 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT + FN+VILKRLFMS+TN+ PLS+SRL+ + +GK+DKIAVLVGTITDDVR +EV
Sbjct  35   FLVRRTDAPFNSVILKRLFMSRTNRAPLSMSRLVKYMAGKDDKIAVLVGTITDDVRQFEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARI KAGGECLTFDQLALRAP G NTVLLRGPKN+REAVKHFG A
Sbjct  95   PALKVAALRFTETARARILKAGGECLTFDQLALRAPTGANTVLLRGPKNAREAVKHFG-A  153

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVP SH KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  154  PGVPQSHAKPYVRSKGRKFEKARGRRNSRGFKV  186


 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 7/49 (14%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDS  542
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRF        V+R D+
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSGNVYLKLLVKLYRFL-------VRRTDA  42



>gb|EMS65848.1| 60S ribosomal protein L18-2 [Triticum urartu]
Length=229

 Score =   256 bits (654),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 140/153 (92%), Gaps = 1/153 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYE  409
            FLVRRT SKFNAVILKRLFMSKTN+PPLS+ RL +F  GKE+K IAV+VGTITDD+R  E
Sbjct  41   FLVRRTKSKFNAVILKRLFMSKTNRPPLSMRRLSNFMKGKEEKNIAVVVGTITDDMRIQE  100

Query  408  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGP  229
            VPA+KV ALRFT+TARARI  AGGECLTFDQLALRAP G+NT+LLRGPKN+REAV+HFG 
Sbjct  101  VPAMKVTALRFTETARARIVNAGGECLTFDQLALRAPTGENTILLRGPKNAREAVRHFGK  160

Query  228  APGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+K
Sbjct  161  APGVPHSHTKPYVRSKGRKFEKARGRRNSRGFK  193


 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  685  GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            GIDL AGG++K+TKR APKS+DVYLKLLVKLYRF 
Sbjct  8    GIDLVAGGRNKRTKRVAPKSNDVYLKLLVKLYRFL  42



>gb|KEH24393.1| 60S ribosomal protein L18-3 [Medicago truncatula]
Length=188

 Score =   254 bits (649),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 136/154 (88%), Gaps = 1/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FN VILKRLFMSK NKPPLSLSRLI +T GKE KIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTESNFNKVILKRLFMSKVNKPPLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFG A
Sbjct  95   PAIKVTALRFTEKARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGRA  154

Query  225  PGVPHSHTKPYVRA-KGRKFERARGKRNSRGYKV  127
            PGVPHS+TKPYVR  K RK E ARGKR SRG+KV
Sbjct  155  PGVPHSNTKPYVRGKKSRKVEAARGKRKSRGFKV  188


 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_004977069.1| PREDICTED: 60S ribosomal protein L18-2-like [Setaria italica]
Length=188

 Score =   253 bits (647),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYE  409
            FLVRRT S FNAVILKRLFMSK N+PP+SL RL +F  GKE+K IAV+VGT+TDD R  E
Sbjct  35   FLVRRTKSSFNAVILKRLFMSKANRPPISLRRLANFMKGKEEKNIAVIVGTVTDDKRIQE  94

Query  408  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGP  229
            +PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG+NTVLLRGPKN+REAV+HFG 
Sbjct  95   IPAMKVTALRFTETARARIINAGGECLTFDQLALRAPLGENTVLLRGPKNAREAVRHFGK  154

Query  228  APGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  155  APGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188


 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFL  36



>gb|AFK34017.1| unknown [Medicago truncatula]
Length=188

 Score =   253 bits (646),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 136/154 (88%), Gaps = 1/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FN VILKRLFMSK NKPPLSLSRLI +T GKE KIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTESNFNKVILKRLFMSKVNKPPLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFG A
Sbjct  95   PAIKVTALRFTEKARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGRA  154

Query  225  PGVPHSHTKPYVRA-KGRKFERARGKRNSRGYKV  127
            PGVPHS+TKPYVR  K RK E ARGKR SRG++V
Sbjct  155  PGVPHSNTKPYVRGKKSRKVEAARGKRKSRGFRV  188


 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>gb|EYU46738.1| hypothetical protein MIMGU_mgv1a014520mg [Erythranthe guttata]
Length=187

 Score =   253 bits (645),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  588  DFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYE  409
             FLVRRTGSKFN V+ KRL MS+ N+PPLSLSRL +   GKE++IAVLVG++TDD+R +E
Sbjct  34   SFLVRRTGSKFNEVVRKRLTMSRVNRPPLSLSRLSALMKGKENQIAVLVGSVTDDIRVHE  93

Query  408  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGP  229
            +PA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTV+LRG + +REAV+HFG 
Sbjct  94   IPAMKVAALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVILRGSRKAREAVRHFGA  153

Query  228  APGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            APGVPHSHTKPYVR+KGRKFE+ARG+R SRG++V
Sbjct  154  APGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV  187


 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRT PKSDD+Y+KLLVKLY F 
Sbjct  1    MGIDLVAGGKSKKTKRTKPKSDDIYIKLLVKLYSFL  36



>ref|NP_001054688.1| Os05g0155100 [Oryza sativa Japonica Group]
 gb|AAV32218.1| cytoplasmic ribosomal protein L18 [Oryza sativa Japonica Group]
 dbj|BAF16602.1| Os05g0155100 [Oryza sativa Japonica Group]
 gb|EAY96610.1| hypothetical protein OsI_18515 [Oryza sativa Indica Group]
 gb|ABR25945.1| 60S ribosomal protein l18 [Oryza sativa Indica Group]
 dbj|BAG88175.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00211.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62383.1| hypothetical protein OsJ_17172 [Oryza sativa Japonica Group]
Length=188

 Score =   252 bits (644),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 137/154 (89%), Gaps = 1/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYE  409
            FLVRRT S FNAVILKRLFMSKTN+PPLSL RL  F  GKE+  IAV+VGT+TDD R  E
Sbjct  35   FLVRRTKSNFNAVILKRLFMSKTNRPPLSLRRLAKFMEGKEENNIAVIVGTVTDDKRIQE  94

Query  408  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGP  229
            +P +KV ALRFT+TARARI  AGGECLTFDQLALRAPLG+NTVLLRGPKN+REAV+HFG 
Sbjct  95   IPKMKVTALRFTETARARIVNAGGECLTFDQLALRAPLGENTVLLRGPKNAREAVRHFGK  154

Query  228  APGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  155  APGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188


 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++K+TKRTAP+SDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSDDVYLKLLVKLYRFL  36



>sp|O65729.1|RL18_CICAR RecName: Full=60S ribosomal protein L18, partial [Cicer arietinum]
 emb|CAA06246.1| ribosomal protein L18 [Cicer arietinum]
Length=183

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 137/153 (90%), Gaps = 1/153 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FNAVILKRLFMSK N+PPLSLSRLI +  GKE KI V+VG +TDD+R Y+V
Sbjct  32   FLVRRTDSNFNAVILKRLFMSKVNRPPLSLSRLIKYMQGKEGKIGVVVGAVTDDIRVYDV  91

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P +KV AL+FT+TARARI+KAGGECLTFDQLALR PL  +TVLLRGPKN+REAVKHFGPA
Sbjct  92   PTIKVTALKFTETARARIQKAGGECLTFDQLALRLPL-TDTVLLRGPKNAREAVKHFGPA  150

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARG+R SRG++V
Sbjct  151  PGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV  183


 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 7/47 (15%)
 Frame = -2

Query  679  DLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  539
            DLKAGGK+K+TKRT+PKS+D+YLKLLVKLYRF        V+R DS 
Sbjct  1    DLKAGGKNKKTKRTSPKSNDIYLKLLVKLYRFL-------VRRTDSN  40



>gb|KIZ05100.1| 60S ribosomal protein L18-3 [Monoraphidium neglectum]
 gb|KIZ07537.1| 60S ribosomal protein L18-3 [Monoraphidium neglectum]
Length=187

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FL RRT S FNAV+LKRLFMSK N+PPLSLS+L  F +GKEDK+AVLVGT+TDDVR +EV
Sbjct  35   FLERRTESNFNAVVLKRLFMSKINRPPLSLSKLAKFMAGKEDKVAVLVGTVTDDVRLHEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P L+V ALRFT+TARARI KAGGECLTFDQLAL  P G++ VLLRGPKN+REAVKHFGPA
Sbjct  95   PKLRVTALRFTETARARIVKAGGECLTFDQLALERPTGKDCVLLRGPKNNREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PGVPHS TKPYVR+KGRKFE+ARG+RNSRGYK
Sbjct  155  PGVPHSSTKPYVRSKGRKFEKARGRRNSRGYK  186


 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++ +  RTAPKSD+VYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGRNTKKHRTAPKSDNVYLKLLVKLYRFL  36



>gb|KJB82633.1| hypothetical protein B456_013G206100 [Gossypium raimondii]
Length=134

