BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF024K05

Length=692
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHN33816.1|  ATP-dependent zinc metalloprotease FTSH 1, chloro...    402   9e-138   Glycine soja [wild soybean]
emb|CBI18876.3|  unnamed protein product                                405   3e-136   Vitis vinifera
ref|NP_001183829.1|  uncharacterized protein LOC100502422               400   6e-135   Zea mays [maize]
gb|ACN35033.1|  unknown                                                 399   7e-135   Zea mays [maize]
ref|XP_008452941.1|  PREDICTED: ATP-dependent zinc metalloproteas...    407   8e-135   Cucumis melo [Oriental melon]
ref|XP_006656509.1|  PREDICTED: ATP-dependent zinc metalloproteas...    399   3e-134   Oryza brachyantha
emb|CAN74077.1|  hypothetical protein VITISV_000978                     404   4e-134   Vitis vinifera
ref|XP_004500893.1|  PREDICTED: ATP-dependent zinc metalloproteas...    405   6e-134   Cicer arietinum [garbanzo]
dbj|BAJ85305.1|  predicted protein                                      389   8e-134   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004966506.1|  PREDICTED: ATP-dependent zinc metalloproteas...    404   1e-133   Setaria italica
ref|XP_007136141.1|  hypothetical protein PHAVU_009G021400g             404   1e-133   Phaseolus vulgaris [French bean]
gb|EEC81336.1|  hypothetical protein OsI_24516                          401   3e-133   Oryza sativa Indica Group [Indian rice]
ref|XP_002285925.1|  PREDICTED: ATP-dependent zinc metalloproteas...    403   3e-133   Vitis vinifera
ref|XP_003527434.1|  PREDICTED: ATP-dependent zinc metalloproteas...    402   4e-133   Glycine max [soybeans]
ref|XP_004145531.1|  PREDICTED: ATP-dependent zinc metalloproteas...    402   7e-133   Cucumis sativus [cucumbers]
ref|XP_010242853.1|  PREDICTED: ATP-dependent zinc metalloproteas...    403   7e-133   Nelumbo nucifera [Indian lotus]
gb|AFW75733.1|  hypothetical protein ZEAMMB73_601488                    402   8e-133   
gb|KDP36832.1|  hypothetical protein JCGZ_08123                         402   8e-133   Jatropha curcas
ref|XP_011101039.1|  PREDICTED: ATP-dependent zinc metalloproteas...    402   1e-132   Sesamum indicum [beniseed]
ref|XP_011074733.1|  PREDICTED: ATP-dependent zinc metalloproteas...    401   2e-132   Sesamum indicum [beniseed]
ref|XP_003523186.1|  PREDICTED: ATP-dependent zinc metalloproteas...    401   2e-132   
ref|XP_006473758.1|  PREDICTED: ATP-dependent zinc metalloproteas...    401   3e-132   Citrus sinensis [apfelsine]
ref|XP_006435323.1|  hypothetical protein CICLE_v10000422mg             401   3e-132   Citrus clementina [clementine]
ref|NP_001058625.1|  Os06g0725900                                       399   1e-131   
gb|EAZ38336.1|  hypothetical protein OsJ_22711                          398   1e-131   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010527682.1|  PREDICTED: ATP-dependent zinc metalloproteas...    399   2e-131   Tarenaya hassleriana [spider flower]
ref|XP_010060660.1|  PREDICTED: ATP-dependent zinc metalloproteas...    399   2e-131   Eucalyptus grandis [rose gum]
ref|XP_010094593.1|  ATP-dependent zinc metalloprotease FTSH            397   6e-131   Morus notabilis
ref|XP_009777632.1|  PREDICTED: ATP-dependent zinc metalloproteas...    397   8e-131   Nicotiana sylvestris
ref|XP_011041264.1|  PREDICTED: ATP-dependent zinc metalloproteas...    397   9e-131   Populus euphratica
ref|XP_006342112.1|  PREDICTED: ATP-dependent zinc metalloproteas...    397   1e-130   Solanum tuberosum [potatoes]
ref|XP_011034903.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    396   1e-130   Populus euphratica
ref|XP_002301927.1|  Cell division protein ftsH                         396   1e-130   Populus trichocarpa [western balsam poplar]
emb|CDP07308.1|  unnamed protein product                                396   2e-130   Coffea canephora [robusta coffee]
emb|CDX96068.1|  BnaA07g26630D                                          395   3e-130   
ref|XP_007017987.1|  FtsH extracellular protease family isoform 1       395   4e-130   
ref|XP_009395377.1|  PREDICTED: ATP-dependent zinc metalloproteas...    395   4e-130   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG14732.1|  ATP-dependent zinc metalloprotease FTSH, chloropl...    395   4e-130   Gossypium arboreum [tree cotton]
ref|XP_009105314.1|  PREDICTED: ATP-dependent zinc metalloproteas...    395   5e-130   Brassica rapa
emb|CDY01840.1|  BnaC06g28800D                                          395   6e-130   
ref|XP_002894238.1|  hypothetical protein ARALYDRAFT_891950             394   1e-129   Arabidopsis lyrata subsp. lyrata
ref|XP_010941398.1|  PREDICTED: ATP-dependent zinc metalloproteas...    394   1e-129   Elaeis guineensis
gb|EMS62975.1|  ATP-dependent zinc metalloprotease FTSH 1, chloro...    387   2e-129   Triticum urartu
ref|XP_009418681.1|  PREDICTED: ATP-dependent zinc metalloproteas...    394   2e-129   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010500575.1|  PREDICTED: ATP-dependent zinc metalloproteas...    394   2e-129   Camelina sativa [gold-of-pleasure]
ref|XP_010479476.1|  PREDICTED: ATP-dependent zinc metalloproteas...    394   2e-129   Camelina sativa [gold-of-pleasure]
ref|XP_006306893.1|  hypothetical protein CARUB_v10008446mg             394   2e-129   Capsella rubella
ref|XP_010479477.1|  PREDICTED: ATP-dependent zinc metalloproteas...    394   3e-129   Camelina sativa [gold-of-pleasure]
ref|XP_006391231.1|  hypothetical protein EUTSA_v10018191mg             394   3e-129   Eutrema salsugineum [saltwater cress]
ref|NP_564563.1|  ATP-dependent zinc metalloprotease FTSH 1             393   3e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002306970.2|  Cell division protein ftsH                         392   6e-129   Populus trichocarpa [western balsam poplar]
ref|XP_008221155.1|  PREDICTED: ATP-dependent zinc metalloproteas...    392   8e-129   Prunus mume [ume]
ref|XP_007221904.1|  hypothetical protein PRUPE_ppa002083mg             392   8e-129   Prunus persica
ref|XP_006828956.1|  hypothetical protein AMTR_s00001p00232760          392   9e-129   Amborella trichopoda
ref|XP_008812082.1|  PREDICTED: ATP-dependent zinc metalloproteas...    391   2e-128   Phoenix dactylifera
ref|XP_003563253.1|  PREDICTED: ATP-dependent zinc metalloproteas...    389   7e-128   Brachypodium distachyon [annual false brome]
ref|XP_004291222.1|  PREDICTED: ATP-dependent zinc metalloproteas...    387   4e-127   Fragaria vesca subsp. vesca
gb|EPS73399.1|  precursor of protein cell division protease ftsh-...    386   9e-127   Genlisea aurea
ref|XP_009618840.1|  PREDICTED: ATP-dependent zinc metalloproteas...    386   2e-126   Nicotiana tomentosiformis
ref|NP_001234196.1|  FtsH-like protein precursor                        386   2e-126   
gb|EMT09942.1|  Cell division protease ftsH-like protein, chlorop...    384   3e-126   
ref|XP_009767982.1|  PREDICTED: ATP-dependent zinc metalloproteas...    385   5e-126   Nicotiana sylvestris
ref|XP_009606853.1|  PREDICTED: ATP-dependent zinc metalloproteas...    385   6e-126   Nicotiana tomentosiformis
emb|CAA68141.1|  chloroplast FtsH protease                              384   6e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008377091.1|  PREDICTED: ATP-dependent zinc metalloproteas...    384   8e-126   
sp|O82150.2|FTSH_TOBAC  RecName: Full=ATP-dependent zinc metallop...    383   3e-125   Nicotiana tabacum [American tobacco]
ref|XP_009334277.1|  PREDICTED: ATP-dependent zinc metalloproteas...    383   4e-125   Pyrus x bretschneideri [bai li]
gb|KEH36287.1|  ATP-dependent zinc metalloprotease FTSH protein         382   5e-125   Medicago truncatula
gb|KJB14315.1|  hypothetical protein B456_002G118800                    381   9e-125   Gossypium raimondii
gb|KHG10496.1|  ATP-dependent zinc metalloprotease FTSH, chloropl...    381   1e-124   Gossypium arboreum [tree cotton]
ref|XP_009334282.1|  PREDICTED: ATP-dependent zinc metalloproteas...    380   3e-124   
gb|EYU36827.1|  hypothetical protein MIMGU_mgv1a002176mg                376   9e-123   Erythranthe guttata [common monkey flower]
sp|Q9BAE0.1|FTSH_MEDSA  RecName: Full=ATP-dependent zinc metallop...    375   2e-122   Medicago sativa [alfalfa]