 Score =   248 bits (634),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = -3

Query  528  MSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIE  349
            MSK NKPPLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIE
Sbjct  1    MSKVNKPPLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIE  60

Query  348  KAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKF  169
            KAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR++GRKF
Sbjct  61   KAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSRGRKF  120

Query  168  ERARGKRNSRGYKV  127
            ERARG+RNS+G++V
Sbjct  121  ERARGRRNSKGFRV  134



>gb|KJB23305.1| hypothetical protein B456_004G091200 [Gossypium raimondii]
Length=134

 Score =   248 bits (633),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = -3

Query  528  MSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIE  349
            MSK NKPPLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARI+
Sbjct  1    MSKVNKPPLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARID  60

Query  348  KAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKF  169
            KAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKF
Sbjct  61   KAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKF  120

Query  168  ERARGKRNSRGYKV  127
            ERARG+RNS+G++V
Sbjct  121  ERARGRRNSKGFRV  134



>ref|XP_010550998.1| PREDICTED: 60S ribosomal protein L18-2-like isoform X2 [Tarenaya 
hassleriana]
Length=157

 Score =   248 bits (633),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = -3

Query  588  DFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYE  409
             FL+R TGS FNAVILKRLFMSK NK PLSLSRL++F  GKEDKI V+VGT+TDDVR YE
Sbjct  5    SFLLR-TGSSFNAVILKRLFMSKVNKAPLSLSRLVNFMQGKEDKIGVVVGTVTDDVRVYE  63

Query  408  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGP  229
            VPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGP
Sbjct  64   VPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGP  123

Query  228  APGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            APGVPHSHTKPYVR  GRKFERARG+R SRG+KV
Sbjct  124  APGVPHSHTKPYVRYTGRKFERARGRRKSRGFKV  157



>gb|KJB22517.1| hypothetical protein B456_004G052100 [Gossypium raimondii]
Length=134

 Score =   247 bits (630),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = -3

Query  528  MSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIE  349
            MSK NKPPLSLSRLI +  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIE
Sbjct  1    MSKVNKPPLSLSRLIQYMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIE  60

Query  348  KAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKF  169
            KAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+ GRKF
Sbjct  61   KAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSNGRKF  120

Query  168  ERARGKRNSRGYKV  127
            ERARG+RNS+G++V
Sbjct  121  ERARGRRNSKGFRV  134



>ref|XP_005843726.1| hypothetical protein CHLNCDRAFT_37334 [Chlorella variabilis]
 gb|EFN51624.1| hypothetical protein CHLNCDRAFT_37334 [Chlorella variabilis]
Length=187

 Score =   247 bits (630),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FN V+LKRLFMSKTN+PPLSLS+L+ F  GKE K+AVLVGTITDD R +EV
Sbjct  35   FLVRRTESDFNKVVLKRLFMSKTNRPPLSLSKLVKFMEGKEGKLAVLVGTITDDTRLFEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P L+VCALR T+TARARI KAGGE +TFDQLAL AP G NTVLLRGPKNSREAVKHFGPA
Sbjct  95   PKLRVCALRVTETARARILKAGGEIITFDQLALIAPTGSNTVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PGVP S  KPYVRAKGRKFERARG+R SRGYK
Sbjct  155  PGVPGSTAKPYVRAKGRKFERARGRRKSRGYK  186


 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGG++K+  RTAPKS++ Y+KLLVKLYRF 
Sbjct  1    MGIDLIAGGRNKRVHRTAPKSENPYVKLLVKLYRFL  36



>ref|XP_003081305.1| ribosomal protein L18 (ISS) [Ostreococcus tauri]
Length=181

 Score =   246 bits (629),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FL RRTGSKFN  +LKRLFMSKTN+PPLSLS+L  F  GKE K+A +VGTITDDVR ++V
Sbjct  30   FLARRTGSKFNETVLKRLFMSKTNRPPLSLSKLAKFMKGKEGKVAAVVGTITDDVRMFDV  89

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKVCALRFT+TARARI KAGGEC+TFDQLAL AP G+  VLLRGPKNSREAVKHFG A
Sbjct  90   PKLKVCALRFTETARARIIKAGGECMTFDQLALAAPTGEGVVLLRGPKNSREAVKHFG-A  148

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PG+P SH KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  149  PGIPGSHAKPYVRSKGRKFEKARGRRNSRGFKV  181



>ref|XP_001690885.1| ribosomal protein L18, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 ref|XP_010832938.1| PREDICTED: 60S ribosomal protein L18-2-like [Bison bison bison]
 gb|EDP05331.1| ribosomal protein L18 [Chlamydomonas reinhardtii]
Length=187

 Score =   246 bits (629),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFN VILKRLFMSKTN+PPLSLS+L +F  GKE K+AV+V T+TDDVR +EV
Sbjct  35   FLVRRTESKFNKVILKRLFMSKTNRPPLSLSKLAAFMKGKESKVAVIVATVTDDVRLFEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P L+VCALRFT+TARARI KAGGECLTFDQLAL+ P G++ VLLRGPK+ REA KHFGPA
Sbjct  95   PKLRVCALRFTETARARITKAGGECLTFDQLALQRPTGKDCVLLRGPKSQREACKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVP S TKPYVRAKGRKFE+ARG+R SRG+KV
Sbjct  155  PGVPGSTTKPYVRAKGRKFEKARGRRKSRGFKV  187


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGG+SK+  RTAPKS +VYL LLVKLYRF 
Sbjct  1    MGIDLKAGGRSKKVHRTAPKSQNVYLALLVKLYRFL  36



>emb|CEF99132.1| Ribosomal protein L18e, conserved site [Ostreococcus tauri]
Length=186

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FL RRTGSKFN  +LKRLFMSKTN+PPLSLS+L  F  GKE K+A +VGTITDDVR ++V
Sbjct  35   FLARRTGSKFNETVLKRLFMSKTNRPPLSLSKLAKFMKGKEGKVAAVVGTITDDVRMFDV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P LKVCALRFT+TARARI KAGGEC+TFDQLAL AP G+  VLLRGPKNSREAVKHFG A
Sbjct  95   PKLKVCALRFTETARARIIKAGGECMTFDQLALAAPTGEGVVLLRGPKNSREAVKHFG-A  153

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PG+P SH KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  154  PGIPGSHAKPYVRSKGRKFEKARGRRNSRGFKV  186


 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGG++K+T RTAPKSD+VYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGRNKKTSRTAPKSDNVYLKLLVKLYRFL  36



>ref|XP_002948325.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ50732.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=187

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFN VILKRLFMSKTN+PPLSLS+L +F  GKE+K+AV+V T+TDDVR YEV
Sbjct  35   FLVRRTDSKFNKVILKRLFMSKTNRPPLSLSKLATFMKGKENKVAVIVATVTDDVRLYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P L+V ALRFT+TARARI KAGGECLTFDQLAL  P G++ VLLRGPK+ REAVKHFGPA
Sbjct  95   PKLRVVALRFTETARARITKAGGECLTFDQLALERPTGKDCVLLRGPKSHREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVP S TKPYVRAKGRKFE+ARG+R SRG+KV
Sbjct  155  PGVPGSTTKPYVRAKGRKFEKARGRRKSRGFKV  187


 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 7/50 (14%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  539
            MGIDLKAGG+SK+  RTAPKS +VYL LLVKLYRF        V+R DS+
Sbjct  1    MGIDLKAGGRSKKVHRTAPKSQNVYLALLVKLYRFL-------VRRTDSK  43



>ref|XP_001785869.1| predicted protein [Physcomitrella patens]
 gb|EDQ49322.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   244 bits (622),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 136/153 (89%), Gaps = 1/153 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT + FN+V+LKRLFMS+ N+PP+S+SRL+ + +GKE KIAV+VGT+TDD R YEV
Sbjct  35   FLVRRTDAPFNSVVLKRLFMSRINRPPISMSRLVKYMTGKEGKIAVIVGTVTDDTRIYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARI K+GGE LTFDQLALRAP G N VLLRGPKN+REAVKHFG A
Sbjct  95   PALKVAALRFTETARARILKSGGEVLTFDQLALRAPTGSNCVLLRGPKNAREAVKHFG-A  153

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVP SH KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  154  PGVPQSHAKPYVRSKGRKFEKARGRRNSRGFKV  186


 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 7/49 (14%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDS  542
            MGIDLKAGG++K+TKRTAPKSD+VYLKLLVKLYRF        V+R D+
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSDNVYLKLLVKLYRFL-------VRRTDA  42