gb|KEH36288.1|  ATP-dependent zinc metalloprotease FTSH protein         363   2e-120   Medicago truncatula
gb|KFK31340.1|  hypothetical protein AALP_AA6G099600                    367   3e-119   Arabis alpina [alpine rockcress]
dbj|BAH20236.1|  AT5G42270                                              360   6e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002960384.1|  hypothetical protein SELMODRAFT_139726             363   9e-119   
ref|XP_010692838.1|  PREDICTED: ATP-dependent zinc metalloproteas...    364   5e-118   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006279579.1|  hypothetical protein CARUB_v10025980mg             364   5e-118   Capsella rubella
ref|XP_010494162.1|  PREDICTED: ATP-dependent zinc metalloproteas...    364   6e-118   Camelina sativa [gold-of-pleasure]
ref|XP_010442152.1|  PREDICTED: ATP-dependent zinc metalloproteas...    363   1e-117   Camelina sativa [gold-of-pleasure]
ref|NP_568604.1|  ATP-dependent zinc metalloprotease FTSH 5             362   2e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865544.1|  hypothetical protein ARALYDRAFT_494803             362   2e-117   
ref|XP_006409314.1|  hypothetical protein EUTSA_v10022579mg             362   2e-117   Eutrema salsugineum [saltwater cress]
dbj|BAN33747.1|  ATP-dependent metalloprotease FtsH                     360   2e-116   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_010482002.1|  PREDICTED: ATP-dependent zinc metalloproteas...    356   5e-115   Camelina sativa [gold-of-pleasure]
sp|Q39444.1|FTSH_CAPAN  RecName: Full=ATP-dependent zinc metallop...    353   3e-114   Capsicum annuum
emb|CAA73318.1|  ATPase                                                 349   4e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001760664.1|  predicted protein                                  344   6e-111   
ref|XP_001753657.1|  predicted protein                                  342   5e-110   
gb|AIS72760.1|  ATP-dependent zinc metalloprotease chloroplastic-...    326   2e-109   Rhizophora apiculata
gb|KJB14314.1|  hypothetical protein B456_002G118800                    334   1e-106   Gossypium raimondii
ref|XP_002510649.1|  Cell division protease ftsH, putative              331   1e-105   
ref|XP_005650371.1|  membrane AAA-metalloprotease                       296   8e-92    Coccomyxa subellipsoidea C-169
gb|KJB57987.1|  hypothetical protein B456_009G188700                    295   2e-91    Gossypium raimondii
ref|XP_007510744.1|  cell division protein FtsH2                        294   4e-91    Bathycoccus prasinos
gb|KIY93255.1|  cell division protease FtsH                             285   4e-89    Monoraphidium neglectum
ref|WP_025961749.1|  hypothetical protein                               273   9e-89    
dbj|BAH20250.1|  AT5G42270                                              273   1e-88    Arabidopsis thaliana [mouse-ear cress]
ref|WP_025929131.1|  hypothetical protein                               273   3e-88    
gb|KIZ03250.1|  cell division protease FtsH                             286   5e-88    Monoraphidium neglectum
ref|XP_002948337.1|  hypothetical protein VOLCADRAFT_80122              286   8e-88    Volvox carteri f. nagariensis
ref|WP_006518079.1|  membrane protease FtsH catalytic subunit           281   3e-87    Leptolyngbya sp. PCC 7375
ref|XP_001690889.1|  membrane AAA-metalloprotease                       284   6e-87    Chlamydomonas reinhardtii
ref|WP_023072541.1|  membrane protease catalytic subunit                281   8e-87    Leptolyngbya sp. Heron Island J
ref|WP_029963924.1|  cell division protein FtsH                         272   1e-86    
ref|WP_025947145.1|  cell division protein FtsH                         272   2e-86    
ref|XP_002505995.1|  hypothetical protein MICPUN_106506                 280   9e-86    Micromonas commoda
ref|XP_003057154.1|  predicted protein                                  280   2e-85    Micromonas pusilla CCMP1545
ref|WP_025970576.1|  cell division protein FtsH                         270   3e-85    
ref|WP_044452063.1|  cell division protein FtsH                         269   9e-85    Mastigocladus laminosus
ref|WP_025954333.1|  cell division protein FtsH                         270   1e-84    
ref|WP_025971093.1|  cell division protein FtsH                         270   2e-84    
ref|WP_006911156.1|  cell division protein FtsH                         273   9e-84    Cyanobium sp. PCC 7001
gb|KGF94553.1|  cell division protein FtsH2                             271   1e-83    Prochlorococcus marinus str. MIT 9201
ref|WP_035992112.1|  cell division protein FtsH                         272   1e-83    Leptolyngbya sp. KIOST-1
ref|WP_025958220.1|  cell division protein FtsH                         270   2e-83    
ref|WP_009455956.1|  MULTISPECIES: cell division protein FtsH           271   2e-83    Fischerella thermalis
ref|WP_025944375.1|  cell division protein FtsH                         271   3e-83    
ref|WP_017297226.1|  cell division protein FtsH                         271   3e-83    Nodosilinea nodulosa
ref|WP_032522853.1|  cell division protein FtsH                         271   3e-83    Prochlorococcus marinus
gb|KGG03814.1|  Cell division protein FtsH                              270   4e-83    Prochlorococcus marinus str. MIT 9321
ref|WP_044106285.1|  cell division protein FtsH                         271   5e-83    cyanobacterium endosymbiont of Epithemia turgida
ref|WP_032519670.1|  cell division protein FtsH                         271   5e-83    Prochlorococcus marinus
gb|KGG06312.1|  Cell division protein FtsH                              270   5e-83    Prochlorococcus marinus str. MIT 9322
ref|WP_025951376.1|  cell division protein FtsH                         271   5e-83    
ref|WP_032515715.1|  cell division protein FtsH                         271   5e-83    Prochlorococcus marinus
ref|WP_025971671.1|  cell division protein FtsH                         271   6e-83    
ref|WP_015191439.1|  ATP-dependent metalloprotease FtsH                 271   6e-83    Stanieria cyanosphaera
ref|WP_025969610.1|  cell division protein FtsH                         271   6e-83    
ref|WP_025964562.1|  cell division protein FtsH                         271   6e-83    
ref|WP_025922112.1|  cell division protein FtsH                         271   6e-83    
ref|WP_025959316.1|  cell division protein FtsH                         271   6e-83    
ref|WP_025980194.1|  cell division protein FtsH                         270   6e-83    
ref|WP_025935637.1|  MULTISPECIES: cell division protein FtsH           270   6e-83    
ref|WP_025892538.1|  cell division protein FtsH                         270   6e-83    
ref|WP_011862269.1|  cell division protein FtsH                         270   6e-83    Prochlorococcus marinus
ref|WP_025900256.1|  MULTISPECIES: cell division protein FtsH           270   6e-83    
ref|WP_025890345.1|  MULTISPECIES: cell division protein FtsH           270   7e-83    Prochlorococcus sp. HOT208_60m_808M21
ref|WP_025967396.1|  cell division protein FtsH                         270   8e-83    
ref|WP_025939914.1|  MULTISPECIES: cell division protein FtsH           270   8e-83    
ref|WP_025924120.1|  MULTISPECIES: cell division protein FtsH           270   8e-83    Prochlorococcus marinus
ref|WP_032517345.1|  cell division protein FtsH                         270   8e-83    Prochlorococcus marinus
ref|WP_036973151.1|  cell division protein FtsH                         264   1e-82    Prochlorococcus sp. MIT 0703
gb|ABX08179.1|  cell division protein FtsH2                             270   1e-82    Prochlorococcus marinus str. MIT 9211
gb|KGG30054.1|  cell division protein FtsH2                             263   1e-82    Prochlorococcus sp. MIT 0703
ref|WP_017320405.1|  cell division protein FtsH                         270   1e-82    cyanobacterium PCC 7702
ref|WP_041391000.1|  cell division protein FtsH                         270   1e-82    Prochlorococcus marinus
gb|KGF88464.1|  cell division protein FtsH2                             269   1e-82    Prochlorococcus marinus str. GP2
ref|WP_025956453.1|  MULTISPECIES: cell division protein FtsH           270   1e-82    
ref|WP_017312914.1|  cell division protein FtsH                         270   2e-82    Fischerella sp. PCC 9339
ref|WP_012593655.1|  MULTISPECIES: cell division protein FtsH           269   2e-82    Cyanothece
ref|WP_025937982.1|  cell division protein FtsH                         269   2e-82    
ref|WP_025922823.1|  cell division protein FtsH                         269   2e-82    
ref|WP_025925903.1|  cell division protein FtsH                         269   2e-82    
ref|WP_016862523.1|  cell division protein FtsH                         269   2e-82    Fischerella muscicola
gb|AIQ94296.1|  Cell division protein FtsH                              269   2e-82    Prochlorococcus sp. MIT 0604
ref|WP_025979191.1|  cell division protein FtsH                         269   2e-82    
ref|WP_012007029.1|  cell division protein FtsH                         269   2e-82    Prochlorococcus marinus
ref|WP_025941250.1|  cell division protein FtsH                         269   2e-82    
ref|WP_042849723.1|  cell division protein FtsH                         269   2e-82    Prochlorococcus sp. MIT 0604
ref|WP_025937318.1|  cell division protein FtsH                         269   2e-82    
ref|WP_002806664.1|  cell division protein FtsH                         269   2e-82    Prochlorococcus marinus
ref|WP_011817719.1|  cell division protein FtsH                         269   2e-82    Prochlorococcus marinus
ref|WP_025933036.1|  cell division protein FtsH                         269   2e-82    
ref|WP_025971407.1|  cell division protein FtsH                         268   2e-82    
ref|WP_025921388.1|  MULTISPECIES: cell division protein FtsH           269   2e-82    
ref|WP_025914082.1|  cell division protein FtsH                         269   2e-82    
ref|WP_032523992.1|  cell division protein FtsH                         269   2e-82    Prochlorococcus marinus
ref|WP_026723275.1|  cell division protein FtsH                         269   3e-82    Hapalosiphonaceae
ref|WP_025965256.1|  cell division protein FtsH                         269   3e-82    Prochlorococcus sp. HOT208_60m_805A16
ref|WP_025929709.1|  cell division protein FtsH                         269   3e-82    
ref|WP_025981174.1|  cell division protein FtsH                         269   3e-82    
ref|WP_025925013.1|  MULTISPECIES: cell division protein FtsH           269   3e-82    
ref|WP_010871638.1|  cell division protein FtsH                         268   3e-82    Synechocystis
dbj|GAL91410.1|  cell division protein FtsH                             268   4e-82    Microcystis aeruginosa NIES-44
ref|WP_015188582.1|  membrane protease FtsH catalytic subunit           268   4e-82    Cyanobacteria [blue-green bacteria]
ref|WP_008275101.1|  cell division protein FtsH                         268   4e-82    Cyanothece sp. CCY0110
ref|XP_011396167.1|  ATP-dependent zinc metalloprotease FTSH 5, c...    271   4e-82    Auxenochlorella protothecoides
ref|WP_016867387.1|  cell division protein FtsH                         268   4e-82    Fischerella muscicola
ref|WP_011375794.1|  cell division protein FtsH                         268   4e-82    Prochlorococcus marinus
ref|WP_036901462.1|  cell division protein FtsH                         268   5e-82    Prochlorococcus sp. MIT 0601
ref|WP_002784350.1|  Cell division protein FtsH; ATP-dependent zi...    268   5e-82    Microcystis aeruginosa
ref|WP_028953545.1|  cell division protein FtsH                         268   6e-82    Synechococcus sp. CC9616
ref|WP_002797753.1|  cell division protein FtsH                         268   6e-82    Microcystis aeruginosa
ref|WP_002763074.1|  MULTISPECIES: cell division protein FtsH           268   6e-82    Microcystis
ref|WP_032514590.1|  cell division protein FtsH                         268   7e-82    Prochlorococcus marinus
ref|WP_002801795.1|  cell division protein FtsH                         268   8e-82    Microcystis aeruginosa
ref|WP_002771354.1|  cell division protein FtsH                         268   8e-82    Microcystis aeruginosa
ref|WP_016876546.1|  cell division protein FtsH                         267   1e-81    Chlorogloeopsis fritschii
ref|WP_006453661.1|  cell division protein FtsH                         267   1e-81    Synechococcus sp. PCC 7335
ref|WP_002793446.1|  cell division protein FtsH                         267   1e-81    Microcystis aeruginosa
ref|WP_015220601.1|  membrane protease FtsH catalytic subunit           267   1e-81    Cyanobacterium aponinum
ref|WP_002737367.1|  ATP-dependent zinc metalloprotease FtsH 3          267   1e-81    Microcystis aeruginosa
ref|WP_012264056.1|  cell division protein FtsH                         267   1e-81    Microcystis aeruginosa
ref|WP_002742170.1|  cell division protein FtsH                         267   1e-81    Microcystis
ref|WP_017303138.1|  cell division protein FtsH                         267   1e-81    Spirulina subsalsa
ref|WP_013320241.1|  cell division protein FtsH                         267   1e-81    Cyanothece sp. PCC 7822
ref|WP_015109466.1|  ATP-dependent metalloprotease FtsH                 267   1e-81    Cyanobacteria [blue-green bacteria]
ref|WP_028949001.1|  cell division protein FtsH                         267   2e-81    Synechocystis sp. PCC 6714
ref|WP_006102026.1|  cell division protein FtsH                         266   2e-81    Coleofasciculus chthonoplastes
ref|WP_035832496.1|  cell division protein FtsH                         266   2e-81    
ref|WP_009545257.1|  MULTISPECIES: cell division protein FtsH           266   2e-81    Cyanothece
ref|WP_009556886.1|  ATP-dependent metalloprotease FtsH                 267   2e-81    Oscillatoriales cyanobacterium JSC-12
gb|ADF81075.1|  FtsH                                                    254   2e-81    Corallina officinalis
ref|WP_017293936.1|  cell division protein FtsH                         266   2e-81    Geminocystis herdmanii
ref|WP_019474071.1|  MULTISPECIES: cell division protein FtsH           266   3e-81    
ref|WP_026730933.1|  cell division protein FtsH                         266   3e-81    Fischerella sp. PCC 9605
ref|WP_006511599.1|  ATP-dependent metalloprotease FtsH                 266   3e-81    Xenococcus sp. PCC 7305
ref|WP_019476442.1|  cell division protein FtsH                         266   3e-81    
ref|WP_039726378.1|  MULTISPECIES: cell division protein FtsH           266   3e-81    Lyngbya confervoides
ref|WP_019478058.1|  cell division protein FtsH                         266   4e-81    
ref|WP_039716361.1|  cell division protein FtsH                         266   4e-81    
ref|WP_032527521.1|  cell division protein FtsH                         266   4e-81    Prochlorococcus marinus
ref|WP_019477234.1|  cell division protein FtsH                         266   4e-81    
ref|WP_038542994.1|  cell division protein FtsH                         266   5e-81    Synechococcus sp. KORDI-100
ref|WP_036922150.1|  cell division protein FtsH                         266   5e-81    
ref|WP_011936606.1|  cell division protein FtsH                         265   5e-81    
ref|XP_001419590.1|  predicted protein                                  266   5e-81    Ostreococcus lucimarinus CCE9901
ref|WP_015156116.1|  membrane protease FtsH catalytic subunit           265   6e-81    Cyanobacteria [blue-green bacteria]
ref|WP_027255466.1|  cell division protein FtsH                         265   7e-81    Planktothrix agardhii
ref|WP_015955558.1|  cell division protein FtsH                         265   8e-81    Cyanothece sp. PCC 7424
ref|WP_026794256.1|  MULTISPECIES: cell division protein FtsH           265   8e-81    Planktothrix
ref|WP_026097926.1|  cell division protein FtsH                         265   8e-81    Geitlerinema sp. PCC 7105
ref|WP_007100703.1|  cell division protein FtsH                         265   9e-81    Synechococcus sp. RS9917
ref|WP_042152619.1|  cell division protein FtsH                         265   9e-81    Planktothrix agardhii
ref|WP_027249137.1|  cell division protein FtsH                         265   1e-80    Planktothrix agardhii
ref|WP_011055986.1|  cell division protein FtsH                         264   1e-80    Thermosynechococcus
ref|WP_024125602.1|  ATP-dependent metalloprotease FtsH3                264   1e-80    Thermosynechococcus sp. NK55a
gb|KIE06858.1|  cell division protein FtsH                              264   1e-80    Tolypothrix bouteillei VB521301