>ref|XP_001760959.1| predicted protein [Physcomitrella patens]
 gb|EDQ74348.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   244 bits (622),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT + FNAV+LKRLFMS+ N+PP+S+SRL+ +  GKEDKIAV+VG++TDD R YEV
Sbjct  35   FLVRRTDAPFNAVVLKRLFMSRINRPPISMSRLVRYMKGKEDKIAVIVGSVTDDTRIYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKV ALRFT+TARARI K GGE LTFDQLALRAP G N VLLRGPKN+REAVKHFG A
Sbjct  95   PALKVAALRFTETARARILKNGGEVLTFDQLALRAPTGSNCVLLRGPKNAREAVKHFG-A  153

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVP SH KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  154  PGVPRSHAKPYVRSKGRKFEKARGRRNSRGFKV  186


 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 7/49 (14%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDS  542
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRF        V+R D+
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSGNVYLKLLVKLYRFL-------VRRTDA  42



>ref|XP_007510670.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18203.1| predicted protein [Bathycoccus prasinos]
Length=240

 Score =   244 bits (622),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FL RRT SKFN  +LKRLFMSKTN+PPLSLS+L  F  GKE K+A +VGTITDDVR +EV
Sbjct  89   FLARRTDSKFNQTVLKRLFMSKTNRPPLSLSKLAKFMKGKEGKVACVVGTITDDVRMFEV  148

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P L VCALRFT TARARI KAGGECLTFDQLAL+AP G+  VLLRGPKNSREAVKHFG A
Sbjct  149  PKLTVCALRFTATARARIVKAGGECLTFDQLALKAPTGEGVVLLRGPKNSREAVKHFG-A  207

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PGVPHSH KPYV+ KGRKFE+ARG+R SRGYK
Sbjct  208  PGVPHSHAKPYVQHKGRKFEKARGRRASRGYK  239


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -2

Query  694  STMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            S  GIDL+AGG++K+TKRT+ KS++VYL LLVKLYRF 
Sbjct  53   SGKGIDLEAGGRNKKTKRTSQKSENVYLALLVKLYRFL  90



>ref|XP_001419602.1| Ribosomal protein L18, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO97895.1| Ribosomal protein L18, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=186

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 132/152 (87%), Gaps = 1/152 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FL RRT SKFN  +LKRLFMSKTN+PPLSLS++  F  GKE K+A +VGT+TDDVR ++V
Sbjct  35   FLARRTDSKFNDTVLKRLFMSKTNRPPLSLSKVAKFMKGKEGKVAAIVGTVTDDVRLHDV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKVCALRFT+TARARI KAGG+C+TFDQLAL AP G+  VLLRGPKNSREAVKHFG A
Sbjct  95   PALKVCALRFTETARARIIKAGGQCMTFDQLALSAPTGEGVVLLRGPKNSREAVKHFG-A  153

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PGVP SH KPYVRAKGRKFE+ARG+R SRGYK
Sbjct  154  PGVPGSHAKPYVRAKGRKFEKARGRRASRGYK  185


 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGG++K+T RTAPKSD+VYLKLLVKLYRF 
Sbjct  1    MGIDLKAGGRNKKTNRTAPKSDNVYLKLLVKLYRFL  36



>sp|O22254.3|RL181_ARATH RecName: Full=Putative 60S ribosomal protein L18-1 [Arabidopsis 
thaliana]
Length=188

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 132/154 (86%), Gaps = 1/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            +LVRRT SKFNAVILKRLFMSK NK PLSLSRL+ +  GK+ KIAV+VGT+TDDVR  +V
Sbjct  35   YLVRRTESKFNAVILKRLFMSKVNKAPLSLSRLVRYMDGKDGKIAVIVGTVTDDVRIEDV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAP-LGQNTVLLRGPKNSREAVKHFGP  229
            PAL V ALRFT++ARARI KAGGECLTFDQLAL  P   +NTVLLRGPKN+REAVKHFGP
Sbjct  95   PALTVTALRFTESARARIHKAGGECLTFDQLALPCPTWSENTVLLRGPKNTREAVKHFGP  154

Query  228  APGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            APGVPHSHTKPYVR  G+K E ARG+R SRG+KV
Sbjct  155  APGVPHSHTKPYVRQTGKKIEIARGRRRSRGFKV  188


 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRT PKSDDVYLKLLVK  R+ 
Sbjct  1    MGIDLIAGGKSKKTKRTEPKSDDVYLKLLVKANRYL  36



>gb|EYU21621.1| hypothetical protein MIMGU_mgv1a014504mg [Erythranthe guttata]
Length=187

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FL RRTGS FN++ILKRL MS+ N+PPLSLSRL S   GKE +IAVLVG+ITDD+R +E+
Sbjct  35   FLTRRTGSSFNSIILKRLIMSRVNRPPLSLSRLSSLMKGKEGQIAVLVGSITDDIRVHEI  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRG + +REAV+HFGPA
Sbjct  95   PAMKVAALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGSRKAREAVRHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187


 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRTAP+S+DVY+KLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTAPRSNDVYIKLLVKLYRFL  36



>ref|XP_002976425.1| hypothetical protein SELMODRAFT_267976 [Selaginella moellendorffii]
 gb|EFJ22685.1| hypothetical protein SELMODRAFT_267976 [Selaginella moellendorffii]
Length=187

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFNAVILKRLFMSKTN+PP+SLSRL +    K  KIAVLVGT+TDD R   V
Sbjct  35   FLVRRTNSKFNAVILKRLFMSKTNQPPVSLSRLSASMEKKSGKIAVLVGTVTDDPRLATV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+ V ALRFT+TARARI  AGG+CLTFD+LAL AP G NTVLLRG K++REAVKHFGPA
Sbjct  95   PAMTVVALRFTRTARARITNAGGKCLTFDELALLAPTGCNTVLLRGRKSAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  187


 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGID++AGG++K+TKRTAPKSD+VYLKLLVKLYRF 
Sbjct  1    MGIDIEAGGRNKKTKRTAPKSDNVYLKLLVKLYRFL  36



>ref|XP_002985888.1| hypothetical protein SELMODRAFT_181978 [Selaginella moellendorffii]
 gb|EFJ13065.1| hypothetical protein SELMODRAFT_181978 [Selaginella moellendorffii]
Length=187

 Score =   238 bits (607),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFNAVILKRLFMSKTN+PP+SLSRL +    K  KIAVLVGT+TDD R   V
Sbjct  35   FLVRRTNSKFNAVILKRLFMSKTNQPPVSLSRLSASMEKKSGKIAVLVGTVTDDPRLAAV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+ V ALRFT+TARARI  AGG+CLTFD+LAL AP G NTVLLRG K++REAVKHFGPA
Sbjct  95   PAMTVVALRFTRTARARITNAGGKCLTFDELALLAPTGCNTVLLRGRKSAREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSHTKPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  155  PGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  187


 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGID++AGG++K+TKRTAPKSD+VYLKLLVKLYRF 
Sbjct  1    MGIDIEAGGRNKKTKRTAPKSDNVYLKLLVKLYRFL  36



>ref|XP_006298641.1| hypothetical protein CARUB_v10014730mg [Capsella rubella]
 gb|EOA31539.1| hypothetical protein CARUB_v10014730mg [Capsella rubella]
Length=134

 Score =   235 bits (600),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -3

Query  528  MSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIE  349
            MSK NK PLSLSRL+ F  GKEDKIAVLVGT+TDDVR +E+PA+KV ALRFT+ ARARIE
Sbjct  1    MSKVNKAPLSLSRLVEFMEGKEDKIAVLVGTVTDDVRVHEIPAMKVTALRFTERARARIE  60

Query  348  KAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKF  169
            KAGGECLTFDQLALRAPLGQNT+LLRGPKNSREAVKHFG APGVPHS TKPYVR KGRKF
Sbjct  61   KAGGECLTFDQLALRAPLGQNTILLRGPKNSREAVKHFGLAPGVPHSDTKPYVRHKGRKF  120

Query  168  ERARGKRNSRGYKV  127
            E+ARGKR SRG+KV
Sbjct  121  EKARGKRKSRGFKV  134



>gb|ACR35483.1| unknown [Zea mays]
 tpg|DAA64099.1| TPA: hypothetical protein ZEAMMB73_909543 [Zea mays]
Length=134

 Score =   235 bits (599),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  528  MSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIE  349
            MSKTN+PPLS+ RL+ F  GK D+IAV+VGT+TDD R  EVPA+KVCALRFT+TARARI 
Sbjct  1    MSKTNRPPLSMRRLVRFMEGKGDQIAVIVGTVTDDKRISEVPAMKVCALRFTETARARII  60

Query  348  KAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKF  169
             AGGECLTFDQLALRAPLGQNTVLLRGPKN+REAV+HFGPAPGVPHSHTKPYVR+KGRKF
Sbjct  61   NAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVRHFGPAPGVPHSHTKPYVRSKGRKF  120

Query  168  ERARGKRNSRGYKV  127
            E+ARG+RNSRG+KV
Sbjct  121  EKARGRRNSRGFKV  134



>gb|ACJ85943.1| unknown [Medicago truncatula]
 gb|AFK48653.1| unknown [Medicago truncatula]
Length=174