ref|WP_011826974.1|  cell division protein FtsH                         264   1e-80    Prochlorococcus sp. MIT 1306
emb|CCH67048.1|  Cell division protein FtsH                             260   2e-80    Richelia intracellularis HH01
ref|WP_036913475.1|  MULTISPECIES: cell division protein FtsH           264   2e-80    Prochlorococcus
ref|WP_011243527.1|  MULTISPECIES: cell division protein FtsH           264   2e-80    Synechococcus
ref|WP_038331075.1|  cell division protein FtsH                         264   2e-80    filamentous cyanobacterium ESFC-1
ref|WP_006042287.1|  cell division protein FtsH                         264   2e-80    Synechococcus sp. WH 7805
ref|WP_026786321.1|  cell division protein FtsH                         264   2e-80    Planktothrix rubescens
ref|WP_017715041.1|  cell division protein FtsH                         264   2e-80    Oscillatoria sp. PCC 10802
ref|WP_011932280.1|  cell division protein FtsH                         264   2e-80    Synechococcus sp. WH 7803
ref|WP_019506377.1|  cell division protein FtsH                         264   2e-80    Pleurocapsa sp. PCC 7319
ref|WP_015204207.1|  membrane protease FtsH catalytic subunit           263   3e-80    Crinalium epipsammum
ref|WP_017291153.1|  cell division protein FtsH                         263   3e-80    Leptolyngbya boryana
ref|WP_012305681.1|  MULTISPECIES: cell division protein FtsH           264   3e-80    Synechococcus
ref|WP_015180805.1|  ATP-dependent metalloprotease FtsH                 263   3e-80    Microcoleus sp. PCC 7113
ref|WP_011131165.1|  cell division protein FtsH                         263   3e-80    Prochlorococcus marinus
ref|WP_015224048.1|  membrane protease FtsH catalytic subunit           263   4e-80    
ref|WP_006623490.1|  cell division protein FtsH                         263   4e-80    
ref|WP_022606782.1|  ATP-dependent metalloprotease FtsH                 263   5e-80    Rubidibacter lacunae
ref|WP_011819579.1|  cell division protein FtsH                         263   5e-80    Prochlorococcus marinus
ref|WP_006669335.1|  MULTISPECIES: cell division protein FtsH           263   5e-80    Arthrospira
ref|WP_009630197.1|  ATP-dependent metalloprotease FtsH                 263   5e-80    Synechocystis sp. PCC 7509
ref|WP_006618677.1|  FtsH peptidase                                     263   5e-80    Arthrospira platensis
emb|CDN17247.1|  Cell division protein FtsH                             262   6e-80    Richelia intracellularis
gb|KGG16707.1|  Cell division protein FtsH                              262   6e-80    Prochlorococcus sp. MIT 0602
ref|WP_011124410.1|  cell division protein FtsH                         262   6e-80    Prochlorococcus marinus
ref|WP_017743955.1|  cell division protein FtsH                         263   7e-80    Scytonema hofmannii
ref|WP_036916506.1|  MULTISPECIES: cell division protein FtsH           263   7e-80    Prochlorococcus
ref|WP_037224718.1|  cell division protein FtsH                         262   8e-80    
ref|WP_024546675.1|  cell division protein FtsH                         263   8e-80    Synechococcus
ref|WP_036001623.1|  cell division protein FtsH                         262   9e-80    [Leptolyngbya] sp. JSC-1
ref|WP_035155002.1|  cell division protein FtsH                         262   9e-80    Calothrix sp. 336/3
ref|WP_008316727.1|  ATP-dependent metalloprotease FtsH                 262   1e-79    Leptolyngbya sp. PCC 6406
ref|WP_015143924.1|  ATP-dependent metalloprotease FtsH                 262   1e-79    Pleurocapsa minor
ref|WP_006172329.1|  cell division protein FtsH                         262   1e-79    Synechococcus sp. WH 5701
ref|WP_015116388.1|  membrane protease FtsH catalytic subunit           262   1e-79    Rivularia sp. PCC 7116
ref|WP_036892144.1|  MULTISPECIES: cell division protein FtsH           262   1e-79    Prochlorococcus
ref|WP_015177320.1|  membrane protease FtsH catalytic subunit           262   1e-79    Oscillatoria nigro-viridis
ref|WP_015173051.1|  membrane protease FtsH catalytic subunit           262   1e-79    Geitlerinema sp. PCC 7407
ref|WP_015133797.1|  membrane protease FtsH catalytic subunit           262   1e-79    Leptolyngbya sp. PCC 7376
ref|WP_028090468.1|  cell division protein FtsH                         261   1e-79    Dolichospermum circinale
ref|WP_009341877.1|  cell division protein FtsH                         261   2e-79    Aphanizomenonaceae
ref|WP_040054828.1|  cell division protein FtsH                         261   2e-79    
ref|WP_011131865.1|  cell division protein FtsH                         261   2e-79    Prochlorococcus marinus
ref|WP_028082599.1|  cell division protein FtsH                         261   2e-79    Dolichospermum circinale
ref|WP_006278775.1|  cell division protein FtsH                         261   2e-79    Cylindrospermopsis
ref|WP_015162315.1|  ATP-dependent metalloprotease FtsH                 261   2e-79    Chamaesiphon minutus
ref|WP_026099187.1|  cell division protein FtsH                         261   2e-79    Prochlorothrix hollandica
ref|WP_015079544.1|  ATP-dependent metalloprotease HflB (FtsH)          261   3e-79    Anabaena sp. 90
ref|WP_010311939.1|  cell division protein FtsH                         261   3e-79    Synechococcus sp. CB0101
ref|WP_015227551.1|  membrane protease FtsH catalytic subunit           261   3e-79    
ref|WP_008230065.1|  Cell division protein FtsH                         261   3e-79    
ref|WP_043694696.1|  cell division protein FtsH                         261   3e-79    
ref|WP_015139560.1|  ATP-dependent metalloprotease FtsH                 261   4e-79    
ref|WP_012411183.1|  cell division protein FtsH                         261   4e-79    
ref|WP_036486108.1|  cell division protein FtsH                         261   4e-79    
ref|WP_040935720.1|  cell division protein FtsH                         260   4e-79    
gb|EGJ33321.1|  membrane protease FtsH catalytic subunit                260   4e-79    
ref|WP_036531425.1|  cell division protein FtsH                         260   4e-79    
ref|WP_012162910.1|  cell division protein FtsH                         260   5e-79    
ref|WP_027401619.1|  cell division protein FtsH                         260   5e-79    
ref|WP_044492620.1|  cell division protein FtsH                         260   5e-79    
ref|WP_027841867.1|  cell division protein FtsH                         260   5e-79    
ref|WP_012954347.1|  cell division protein FtsH                         260   6e-79    
ref|WP_007356988.1|  MULTISPECIES: cell division protein FtsH           260   7e-79    
ref|WP_019494535.1|  cell division protein FtsH                         260   7e-79    
ref|WP_006633639.1|  cell division protein FtsH                         259   8e-79    
ref|WP_010995433.1|  cell division protein FtsH                         259   8e-79    
ref|WP_006853632.1|  cell division protein FtsH                         259   9e-79    
ref|WP_015230925.1|  ATP-dependent metalloprotease FtsH                 259   1e-78    
ref|WP_015214216.1|  membrane protease FtsH catalytic subunit           259   1e-78    
ref|WP_029633975.1|  cell division protein FtsH [                       259   1e-78    
ref|WP_015114520.1|  membrane protease FtsH catalytic subunit           259   1e-78    
ref|WP_015129349.1|  membrane protease FtsH catalytic subunit           259   1e-78    
ref|WP_011618327.1|  cell division protein FtsH                         259   1e-78    
ref|WP_013189950.1|  cell division protein FtsH                         259   2e-78    
ref|WP_016949229.1|  cell division protein FtsH                         259   2e-78    
ref|WP_015124055.1|  membrane protease FtsH catalytic subunit           259   2e-78    
ref|WP_007099803.1|  cell division protein FtsH                         259   2e-78    
ref|WP_039740989.1|  cell division protein FtsH                         258   2e-78    
ref|WP_011127179.1|  cell division protein FtsH                         258   2e-78    
gb|EHJ10086.1|  Cell division protein FtsH                              257   3e-78    
gb|AII47735.1|  cell division protein FtsH                              258   3e-78    
ref|WP_041036156.1|  cell division protein FtsH                         258   3e-78    
ref|WP_017315070.1|  cell division protein FtsH                         258   3e-78    
ref|WP_012627305.1|  cell division protein FtsH                         258   3e-78    
ref|WP_010314566.1|  cell division protein FtsH                         258   3e-78    
gb|AHF62715.1|  ATP-dependent metalloprotease FtsH                      258   4e-78    
ref|WP_038551333.1|  cell division protein FtsH                         258   4e-78    
ref|WP_011363329.1|  cell division protein FtsH                         258   4e-78    
ref|WP_011317448.1|  cell division protein FtsH                         258   5e-78    
gb|KIJ85386.1|  cell division protein FtsH                              257   6e-78    
ref|WP_006528450.1|  ATP-dependent metalloprotease FtsH                 257   6e-78    
ref|WP_021836615.1|  Cell division protein FtsH                         258   6e-78    
ref|WP_021830407.1|  Cell division protein FtsH                         257   6e-78    
ref|WP_011613138.1|  cell division protein FtsH                         257   7e-78    
gb|ADD94882.1|  FtsH peptidase                                          257   8e-78    
ref|WP_009782358.1|  cell division protein FtsH                         257   9e-78    
ref|WP_023067153.1|  ATP-dependent zinc metalloprotease FtsH 3          257   9e-78    
ref|WP_015146710.1|  membrane protease FtsH catalytic subunit           257   1e-77    
ref|WP_015197493.1|  membrane protease FtsH catalytic subunit           256   1e-77    
ref|WP_017653544.1|  cell division protein FtsH                         256   2e-77    
ref|WP_011360789.1|  cell division protein FtsH                         256   3e-77    
ref|WP_015208761.1|  membrane protease FtsH catalytic subunit           255   3e-77    
ref|WP_009788844.1|  cell division protein FtsH                         254   7e-77    
ref|WP_036906170.1|  cell division protein FtsH                         254   8e-77    
ref|WP_006198086.1|  cell division protein FtsH                         254   1e-76    
ref|WP_011294228.1|  cell division protein FtsH                         253   2e-76    
ref|WP_038651066.1|  cell division protein FtsH                         253   2e-76    
ref|WP_011823081.1|  cell division protein FtsH                         253   3e-76    
ref|WP_011141915.1|  cell division protein FtsH                         244   7e-73    
ref|YP_002049185.1|  cell division protein ftsH                         243   1e-72    
gb|ABH09265.1|  cell division protein                                   243   1e-72    
ref|XP_005713345.1|  cell division protein FtsH                         245   2e-72    
ref|WP_023174221.1|  ATP-dependent metalloprotease FtsH                 243   2e-72    
ref|WP_015167033.1|  ATP-dependent metalloprotease FtsH                 241   8e-72    
ref|WP_025953358.1|  hypothetical protein                               230   1e-71    
gb|EYU36826.1|  hypothetical protein MIMGU_mgv1a002176mg                241   2e-71    
ref|WP_015165890.1|  ATP-dependent metalloprotease FtsH                 239   6e-71    
gb|AFK49239.1|  unknown                                                 229   7e-71    
ref|XP_005834056.1|  hypothetical protein GUITHDRAFT_86435              237   1e-69    
ref|WP_019500986.1|  cell division protein FtsH                         235   2e-69    
ref|XP_005708438.1|  AAA-type ATPase                                    234   4e-68    
ref|WP_009628744.1|  membrane protease FtsH catalytic subunit           229   3e-67    
ref|WP_017324919.1|  hypothetical protein                               228   1e-66    
ref|XP_005538209.1|  cell division protein FtsH                         227   2e-65    
ref|WP_011431525.1|  cell division protein FtsH                         224   3e-65    
ref|WP_011432278.1|  cell division protein FtsH                         224   6e-65    
ref|WP_010468934.1|  cell division protein FtsH                         218   3e-63    
gb|ACV52574.1|  FtsH-like protein                                       206   8e-63    
ref|XP_002287516.1|  metalloprotease                                    216   1e-62    
ref|XP_005708136.1|  AAA-type ATPase                                    216   2e-61    
ref|XP_002177215.1|  predicted protein                                  213   9e-61    
gb|EJK55379.1|  hypothetical protein THAOC_24887                        211   5e-60    
ref|XP_002291485.1|  chloroplast ftsH                                   208   1e-59    
gb|KJB14313.1|  hypothetical protein B456_002G118800                    199   5e-56    
gb|EWM30233.1|  atp-dependent metalloprotease                           201   6e-56    
gb|AHJ28404.1|  Cell division protein FtsH                              196   6e-55    
ref|WP_006199059.1|  cell division protein FtsH                         196   1e-54    
ref|WP_044452899.1|  cell division protein FtsH                         190   2e-54    
ref|WP_015119379.1|  membrane protease FtsH catalytic subunit           194   6e-54    
ref|WP_018875886.1|  MULTISPECIES: ATP-dependent metalloprotease        193   1e-53    
ref|WP_018867786.1|  MULTISPECIES: ATP-dependent metalloprotease        193   1e-53    
ref|YP_009027610.1|  putative plastid division protein                  193   1e-53    
gb|AHB35104.1|  putative plastid division protein                       193   1e-53    
emb|CBN76650.1|  FtsH protease                                          194   1e-53    
ref|WP_018146241.1|  MULTISPECIES: ATP-dependent metalloprotease        192   3e-53    
ref|WP_018937957.1|  MULTISPECIES: ATP-dependent metalloprotease        192   3e-53    
ref|WP_019593923.1|  ATP-dependent metalloprotease                      192   4e-53    
ref|WP_017322954.1|  cell division protein FtsH                         191   4e-53    
ref|WP_009459923.1|  MULTISPECIES: cell division protein FtsH           191   4e-53    
ref|WP_036002156.1|  cell division protein FtsH                         186   5e-53    
ref|WP_016869882.1|  cell division protein FtsH                         191   5e-53    
dbj|BAP57909.1|  ATP-dependent metalloprotease FtsH                     191   5e-53    
ref|WP_015124159.1|  membrane protease FtsH catalytic subunit           191   5e-53    
ref|WP_035150451.1|  cell division protein FtsH                         191   6e-53    
ref|WP_042712540.1|  hypothetical protein                               180   6e-53    
ref|WP_016858941.1|  cell division protein FtsH                         191   7e-53    
ref|WP_018948798.1|  ATP-dependent metalloprotease                      191   8e-53    
ref|WP_039738012.1|  cell division protein FtsH                         191   8e-53    
ref|YP_007947857.1|  cell division protein                              191   9e-53    
ref|WP_015153530.1|  membrane protease FtsH catalytic subunit           190   1e-52    
gb|EAM48267.1|  Peptidase M41                                           179   1e-52    
ref|WP_013191839.1|  cell division protein FtsH                         190   1e-52    
ref|YP_537009.1|  cell division protein                                 190   1e-52    
gb|AIA21561.1|  putative plastid division protein                       190   1e-52    
ref|WP_018862431.1|  MULTISPECIES: ATP-dependent metalloprotease        191   1e-52    
emb|CCH67560.1|  Cell division protein FtsH                             186   1e-52    
ref|WP_026732891.1|  cell division protein FtsH                         190   1e-52    
ref|WP_026719681.1|  cell division protein FtsH                         190   1e-52    
ref|WP_015170903.1|  membrane protease FtsH catalytic subunit           190   2e-52    
ref|WP_027845285.1|  cell division protein FtsH                         190   2e-52    
ref|WP_011056581.1|  cell division protein FtsH                         190   2e-52    
ref|WP_021202559.1|  ATP-dependent metalloprotease                      184   2e-52    
ref|WP_038051416.1|  ATP-dependent metalloprotease                      190   2e-52    
ref|WP_012408087.1|  cell division protein FtsH                         190   2e-52    
ref|WP_018141827.1|  MULTISPECIES: ATP-dependent metalloprotease        190   2e-52    