 Score =   236 bits (603),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FN VILKRLFMSK NKPPLSLSRLI +T GKE KIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTESNFNKVILKRLFMSKVNKPPLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFG A
Sbjct  95   PAIKVTALRFTEKARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGRA  154

Query  225  PGVPHSHTKPYVRAK  181
            PGVPHS+TKPYVR K
Sbjct  155  PGVPHSNTKPYVRGK  169


 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_005643635.1| ribosomal protein L18 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE19091.1| ribosomal protein L18 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
Length=186

 Score =   234 bits (598),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SKFN V+LKRLFMS+TN+PPLSLS+L +F  GKEDK AVL+GTITDDVR +EV
Sbjct  35   FLVRRTESKFNKVVLKRLFMSRTNRPPLSLSKLATFMKGKEDKTAVLIGTITDDVRLFEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P L V ALR T+TARARI  AGG+ LTFDQLAL AP G N VLLRGPKNSREAVKH G A
Sbjct  95   PKLTVVALRVTETARARILGAGGKILTFDQLALLAPTGSNCVLLRGPKNSREAVKHRG-A  153

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PGVPHSH KPYVR+KGRKFE+ARG+R SRGYK
Sbjct  154  PGVPHSHAKPYVRSKGRKFEKARGRRKSRGYK  185


 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL+AGG++K+T RTAPKS++VYLKLLVKLY F 
Sbjct  1    MGIDLEAGGRNKKTWRTAPKSENVYLKLLVKLYTFL  36



>gb|KFK32338.1| hypothetical protein AALP_AA6G228700 [Arabis alpina]
Length=197

 Score =   234 bits (597),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 129/153 (84%), Gaps = 2/153 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FN VILKRLFMSK NK P SLSRL+   SGK+DKIAVLVGTI DDV  +++
Sbjct  47   FLVRRTQSNFNKVILKRLFMSKVNKAPFSLSRLVELMSGKDDKIAVLVGTIIDDVSVHDI  106

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
             A+KV ALRFT+ ARARI KAGG+CLTFDQLALRAPLGQNTV LRG KNSREAVKHFGPA
Sbjct  107  LAIKVAALRFTERARARIVKAGGKCLTFDQLALRAPLGQNTVFLRGRKNSREAVKHFGPA  166

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH+KPYVR++GRKFE  R  R SR +KV
Sbjct  167  PGVPHSHSKPYVRSEGRKFETRR--RKSRRFKV  197


 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  685  GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            GIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRF 
Sbjct  14   GIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFL  48



>ref|XP_010455078.1| PREDICTED: 60S ribosomal protein L18-2-like isoform X2 [Camelina 
sativa]
Length=134

 Score =   231 bits (590),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  528  MSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIE  349
            MSK NK PLSLS+L+SF +GK+ KI VLVGTITDD+R +++PA+K+ ALRFT+ ARARIE
Sbjct  1    MSKVNKAPLSLSKLVSFMNGKDGKIGVLVGTITDDLRVHDIPAMKITALRFTERARARIE  60

Query  348  KAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKF  169
            KAGGECLTFDQLAL+APLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR +GRKF
Sbjct  61   KAGGECLTFDQLALKAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRGRGRKF  120

Query  168  ERARGKRNSRGYKV  127
            E+ARG+R SRG+KV
Sbjct  121  EKARGRRKSRGFKV  134



>ref|XP_007143771.1| hypothetical protein PHAVU_007G100200g, partial [Phaseolus vulgaris]
 gb|ESW15765.1| hypothetical protein PHAVU_007G100200g, partial [Phaseolus vulgaris]
Length=148

 Score =   231 bits (588),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = -3

Query  570  TGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKV  391
            TGS FN VILKRLFMSK NKPPLSLSRLI  T GKEDKI V+VGT+ DD+  YEVP LK+
Sbjct  1    TGSNFNVVILKRLFMSKVNKPPLSLSRLIRHTKGKEDKIVVVVGTVPDDIIVYEVPQLKI  60

Query  390  CALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPH  211
              L+FT+ ARAR++K  GECLTFDQLALRAPLGQNTVLLRGPKN REAVKHFG A  VPH
Sbjct  61   TTLKFTERARARVDKTYGECLTFDQLALRAPLGQNTVLLRGPKNVREAVKHFGLASSVPH  120

Query  210  SHTKPYVRAKGRKFERARGKRNSRGYKV  127
            +H+KPY R+KGRKFE+ RG +N+RG++V
Sbjct  121  NHSKPYDRSKGRKFEKVRGSKNNRGFRV  148



>gb|ACN41161.1| unknown [Picea sitchensis]
Length=134

 Score =   229 bits (584),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -3

Query  528  MSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIE  349
            MSKTNKPPLSLSRL  +  GK+DKIAV+VGTITDD R YE+P +KV ALRFT+TARARI 
Sbjct  1    MSKTNKPPLSLSRLARYMQGKDDKIAVVVGTITDDNRVYELPPVKVTALRFTETARARIL  60

Query  348  KAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKF  169
            KAGGECLTFDQLALRAPLGQNTVLLRGPK+ REAVKHFG APGVPHSHTKPYVR+KGRK+
Sbjct  61   KAGGECLTFDQLALRAPLGQNTVLLRGPKSHREAVKHFGRAPGVPHSHTKPYVRSKGRKY  120

Query  168  ERARGKRNSRGYKV  127
            E ARG+RNSRG+KV
Sbjct  121  EMARGRRNSRGFKV  134



>ref|XP_001745439.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90017.1| predicted protein [Monosiga brevicollis MX1]
Length=185

 Score =   229 bits (585),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FL RRT S FN V+L+RLFMS+ N+PPLSLS+L++    +E KIAV+VGT+TDDVR  EV
Sbjct  34   FLARRTESSFNKVVLRRLFMSRINRPPLSLSKLMTHMKKQESKIAVIVGTVTDDVRVIEV  93

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P L VCALR T++AR RI  AGGE +TFDQLALRAP GQNTVLL+GP+ SREAVKHFG A
Sbjct  94   PKLTVCALRVTESARKRILAAGGEIMTFDQLALRAPTGQNTVLLQGPRKSREAVKHFG-A  152

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVPHSH KPYVR+KGRKFE+ARG+R SRGYKV
Sbjct  153  PGVPHSHVKPYVRSKGRKFEKARGRRASRGYKV  185



>gb|ACF83096.1| unknown [Zea mays]
 gb|AFW81441.1| hypothetical protein ZEAMMB73_288952 [Zea mays]
 gb|AFW81442.1| hypothetical protein ZEAMMB73_288952 [Zea mays]
Length=134

 Score =   227 bits (578),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  528  MSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIE  349
            MSKTN+PP+S+ RL+ F  GKE  IAV+VGT+TDD R  EVPA+KV ALRFT+TARARI 
Sbjct  1    MSKTNRPPISMRRLVKFMEGKEKNIAVIVGTVTDDKRIQEVPAMKVTALRFTETARARIV  60

Query  348  KAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKF  169
             AGGECLTFDQLALRAPLG+NTVLLRGPKN+REAV+HFG APGVPHSHTKPYVR+KGRKF
Sbjct  61   NAGGECLTFDQLALRAPLGENTVLLRGPKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKF  120

Query  168  ERARGKRNSRGYKV  127
            E+ARG+RNSRG+KV
Sbjct  121  EKARGRRNSRGFKV  134



>gb|ABR23470.1| 60s ribosomal protein L18 [Ornithodoros parkeri]
Length=188

 Score =   227 bits (579),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAVLVGTITDDVRAY  412
            FL RRT +KFN VILKRLFMS+ N+PP++LS+++ F    G+E+KIAV+VGTITDDVR Y
Sbjct  34   FLARRTDAKFNRVILKRLFMSRINRPPMALSKVVRFMKKPGRENKIAVVVGTITDDVRLY  93

Query  411  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG  232
            EVP L+VCAL  T  ARARI KAGGE + FD+LA+++P GQNTVL++G + +REA +HFG
Sbjct  94   EVPKLRVCALHVTDRARARIHKAGGEIMNFDELAVKSPRGQNTVLIQGRRTAREACRHFG  153

Query  231  PAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PAPGVPHSHTKPYVR+KGRKFERARG+R SRG+KV
Sbjct  154  PAPGVPHSHTKPYVRSKGRKFERARGRRKSRGFKV  188



>ref|XP_003626232.1| 60S ribosomal protein L18 [Medicago truncatula]
 gb|AES82450.1| 60S ribosomal protein L18-3 [Medicago truncatula]
Length=134

 Score =   225 bits (574),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  528  MSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIE  349
            MSK N+PP+SLS++I +  GK+ KI V+VG +TDD+R YEVP LK+ ALRFT+TARARIE
Sbjct  1    MSKVNRPPISLSKMIEYMKGKDGKIGVVVGAVTDDIRVYEVPVLKIAALRFTETARARIE  60