gb|ADD96240.1|  ATP dependent metallopeptidase HflB                     180   2e-52    
ref|WP_016951384.1|  cell division protein FtsH                         189   3e-52    
ref|WP_022344010.1|  aTP-dependent metallopeptidase HflB subfamil...    189   3e-52    
ref|WP_029633486.1|  cell division protein FtsH [                       189   3e-52    
ref|WP_015216796.1|  membrane protease FtsH catalytic subunit           189   3e-52    
ref|WP_002682906.1|  ATP-dependent metalloprotease                      189   3e-52    
ref|WP_006456705.1|  cell division protein FtsH                         189   4e-52    
ref|WP_012408423.1|  cell division protein FtsH                         189   5e-52    
ref|YP_001293616.1|  cell division protein                              188   5e-52    
ref|WP_039716067.1|  cell division protein FtsH                         188   6e-52    
ref|WP_017312271.1|  cell division protein FtsH                         188   6e-52    
gb|KHD08639.1|  ATP-dependent metalloprotease                           188   6e-52    
ref|WP_012629618.1|  cell division protein FtsH                         188   6e-52    
ref|WP_010997786.1|  cell division protein FtsH                         188   7e-52    
ref|WP_017651155.1|  cell division protein FtsH                         188   9e-52    
ref|WP_006508907.1|  ATP-dependent metalloprotease FtsH                 188   9e-52    
ref|WP_018864965.1|  ATP-dependent metalloprotease                      188   1e-51    
ref|WP_041739648.1|  cell division protein FtsH                         187   1e-51    
ref|WP_019623587.1|  MULTISPECIES: ATP-dependent metalloprotease        188   1e-51    
ref|WP_016876491.1|  cell division protein FtsH                         187   1e-51    
ref|WP_015112002.1|  membrane protease FtsH catalytic subunit           187   1e-51    
gb|AFZ02140.1|  membrane protease FtsH catalytic subunit                187   1e-51    
ref|WP_024326958.1|  ATP-dependent metalloprotease                      187   1e-51    
ref|YP_007627352.1|  cell division protein                              187   1e-51    
ref|WP_031388311.1|  cell division protein FtsH                         187   1e-51    
ref|WP_019584275.1|  ATP-dependent metalloprotease                      187   1e-51    
gb|AFC39995.1|  cell division protein                                   187   1e-51    
gb|AIA21355.1|  putative plastid division protein                       187   2e-51    
ref|WP_037216619.1|  cell division protein FtsH                         187   2e-51    
ref|WP_011319922.1|  cell division protein FtsH                         187   2e-51    
gb|AFW93266.1|  ATP-dependent metallopeptidase                          186   2e-51    
ref|WP_036533052.1|  cell division protein FtsH                         187   2e-51    
emb|CDN10469.1|  Cell division protein FtsH                             187   2e-51    
ref|WP_029974924.1|  cell division protein FtsH                         177   2e-51    
ref|WP_018940736.1|  ATP-dependent metalloprotease                      187   2e-51    
ref|YP_008144816.1|  ATP-dependent zinc metalloprotease FtsH            186   3e-51    
ref|WP_012162627.1|  cell division protein FtsH                         187   3e-51    
ref|WP_041457570.1|  cell division protein FtsH                         186   3e-51    
ref|NP_053937.1|  cell division protein                                 186   3e-51    
ref|WP_017925965.1|  ATP-dependent metalloprotease                      187   3e-51    
ref|WP_009555904.1|  membrane protease FtsH catalytic subunit           186   3e-51    
ref|WP_019024747.1|  MULTISPECIES: ATP-dependent metalloprotease        187   3e-51    
ref|WP_012982116.1|  ATP-dependent metalloprotease                      186   3e-51    
ref|WP_017941358.1|  MULTISPECIES: ATP-dependent metalloprotease        187   3e-51    
ref|WP_018138282.1|  MULTISPECIES: ATP-dependent metalloprotease        186   3e-51    
ref|WP_015132046.1|  membrane protease FtsH catalytic subunit           186   3e-51    
ref|WP_025891584.1|  hypothetical protein                               177   3e-51    
ref|WP_022658404.1|  ATP-dependent metalloprotease                      187   3e-51    
ref|WP_026082835.1|  cell division protein FtsH                         186   4e-51    
ref|WP_015137807.1|  ATP-dependent metalloprotease FtsH                 186   4e-51    
ref|WP_023070843.1|  membrane protease catalytic subunit                186   4e-51    
ref|WP_025951531.1|  hypothetical protein                               177   4e-51    
ref|WP_015188757.1|  membrane protease FtsH catalytic subunit           186   4e-51    
ref|YP_009019579.1|  ftsH protease-like protein                         186   5e-51    
ref|WP_020990697.1|  ATP-dependent metallopeptidase HflB                186   5e-51    
ref|WP_019491912.1|  cell division protein FtsH                         186   5e-51    
ref|WP_009302174.1|  ATP-dependent metalloprotease                      186   5e-51    
ref|WP_019641895.1|  ATP-dependent metalloprotease                      186   6e-51    
gb|AJH65894.1|  ATP-dependent zinc metalloprotease FtsH                 186   6e-51    
ref|WP_023174351.1|  ATP-dependent metalloprotease FtsH                 186   6e-51    
ref|WP_017662490.1|  cell division protein FtsH                         186   6e-51    
ref|WP_028083738.1|  cell division protein FtsH                         186   7e-51    
gb|EKD74993.1|  hypothetical protein ACD_44C00263G0003                  186   7e-51    
emb|CCP10974.1|  cell division protease FtsH                            178   7e-51    
ref|WP_038395594.1|  ATP-dependent metalloprotease                      177   7e-51    
ref|WP_010477442.1|  cell division protein FtsH                         185   7e-51    
ref|WP_000629598.1|  hypothetical protein                               176   8e-51    
ref|WP_025280931.1|  MULTISPECIES: ATP-dependent metalloprotease        185   8e-51    
ref|WP_040355337.1|  ATP-dependent metalloprotease                      185   8e-51    
gb|EEV88713.1|  ATP-dependent metallopeptidase HflB                     185   9e-51    
ref|WP_006278637.1|  cell division protein FtsH                         185   9e-51    
ref|WP_028089678.1|  cell division protein FtsH                         185   1e-50    
emb|CCH65009.1|  Cell division protein FtsH                             184   1e-50    
ref|WP_008931990.1|  ATP-dependent metalloprotease                      185   1e-50    
ref|WP_018934759.1|  ATP-dependent metalloprotease                      185   1e-50    
ref|WP_044258630.1|  hypothetical protein                               184   1e-50    
ref|YP_063571.1|  cell division protein                                 184   1e-50    
ref|WP_017654114.1|  cell division protein FtsH                         184   1e-50    
ref|WP_029759589.1|  cell division protein FtsH                         173   1e-50    
ref|WP_042767692.1|  ATP-dependent metalloprotease                      177   1e-50    
ref|WP_042055247.1|  ATP-dependent metalloprotease                      176   1e-50    
gb|EDM57045.1|  ATP-dependent metallopeptidase HflB                     176   1e-50    
ref|WP_022451567.1|  aTP-dependent metallopeptidase HflB subfamil...    184   2e-50    
ref|WP_015163831.1|  membrane protease FtsH catalytic subunit           184   2e-50    
ref|WP_009343155.1|  cell division protein FtsH                         184   2e-50    
ref|WP_015207685.1|  membrane protease FtsH catalytic subunit           184   2e-50    
ref|WP_010873456.1|  cell division protein FtsH                         184   2e-50    
ref|WP_027401898.1|  cell division protein FtsH                         184   2e-50    
ref|WP_031459350.1|  cell division protein FtsH                         184   2e-50    
ref|WP_043108119.1|  ATP-dependent metalloprotease                      184   3e-50    
ref|WP_009847543.1|  ATP-dependent Zn protease                          176   3e-50    
ref|WP_044818844.1|  ATP-dependent metalloprotease                      176   3e-50    
ref|WP_006517061.1|  membrane protease FtsH catalytic subunit           184   3e-50    
ref|WP_028948642.1|  cell division protein FtsH                         183   3e-50    