Query  348  KAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKF  169
            KAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSH+KPYVR+KGRK 
Sbjct  61   KAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGRAPGVPHSHSKPYVRSKGRKQ  120

Query  168  ERARGKRNSRGYKV  127
            E+ARGKR SRG++V
Sbjct  121  EKARGKRKSRGFRV  134



>ref|XP_001640445.1| predicted protein [Nematostella vectensis]
 gb|EDO48382.1| predicted protein [Nematostella vectensis]
Length=188

 Score =   226 bits (577),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLI--SFTSGKEDKIAVLVGTITDDVRAY  412
            FL RRT +KFN +++KRL MS+T +PPLSL+RL+     SG +DKI V+VG+ITDD R +
Sbjct  34   FLSRRTNAKFNQIVMKRLCMSRTKRPPLSLARLVRKMKASGHKDKICVVVGSITDDKRIF  93

Query  411  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG  232
            EVPALK+CALRF++TARARI KAGGE LTFDQLALRAPLGQNTVLL+GP+ +REA +H G
Sbjct  94   EVPALKICALRFSETARARILKAGGEILTFDQLALRAPLGQNTVLLQGPRKAREAERHMG  153

Query  231  PAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
             APGVPHS TKP+VR+KGRKFERARG+R SRG+KV
Sbjct  154  LAPGVPHSDTKPFVRSKGRKFERARGRRKSRGFKV  188



>ref|XP_009775352.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana sylvestris]
Length=173

 Score =   226 bits (575),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 128/153 (84%), Gaps = 14/153 (9%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRTGS+FNAVILKRLFMSK NK PLSLSRLI++  GKEDK+AV+             
Sbjct  35   FLVRRTGSQFNAVILKRLFMSKINKAPLSLSRLITYMKGKEDKVAVV-------------  81

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
                V ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG A
Sbjct  82   -VGTVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGRA  140

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGV HSHTKPYVRAKGRKFERARGKR SRG+KV
Sbjct  141  PGVSHSHTKPYVRAKGRKFERARGKRKSRGFKV  173


 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL AGGKSK+TKRT P+SDDVYLKLLVKLYRF 
Sbjct  1    MGIDLVAGGKSKKTKRTTPQSDDVYLKLLVKLYRFL  36



>ref|XP_002400316.1| ribosomal protein L18, putative [Ixodes scapularis]
 gb|EEC15787.1| ribosomal protein L18, putative [Ixodes scapularis]
Length=188

 Score =   226 bits (576),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 133/154 (86%), Gaps = 2/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAVLVGTITDDVRAY  412
            FL RR+G+KFN ++LKRLFMS+ NKP +SL+R+  F    G+E+ IAV+VGT+TDD+R Y
Sbjct  34   FLARRSGAKFNRIVLKRLFMSRINKPVISLARVTRFMKKPGRENLIAVVVGTVTDDLRLY  93

Query  411  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG  232
            +VP L++CALR T+ ARARI KAGGE LTFDQLA++AP G+ TVL++GP+NSREA +HFG
Sbjct  94   DVPKLRLCALRVTERARARILKAGGEILTFDQLAVQAPKGKGTVLMQGPRNSREACRHFG  153

Query  231  PAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PAPGVPHSHTKPYVR+KGRKFERARG+R SRGYK
Sbjct  154  PAPGVPHSHTKPYVRSKGRKFERARGRRKSRGYK  187



>gb|AAO46881.1| 60S ribosomal protein [Medicago sativa]
Length=164

 Score =   223 bits (569),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FN VILKRLFMSK NKPPLSLSRLI +T GKE KIAV+VG +TDD+R YEV
Sbjct  35   FLVRRTESNFNKVILKRLFMSKVNKPPLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL+APLGQNTVLLRGPKN+REAVKHFG A
Sbjct  95   PAIKVTALRFTEKARARIEKAGGECLTFDQLALKAPLGQNTVLLRGPKNAREAVKHFGRA  154

Query  225  PGVPHSHTK  199
            PGVPHS TK
Sbjct  155  PGVPHSSTK  163


 Score = 70.9 bits (172),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRF 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFL  36



>ref|XP_011255380.1| PREDICTED: 60S ribosomal protein L18 [Camponotus floridanus]
 gb|EFN68908.1| 60S ribosomal protein L18 [Camponotus floridanus]
Length=188

 Score =   225 bits (573),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 131/154 (85%), Gaps = 2/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAVLVGTITDDVRAY  412
            FL RRT SKFN +IL+RLFMSK N+PP+SL+R++ F    G+E+ +AV+VG++TDD R +
Sbjct  34   FLARRTNSKFNQIILRRLFMSKINRPPISLARIVRFMKKPGRENCVAVIVGSVTDDARIF  93

Query  411  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG  232
            E+P L VCALR T+ ARARI KAGGE +TFDQLALRAP G+ TVL++GP+ +RE+VKHFG
Sbjct  94   EIPKLTVCALRVTERARARILKAGGEIITFDQLALRAPTGKRTVLMQGPRKARESVKHFG  153

Query  231  PAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PAPGVPHSH+KPYVR+KGRKFERARG+R S GYK
Sbjct  154  PAPGVPHSHSKPYVRSKGRKFERARGRRRSCGYK  187



>ref|XP_968042.1| PREDICTED: 60S ribosomal protein L18 [Tribolium castaneum]
 gb|EFA00786.1| hypothetical protein TcasGA2_TC003672 [Tribolium castaneum]
Length=188

 Score =   224 bits (571),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 127/154 (82%), Gaps = 2/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAVLVGTITDDVRAY  412
            +L RRTGSKFN +ILKRLFMSK NKPP+SL+R++      G+E   AV+VGT+TDD R +
Sbjct  34   YLARRTGSKFNKIILKRLFMSKINKPPISLARVVRAMKKPGREGLTAVIVGTVTDDARIW  93

Query  411  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG  232
            EVP L +CALR T TARARI KAGGE +TFDQLALRAP G  TVLL+G +N+REAVKHFG
Sbjct  94   EVPKLSICALRVTGTARARILKAGGEVITFDQLALRAPTGAKTVLLQGRRNAREAVKHFG  153

Query  231  PAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PAPGVPHSHTKP+VR KGRKFERARG+R S GYK
Sbjct  154  PAPGVPHSHTKPFVRTKGRKFERARGRRRSCGYK  187



>gb|ADV03044.1| ribosomal protein L18 [Amphidinium carterae]
Length=187

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = -3

Query  576  RRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPAL  397
            RRT SKFN VI KR+ M++ NK PLSLSRLI     KE KIAV+VG++TDD R Y+VPA+
Sbjct  38   RRTESKFNKVIHKRMNMARRNKAPLSLSRLIKNMENKEGKIAVVVGSVTDDKRIYDVPAM  97

Query  396  KVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGV  217
             VCALRFT+TARARI +AGGECLTFD+L +RAPLGQ TVLLRGP  +RE  KHFG APGV
Sbjct  98   TVCALRFTETARARIVEAGGECLTFDKLVMRAPLGQGTVLLRGPTKAREVEKHFGKAPGV  157

Query  216  PHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PHS TKPY+RAKGRKFE+ARG+R SRGYKV
Sbjct  158  PHSSTKPYLRAKGRKFEKARGRRKSRGYKV  187



>ref|XP_011351685.1| PREDICTED: 60S ribosomal protein L18 [Cerapachys biroi]
 gb|EZA61183.1| 60S ribosomal protein L18 [Cerapachys biroi]
Length=188

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAVLVGTITDDVRAY  412
            FL RRT SKFN +ILKRLFMSK ++PP+SL+R++ F    G+E+ IAV+VGT+TDD R +
Sbjct  34   FLARRTNSKFNRIILKRLFMSKIHRPPISLARIVRFMKKPGRENCIAVIVGTVTDDARIF  93

Query  411  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG  232
            E+P L VCALR T  ARARI KAGGE +T DQLALRAP G++TVL++GP+ +RE+VKHFG
Sbjct  94   EIPKLTVCALRVTTRARARILKAGGEIITLDQLALRAPTGKHTVLMQGPRKARESVKHFG  153

Query  231  PAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PAPGVPHSH+KPYVR+KGRKFERARG+R S GYK
Sbjct  154  PAPGVPHSHSKPYVRSKGRKFERARGRRRSCGYK  187



>ref|XP_004991895.1| ribosomal protein l18 [Salpingoeca rosetta]
 gb|EGD75438.1| ribosomal protein l18 [Salpingoeca rosetta]
Length=186

 Score =   223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FN V+LKR+FMSK ++PP+SLSR++    G+E  IAV+VGT+TDD R  E+
Sbjct  34   FLVRRTNSSFNKVVLKRMFMSKIHRPPMSLSRIVQNMKGREQLIAVIVGTVTDDPRMLEL  93