>gb|KHN33816.1| ATP-dependent zinc metalloprotease FTSH 1, chloroplastic [Glycine 
soja]
Length=325

 Score =   402 bits (1032),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 195/201 (97%), Positives = 200/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  125  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  184

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  185  ENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  244

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVERAYSRAT IITTHIDILHKLAQLLIEKE
Sbjct  245  GNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYSRATHIITTHIDILHKLAQLLIEKE  304

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+VA
Sbjct  305  TVDGEEFMSLFIDGKAELYVA  325



>emb|CBI18876.3| unnamed protein product [Vitis vinifera]
Length=538

 Score =   405 bits (1042),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 195/201 (97%), Positives = 200/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  338  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  397

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  398  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  457

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AYSRA QI+TTHIDILHKLAQLLIEKE
Sbjct  458  GNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYSRAKQIMTTHIDILHKLAQLLIEKE  517

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAELFVA
Sbjct  518  TVDGEEFMSLFIDGKAELFVA  538



>ref|NP_001183829.1| uncharacterized protein LOC100502422 [Zea mays]
 gb|ACR38427.1| unknown [Zea mays]
Length=475

 Score =   400 bits (1028),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 194/201 (97%), Positives = 200/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  275  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  334

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  335  ENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  394

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRA QIITTHIDILHKLAQLLIEKE
Sbjct  395  GNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRARQIITTHIDILHKLAQLLIEKE  454

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AELFVA
Sbjct  455  TVDGEEFMSLFIDGQAELFVA  475



>gb|ACN35033.1| unknown [Zea mays]
Length=463

 Score =   399 bits (1026),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 194/201 (97%), Positives = 200/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  263  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  322

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  323  ENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  382

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRA QIITTHIDILHKLAQLLIEKE
Sbjct  383  GNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRARQIITTHIDILHKLAQLLIEKE  442