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P L VCALRF++TAR RI  AGGECLTFDQLALR+P GQNTVL++GP+ +REAVKHFG A
Sbjct  94   PKLTVCALRFSETARKRILAAGGECLTFDQLALRSPKGQNTVLMQGPRKAREAVKHFGRA  153

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PG+P SH +PYVRAKGRKFE+ARG+R SRG++
Sbjct  154  PGLPGSHARPYVRAKGRKFEKARGRRTSRGFR  185



>emb|CBK22327.2| unnamed protein product [Blastocystis hominis]
Length=194

 Score =   223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 141/193 (73%), Gaps = 6/193 (3%)
 Frame = -3

Query  690  PWVSI*KPEVRASRRSA-----QLPSPtmft*sfs*sfTDFLVRRTGSKFNAVILKRLFM  526
            PWV +   ++ A  R+      Q P       +   +   FL RRT ++F  V+LKRL+M
Sbjct  3    PWVKLPGIDLVAGGRNCGHKKRQAPKSENVYLALLVNLYRFLARRTNARFPEVVLKRLYM  62

Query  525  SKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEK  346
            S+ N+PP+SLSRL+    GKEDKIAV+VGT+TDD+R  EVPALKVCALRFT+TARARI K
Sbjct  63   SRINRPPMSLSRLMKHMQGKEDKIAVIVGTVTDDIRVIEVPALKVCALRFTETARARILK  122

Query  345  AGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFE  166
            AGGEC+T DQLALRAP G NTVLL+G +++REAV+HFG  PG P S  +PYVR+ GRKFE
Sbjct  123  AGGECITLDQLALRAPTGANTVLLQGHRSAREAVRHFG-TPGTPGSKARPYVRSTGRKFE  181

Query  165  RARGKRNSRGYKV  127
            RARG+R S GYKV
Sbjct  182  RARGRRASMGYKV  194



>ref|XP_006677675.1| hypothetical protein BATDEDRAFT_87003 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF82239.1| hypothetical protein BATDEDRAFT_87003 [Batrachochytrium dendrobatidis 
JAM81]
Length=186

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 127/152 (84%), Gaps = 1/152 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FL RRT SKFN V+LKRLFMS+ N+PP+S+SRL  + SGKE+KIAV+VGT+TDD R  EV
Sbjct  35   FLARRTNSKFNQVVLKRLFMSRVNRPPISISRLSKYLSGKENKIAVVVGTVTDDNRLLEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P + V ALR T +ARARI KAGGE LTFDQLALR+PLG+ TVLLRGPKNSREAVKHFG  
Sbjct  95   PKISVAALRVTNSARARILKAGGEILTFDQLALRSPLGKGTVLLRGPKNSREAVKHFG-T  153

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PG P S  KPYVR+KGRKFE+ARG+R SRGYK
Sbjct  154  PGKPGSTAKPYVRSKGRKFEKARGRRASRGYK  185


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MG+DL+     K+  R APKSD+VYL+LLVKLYRF 
Sbjct  1    MGVDLQKKHHQKKGARVAPKSDNVYLRLLVKLYRFL  36



>emb|CBK22442.2| unnamed protein product [Blastocystis hominis]
Length=186

 Score =   223 bits (567),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FL RRT ++F  V+LKRL+MS+ N+PP+SLSRL+    GKEDKIAV+VGT+TDD+R  EV
Sbjct  35   FLARRTNARFPEVVLKRLYMSRINRPPMSLSRLMKHMQGKEDKIAVIVGTVTDDIRVIEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKVCALRFT+TARARI KAGGEC+T DQLALRAP G NTVLL+G +++REAV+HFG  
Sbjct  95   PALKVCALRFTETARARILKAGGECITLDQLALRAPTGANTVLLQGHRSAREAVRHFG-T  153

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PG P S  +PYVR+ GRKFERARG+R S GYKV
Sbjct  154  PGTPGSKARPYVRSTGRKFERARGRRASMGYKV  186



>ref|XP_003707499.1| PREDICTED: 60S ribosomal protein L18-like [Megachile rotundata]
Length=218

 Score =   224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAVLVGTITDDVRAY  412
            FL RRT +KFN +ILKRLFMSK ++PP+SL+R++ F    G+E+ IAV+VGT+TDD R +
Sbjct  64   FLARRTNAKFNKIILKRLFMSKIHRPPISLARVVRFMKKPGRENAIAVIVGTVTDDARIF  123

Query  411  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG  232
            E+P L VCALR T+ ARARI KAGGE +TFDQLALRAP G+ TVL++G +N+REAVKHFG
Sbjct  124  EIPKLTVCALRITEKARARILKAGGELITFDQLALRAPTGRRTVLMQGRRNAREAVKHFG  183

Query  231  PAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PAPGVPHSHTKP VR+KGRKFERARG+R S GYK
Sbjct  184  PAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  217



>emb|CBK21900.2| Ribosomal protein L18e [Blastocystis hominis]
Length=189

 Score =   223 bits (567),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FL RRT ++F  V+LKRL+MS+ N+PP+SLSRL+    GKEDKIAV+VGT+TDD+R  EV
Sbjct  38   FLARRTNARFPEVVLKRLYMSRINRPPMSLSRLMKHMQGKEDKIAVIVGTVTDDIRVIEV  97

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PALKVCALRFT+TARARI KAGGEC+T DQLALRAP G NTVLL+G +++REAV+HFG  
Sbjct  98   PALKVCALRFTETARARILKAGGECITLDQLALRAPTGANTVLLQGHRSAREAVRHFG-T  156

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PG P S  +PYVR+ GRKFERARG+R S GYKV
Sbjct  157  PGTPGSKARPYVRSTGRKFERARGRRASMGYKV  189



>ref|XP_011135288.1| PREDICTED: 60S ribosomal protein L18 [Harpegnathos saltator]
Length=188

 Score =   222 bits (566),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 127/154 (82%), Gaps = 2/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAVLVGTITDDVRAY  412
            FL RRT SKFN +ILKRLFMSK NKPP+SL+R++   S   +E+ IAV+VGTITDD R +
Sbjct  34   FLARRTNSKFNKIILKRLFMSKINKPPISLARIVRLMSKSHRENCIAVVVGTITDDARIF  93

Query  411  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG  232
            E+P L VCALR T+ AR RI KAGGE +TFDQLALRAP G+ TVLL+GP+ +REA KHFG
Sbjct  94   EIPKLTVCALRVTEKARGRILKAGGELITFDQLALRAPTGKRTVLLQGPRKAREAQKHFG  153

Query  231  PAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PAPGVPHSHTKP VR+KGRKFERARG+R S GYK
Sbjct  154  PAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  187



>gb|AAX48850.1| L18 [Suberites domuncula]
Length=187

 Score =   222 bits (566),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 134/155 (86%), Gaps = 2/155 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFT--SGKEDKIAVLVGTITDDVRAY  412
            FL RRT + FN V+LKRL+MSKTN+PPLS++R++     + +  KIAV+VGT+T+DVR +
Sbjct  33   FLARRTDAPFNKVVLKRLYMSKTNRPPLSIARIVRQMKPADRTTKIAVVVGTVTNDVRIF  92

Query  411  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG  232
            ++P + +CAL+FT+ ARAR+ KAGGE LTFDQLALRAP GQNT++L+GP+ +REAV+HFG
Sbjct  93   DIPKMTICALKFTEAARARVLKAGGEVLTFDQLALRAPKGQNTIILQGPRRAREAVRHFG  152

Query  231  PAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
             APGVPHSH+KPYVR+KGRKFERARG+RNS+G+KV
Sbjct  153  RAPGVPHSHSKPYVRSKGRKFERARGRRNSKGFKV  187



>gb|EFN87206.1| 60S ribosomal protein L18 [Harpegnathos saltator]
Length=187

 Score =   222 bits (565),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 127/154 (82%), Gaps = 2/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAVLVGTITDDVRAY  412
            FL RRT SKFN +ILKRLFMSK NKPP+SL+R++   S   +E+ IAV+VGTITDD R +
Sbjct  33   FLARRTNSKFNKIILKRLFMSKINKPPISLARIVRLMSKSHRENCIAVVVGTITDDARIF  92

Query  411  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG  232
            E+P L VCALR T+ AR RI KAGGE +TFDQLALRAP G+ TVLL+GP+ +REA KHFG
Sbjct  93   EIPKLTVCALRVTEKARGRILKAGGELITFDQLALRAPTGKRTVLLQGPRKAREAQKHFG  152

Query  231  PAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PAPGVPHSHTKP VR+KGRKFERARG+R S GYK
Sbjct  153  PAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  186



>ref|XP_006561192.1| PREDICTED: 60S ribosomal protein L18-like [Apis mellifera]
 ref|XP_006622209.1| PREDICTED: 60S ribosomal protein L18-like [Apis dorsata]
Length=188

 Score =   221 bits (564),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 129/154 (84%), Gaps = 2/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAVLVGTITDDVRAY  412
            FL RRT SKFN +ILKRLFMSK ++PP+SL+R++ F    G+E+ IAV+VGT+TDD R +
Sbjct  34   FLARRTNSKFNKIILKRLFMSKIHRPPISLARIVRFMKKPGRENAIAVIVGTVTDDARIF  93

Query  411  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG  232
            E+P L VCALR T+ ARARI KAGGE ++FDQLALRAP G+ TVL++G + +REAVKHFG
Sbjct  94   EIPKLTVCALRITERARARILKAGGELISFDQLALRAPTGKRTVLMQGRRKAREAVKHFG  153

Query  231  PAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PAPGVPHSHTKP VR+KGRKFERARG+R S GYK
Sbjct  154  PAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  187



>ref|XP_003056676.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58321.1| predicted protein [Micromonas pusilla CCMP1545]
Length=183

 Score =   221 bits (564),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 123/152 (81%), Gaps = 4/152 (3%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FL RRT S FN  +LKRLFMSK N+PPLSLS+L  F  G    ++ +VGT+TDD R +EV
Sbjct  35   FLARRTDSDFNKTVLKRLFMSKINRPPLSLSKLAKFHKGG---VSAIVGTVTDDARMFEV  91

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PA+KVCALRFT+TARARI KAGGEC+TFDQLAL AP G    LLRGPKNSREAVKHFG A
Sbjct  92   PAMKVCALRFTETARARIIKAGGECMTFDQLALSAPTGDGVTLLRGPKNSREAVKHFG-A  150

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PGVP SH KPYVR KGRKFE+ARG+R SRGYK
Sbjct  151  PGVPGSHAKPYVRHKGRKFEKARGRRKSRGYK  182


 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFF  581
            MGIDL+AGG++K   RTAPKS++VYLKLLVKLYRF 
Sbjct  1    MGIDLEAGGRNKVKHRTAPKSENVYLKLLVKLYRFL  36



>ref|XP_003691391.1| PREDICTED: 60S ribosomal protein L18-like [Apis florea]
Length=188

 Score =   221 bits (563),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 129/154 (84%), Gaps = 2/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAVLVGTITDDVRAY  412
            FL RRT SKFN +ILKRLFMSK ++PP+SL+R++ F    G+E+ IAV+VGT+TDD R +
Sbjct  34   FLARRTNSKFNKIILKRLFMSKIHRPPISLARIVRFMKKPGRENAIAVIVGTVTDDARIF  93

Query  411  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG  232
            E+P L VCALR T+ ARARI KAGGE ++FDQLALRAP G+ TVL++G + +REAVKHFG
Sbjct  94   EIPKLTVCALRVTERARARILKAGGELISFDQLALRAPTGKRTVLMQGRRKAREAVKHFG  153

Query  231  PAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PAPGVPHSHTKP VR+KGRKFERARG+R S GYK
Sbjct  154  PAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  187



>ref|XP_011015181.1| PREDICTED: 60S ribosomal protein L18-2-like, partial [Populus 
euphratica]
Length=126

 Score =   219 bits (557),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 118/126 (94%), Gaps = 1/126 (1%)
 Frame = -3

Query  504  LSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLT  325
            L  + +I F + +EDKIAV+VGTITDD+R YEVPALKV ALRFT+TARARIEKAGGECLT
Sbjct  2    LLFNDIIGFVN-QEDKIAVVVGTITDDIRVYEVPALKVTALRFTETARARIEKAGGECLT  60

Query  324  FDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRN  145
            FDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPY+R+KGRKFE+ARGKRN
Sbjct  61   FDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYIRSKGRKFEKARGKRN  120

Query  144  SRGYKV  127
            S+G++V
Sbjct  121  SKGFRV  126



>ref|XP_011497333.1| PREDICTED: 60S ribosomal protein L18 [Ceratosolen solmsi marchali]
Length=188

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 128/154 (83%), Gaps = 2/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAVLVGTITDDVRAY  412
            FL RRT SKFN +ILKRLFMS+ ++PP+SL+R+  F    G+ED IAV+VGT+TDD R +
Sbjct  34   FLARRTRSKFNRIILKRLFMSRIHRPPISLARITRFMKKPGREDCIAVIVGTVTDDARIF  93

Query  411  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG  232
            EVP L +CALR T+ AR RI KAGGE +TFDQLALR+P G+ TVL++GP+ +REAVKHFG
Sbjct  94   EVPKLTICALRVTEKARGRILKAGGEIITFDQLALRSPTGRKTVLIQGPRKAREAVKHFG  153

Query  231  PAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PAPGVPHSHTKP VR+KGRKFERARG+R S GYK
Sbjct  154  PAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  187



>gb|KDR14978.1| 60S ribosomal protein L18 [Zootermopsis nevadensis]
Length=188

 Score =   220 bits (560),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 127/154 (82%), Gaps = 2/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKE--DKIAVLVGTITDDVRAY  412
            FL RRT SKFN +ILKRLFMSK N+PP+SL+R++      E  + IAV+VGTITDD R +
Sbjct  34   FLTRRTKSKFNKIILKRLFMSKINRPPISLARVVHLMKDPERANLIAVIVGTITDDQRIF  93

Query  411  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG  232
            EVP L VCALR T+ ARARI KAGGE +TFDQLALRAP G+ TVL++G +N+REAVKHFG
Sbjct  94   EVPKLTVCALRVTERARARILKAGGEIITFDQLALRAPTGKKTVLIQGRRNAREAVKHFG  153

Query  231  PAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
             APGVPHSHTKPYVR+KGRKFERARG+R S GYK
Sbjct  154  LAPGVPHSHTKPYVRSKGRKFERARGRRRSCGYK  187



>ref|XP_011062886.1| PREDICTED: 60S ribosomal protein L18 [Acromyrmex echinatior]
 gb|EGI60312.1| 60S ribosomal protein L18 [Acromyrmex echinatior]
Length=232

 Score =   221 bits (563),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 128/154 (83%), Gaps = 2/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAVLVGTITDDVRAY  412
            FL RRT SKFN +ILKRLFMSK ++PP+SL+R++ F     +E+ +AV+VGTITDD R +
Sbjct  78   FLARRTNSKFNKIILKRLFMSKIHRPPISLARIVRFMKKPNRENCVAVIVGTITDDARIF  137

Query  411  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG  232
            EVP L VCALR T+ ARARI K GGE +TFDQLALR+P G  TVL++GP+N+RE+VKHFG
Sbjct  138  EVPKLTVCALRVTEKARARILKNGGEIITFDQLALRSPTGSRTVLMQGPRNARESVKHFG  197

Query  231  PAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
             APGVPHSHTKPYVR+KGRKFERARG+R S GYK
Sbjct  198  LAPGVPHSHTKPYVRSKGRKFERARGRRRSCGYK  231



>ref|XP_009012591.1| hypothetical protein HELRODRAFT_156470 [Helobdella robusta]
 gb|ESO09498.1| hypothetical protein HELRODRAFT_156470 [Helobdella robusta]
Length=188

 Score =   219 bits (558),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 126/154 (82%), Gaps = 2/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFT--SGKEDKIAVLVGTITDDVRAY  412
            FL RRT +KFN ++ KRL MS+TNKPPLSLSRL       G+E+K+AV+VGT+TDD R Y
Sbjct  34   FLARRTNAKFNQIVFKRLIMSRTNKPPLSLSRLSRHMKKQGRENKLAVVVGTVTDDERLY  93

Query  411  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG  232
             VP LK+ ALR T TAR RI KAGGE LTFDQLAL+AP G+NTVLL+G + +R+A +HFG
Sbjct  94   TVPKLKLVALRVTDTARTRILKAGGEILTFDQLALKAPKGENTVLLQGQRKARKAYRHFG  153

Query  231  PAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
             APGVPHSHTKPYVRAKGRKFERARG+R SRGYK
Sbjct  154  LAPGVPHSHTKPYVRAKGRKFERARGRRKSRGYK  187



>emb|CAJ17294.1| ribosomal protein L18e [Hister sp. APV-2005]
Length=188

 Score =   219 bits (558),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 2/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAVLVGTITDDVRAY  412
            +L RRT SKFN +IL+RLFMS+ N+ P+SL+R++ F    G+E  +AV+VGT+TDD R +
Sbjct  34   YLARRTNSKFNKIILRRLFMSRINRAPMSLARIVRFMKKPGREGLMAVVVGTVTDDQRIW  93

Query  411  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG  232
            EVP L VCALR T+ ARARI KAGGE LTFDQLALRAP G  TVL++G + +REAVKHFG
Sbjct  94   EVPKLTVCALRITEKARARILKAGGEILTFDQLALRAPTGNKTVLMQGKRTAREAVKHFG  153

Query  231  PAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PAPGVPHSHTKP+VR+KGRKFERARG+R S GYK
Sbjct  154  PAPGVPHSHTKPFVRSKGRKFERARGRRRSCGYK  187



>ref|XP_011396696.1| 60S ribosomal protein L18-3 [Auxenochlorella protothecoides]
 gb|KFM23818.1| 60S ribosomal protein L18-3 [Auxenochlorella protothecoides]
Length=187

 Score =   219 bits (558),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT S FN VILKRLFMSK N+PPLSLS+L  FT+G+  KIAVLVGT+TDD+R +EV
Sbjct  35   FLVRRTESDFNKVILKRLFMSKVNRPPLSLSKLAKFTAGQPGKIAVLVGTVTDDIRLHEV  94

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P ++V ALR T+TARARI  AGGE LT DQLAL AP G NTVLLRGPKNSREAVKHFGPA
Sbjct  95   PKIRVAALRVTETARARIVAAGGEVLTLDQLALLAPTGSNTVLLRGPKNSREAVKHFGPA  154

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PGVP S TKPYVR+KGRKFERARG+R+SRGYK
Sbjct  155  PGVPGSSTKPYVRSKGRKFERARGRRSSRGYK  186


 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 7/50 (14%)
 Frame = -2

Query  688  MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSE  539
            MGIDL+AGG++ +  RTAPKS + Y+KLLVKLYRF        V+R +S+
Sbjct  1    MGIDLRAGGRNTKVHRTAPKSQNPYVKLLVKLYRFL-------VRRTESD  43



>ref|XP_011351645.1| PREDICTED: 60S ribosomal protein L18-like [Cerapachys biroi]
 gb|EZA61166.1| 60S ribosomal protein L18 [Cerapachys biroi]
Length=188

 Score =   219 bits (557),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 128/154 (83%), Gaps = 2/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAVLVGTITDDVRAY  412
            FL RRT SKFN +ILKRLFMSK + PP+SL+R++ F    G+E+ IAV+VGT+TDD R +
Sbjct  34   FLARRTNSKFNRIILKRLFMSKIHLPPISLARIVRFMKKPGRENCIAVIVGTVTDDSRIF  93

Query  411  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG  232
            E+P L +CALR T+ AR RI KAGGE +TFDQLALRAP G+ TVL++GP+ +RE+VKHFG
Sbjct  94   EIPKLTICALRVTEKARGRILKAGGEIITFDQLALRAPTGKRTVLMQGPRKARESVKHFG  153

Query  231  PAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
             APGVPHSHTKPYVR+KGRKFERARG+R S GYK
Sbjct  154  LAPGVPHSHTKPYVRSKGRKFERARGRRRSCGYK  187



>ref|XP_008546759.1| PREDICTED: 60S ribosomal protein L18 [Microplitis demolitor]
Length=188

 Score =   219 bits (557),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 126/154 (82%), Gaps = 2/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAVLVGTITDDVRAY  412
            FL RRTGSKFN +ILKRLFMS+ NKPP+SL+R++ F     +E+ IAV+VGT+TDD R +
Sbjct  34   FLARRTGSKFNKIILKRLFMSRINKPPISLARVVRFMKKPHRENCIAVIVGTVTDDARIF  93

Query  411  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG  232
            E P L VCALR T  AR RI KAGGE +TFD+LALR+P G  TVL++G +N+REAVKHFG
Sbjct  94   ECPKLTVCALRVTDKARGRILKAGGEVITFDELALRSPTGSKTVLMQGRRNAREAVKHFG  153

Query  231  PAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PAPGVPHSHTKP VR+KGRKFERARG+R S GYK
Sbjct  154  PAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  187



>ref|XP_004345091.2| ribosomal protein L18e [Capsaspora owczarzaki ATCC 30864]
Length=186

 Score =   218 bits (556),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 124/153 (81%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FL RRT S FN V+LKRLF S+ ++PPLSLS+L+  T G E   AV+VGT+TDD R + V
Sbjct  34   FLARRTDSPFNKVVLKRLFQSRIHRPPLSLSKLVRLTKGSEKLTAVVVGTVTDDERLHVV  93

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P L VCALRFT  ARARI KAGGE +TFDQLALR+P G+NT+LLRGP  SREAVKHFG A
Sbjct  94   PKLTVCALRFTAAARARILKAGGETITFDQLALRSPTGKNTLLLRGPVKSREAVKHFGAA  153

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVP S TKPYVR+KGRKFE+ARG+R SRGYKV
Sbjct  154  PGVPKSTTKPYVRSKGRKFEKARGRRASRGYKV  186



>gb|KJE95959.1| ribosomal protein L18e [Capsaspora owczarzaki ATCC 30864]
Length=209

 Score =   218 bits (556),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 124/153 (81%), Gaps = 0/153 (0%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FL RRT S FN V+LKRLF S+ ++PPLSLS+L+  T G E   AV+VGT+TDD R + V
Sbjct  57   FLARRTDSPFNKVVLKRLFQSRIHRPPLSLSKLVRLTKGSEKLTAVVVGTVTDDERLHVV  116

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            P L VCALRFT  ARARI KAGGE +TFDQLALR+P G+NT+LLRGP  SREAVKHFG A
Sbjct  117  PKLTVCALRFTAAARARILKAGGETITFDQLALRSPTGKNTLLLRGPVKSREAVKHFGAA  176

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVP S TKPYVR+KGRKFE+ARG+R SRGYKV
Sbjct  177  PGVPKSTTKPYVRSKGRKFEKARGRRASRGYKV  209



>gb|AAN73381.1| ribosomal protein L18 [Branchiostoma lanceolatum]
Length=188

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 129/154 (84%), Gaps = 2/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAVLVGTITDDVRAY  412
            FL RRT +KFN V+L+RLFMS+TN+PP+S++RLI      G+E K AV+VGTITDDVR +
Sbjct  34   FLARRTNAKFNQVVLERLFMSRTNRPPMSIARLIRLMKKPGREGKTAVVVGTITDDVRIF  93

Query  411  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG  232
            E+P LK+C LR T+ ARA+I KAGGE +TFDQLALR+P G+NTVL++G + +RE  +H+G
Sbjct  94   EIPKLKICCLRVTEGARAKILKAGGEIITFDQLALRSPKGKNTVLIQGQRRARETCRHWG  153

Query  231  PAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PAPGVPHSHTKP+VR+KGRKFERARG+R S GYK
Sbjct  154  PAPGVPHSHTKPFVRSKGRKFERARGRRKSCGYK  187



>ref|XP_008201914.1| PREDICTED: 60S ribosomal protein L18 [Nasonia vitripennis]
Length=188

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 2/154 (1%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAVLVGTITDDVRAY  412
            FL RRT SKFN +ILKRLFMS+ ++PP+SL+R+  F    G+E+ IAV+VGT+TDD R +
Sbjct  34   FLARRTNSKFNKIILKRLFMSRIHRPPISLARVTRFMKKPGRENCIAVIVGTVTDDARIF  93

Query  411  EVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG  232
            EVP L VCALR T+ AR RI KAGGE +TFDQLAL++P G+ TVL++GP+  REAVKHFG
Sbjct  94   EVPKLTVCALRVTEKARGRILKAGGEIITFDQLALKSPTGRKTVLIQGPRKGREAVKHFG  153

Query  231  PAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  130
            PAPGVPHSHTKP VR+KGRKFERARG+R S GYK
Sbjct  154  PAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  187



>ref|XP_002506220.1| ribosomal protein L18 [Micromonas sp. RCC299]
 gb|ACO67478.1| ribosomal protein L18 [Micromonas sp. RCC299]
Length=386

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 127/153 (83%), Gaps = 3/153 (2%)
 Frame = -3

Query  585  FLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEV  406
            FLVRRT SK N  ILKRLFMSK N+PPLSLS+L  F   K  +I+ +VGTITDD R +EV
Sbjct  237  FLVRRTDSKVNETILKRLFMSKINRPPLSLSKLAKFA--KPGQISAVVGTITDDARMFEV  294

Query  405  PALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPA  226
            PAL+VCALRFT+TARARI KAGGEC+TFDQLAL+AP G+N  LLRGPK+ REAVKHFG A
Sbjct  295  PALRVCALRFTETARARIVKAGGECITFDQLALQAPTGENVCLLRGPKSHREAVKHFG-A  353

Query  225  PGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  127
            PGVP SH KPYVR KGRKFE+ARG+R SRGYK 
Sbjct  354  PGVPGSHAKPYVRHKGRKFEKARGRRKSRGYKA  386


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 7/53 (13%)
 Frame = -2

Query  691  TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFFGEEDRKQVQRCDSEAS  533
            + GID++AGG++K+  RTAPKS++VYLKLLVKLYRF        V+R DS+ +
Sbjct  202  SQGIDIEAGGRNKKKSRTAPKSENVYLKLLVKLYRFL-------VRRTDSKVN  247



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1246782646395