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AELFVA
Sbjct  443  TVDGEEFMSLFIDGQAELFVA  463



>ref|XP_008452941.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Cucumis melo]
Length=715

 Score =   407 bits (1047),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 198/201 (99%), Positives = 201/201 (100%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  515  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  574

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG
Sbjct  575  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  634

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATAD+VDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE
Sbjct  635  GNPFLGQQMSSQKDYSMATADIVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  694

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+VA
Sbjct  695  TVDGEEFMSLFIDGKAELYVA  715



>ref|XP_006656509.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Oryza brachyantha]
Length=475

 Score =   399 bits (1024),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 193/201 (96%), Positives = 201/201 (100%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  275  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  334

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  335  ENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  394

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRATQIITTHIDILHKLAQLL+EKE
Sbjct  395  GNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRATQIITTHIDILHKLAQLLMEKE  454

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AELFVA
Sbjct  455  TVDGEEFMSLFIDGQAELFVA  475



>emb|CAN74077.1| hypothetical protein VITISV_000978 [Vitis vinifera]
Length=663

 Score =   404 bits (1038),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 195/201 (97%), Positives = 200/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  463  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  522

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  523  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  582

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AYSRA QI+TTHIDILHKLAQLLIEKE
Sbjct  583  GNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYSRAKQIMTTHIDILHKLAQLLIEKE  642

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAELFVA
Sbjct  643  TVDGEEFMSLFIDGKAELFVA  663



>ref|XP_004500893.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cicer arietinum]
Length=713

 Score =   405 bits (1041),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 196/201 (98%), Positives = 200/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  513  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  572

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  573  ENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  632

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQM+TQKDYSMATADVVDAEVRELVE+AYSRATQII THIDILHKLAQLLIEKE
Sbjct  633  GNPFLGQQMATQKDYSMATADVVDAEVRELVEKAYSRATQIINTHIDILHKLAQLLIEKE  692

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAELFVA
Sbjct  693  TVDGEEFMSLFIDGKAELFVA  713



>dbj|BAJ85305.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=249

 Score =   389 bits (999),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 187/201 (93%), Positives = 196/201 (98%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +K+KLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  49   QKRKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  108

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGFSKKIGQ+AIG  G
Sbjct  109  ENQMAVALGGRVAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGFSKKIGQVAIGSSG  168

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATAD+VDAEVRELVE AYSRATQII THIDILH+LA LLIEKE
Sbjct  169  GNPFLGQQMSSQKDYSMATADIVDAEVRELVETAYSRATQIINTHIDILHRLANLLIEKE  228

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AELFVA
Sbjct  229  TVDGEEFMSLFIDGQAELFVA  249



>ref|XP_004966506.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Setaria italica]
Length=685

 Score =   404 bits (1037),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 195/201 (97%), Positives = 201/201 (100%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  485  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  544

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  545  ENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  604

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATAD+VDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE
Sbjct  605  GNPFLGQQMSSQKDYSMATADIVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  664

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AELFVA
Sbjct  665  TVDGEEFMSLFIDGQAELFVA  685



>ref|XP_007136141.1| hypothetical protein PHAVU_009G021400g [Phaseolus vulgaris]
 gb|ESW08135.1| hypothetical protein PHAVU_009G021400g [Phaseolus vulgaris]
Length=709

 Score =   404 bits (1038),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 196/201 (98%), Positives = 200/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  509  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  568

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  569  ENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  628

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRAT IITTHIDILHKLAQLLIEKE
Sbjct  629  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATNIITTHIDILHKLAQLLIEKE  688

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+VA
Sbjct  689  TVDGEEFMSLFIDGKAELYVA  709



>gb|EEC81336.1| hypothetical protein OsI_24516 [Oryza sativa Indica Group]
Length=630

 Score =   401 bits (1030),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 193/201 (96%), Positives = 201/201 (100%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  430  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  489

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  490  ENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  549

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRATQIITTHIDILHKLAQLL+EKE
Sbjct  550  GNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRATQIITTHIDILHKLAQLLMEKE  609

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AELFVA
Sbjct  610  TVDGEEFMSLFIDGQAELFVA  630



>ref|XP_002285925.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Vitis vinifera]
Length=706

 Score =   403 bits (1036),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 195/201 (97%), Positives = 200/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  506  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  565

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  566  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  625

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AYSRA QI+TTHIDILHKLAQLLIEKE
Sbjct  626  GNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYSRAKQIMTTHIDILHKLAQLLIEKE  685

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAELFVA
Sbjct  686  TVDGEEFMSLFIDGKAELFVA  706



>ref|XP_003527434.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Glycine max]
Length=696

 Score =   402 bits (1034),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 195/201 (97%), Positives = 200/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  496  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  555

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  556  ENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  615

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVERAYSRAT IITTHIDILHKLAQLLIEKE
Sbjct  616  GNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYSRATHIITTHIDILHKLAQLLIEKE  675

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+VA
Sbjct  676  TVDGEEFMSLFIDGKAELYVA  696



>ref|XP_004145531.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157076.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55486.1| hypothetical protein Csa_4G653470 [Cucumis sativus]
Length=715

 Score =   402 bits (1034),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 196/201 (98%), Positives = 199/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  515  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  574

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG
Sbjct  575  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  634

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATAD+VDAEVRELVERAYSRA QIITTH DILHKLAQLLIEKE
Sbjct  635  GNPFLGQQMSSQKDYSMATADIVDAEVRELVERAYSRAKQIITTHNDILHKLAQLLIEKE  694

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+VA
Sbjct  695  TVDGEEFMSLFIDGKAELYVA  715



>ref|XP_010242853.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nelumbo nucifera]
Length=720

 Score =   403 bits (1035),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 194/201 (97%), Positives = 201/201 (100%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  520  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  579

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSK+IGQ+AIGGPG
Sbjct  580  ENQMAVALGGRVAEEVIFGKDNVTTGASNDFMQVSRVARQMVERFGFSKRIGQVAIGGPG  639

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVERAY+RATQIITTHIDILHKLAQLL+EKE
Sbjct  640  GNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYARATQIITTHIDILHKLAQLLMEKE  699

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+VA
Sbjct  700  TVDGEEFMSLFIDGKAELYVA  720



>gb|AFW75733.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
 gb|AFW75734.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
Length=688

 Score =   402 bits (1032),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 194/201 (97%), Positives = 200/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  488  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  547

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  548  ENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  607

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRA QIITTHIDILHKLAQLLIEKE
Sbjct  608  GNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRARQIITTHIDILHKLAQLLIEKE  667

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AELFVA
Sbjct  668  TVDGEEFMSLFIDGQAELFVA  688



>gb|KDP36832.1| hypothetical protein JCGZ_08123 [Jatropha curcas]
Length=715

 Score =   402 bits (1034),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 195/201 (97%), Positives = 199/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  515  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  574

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  575  ENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  634

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVERAY+RA  IITTHIDILHKLAQLLIEKE
Sbjct  635  GNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYARAKHIITTHIDILHKLAQLLIEKE  694

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAELFVA
Sbjct  695  TVDGEEFMSLFIDGKAELFVA  715



>ref|XP_011101039.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Sesamum indicum]
Length=703

 Score =   402 bits (1032),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 193/201 (96%), Positives = 201/201 (100%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  503  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  562

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  563  ENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  622

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVERAY+RATQIITTHIDILHKLAQLLIEKE
Sbjct  623  GNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYTRATQIITTHIDILHKLAQLLIEKE  682

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL++A
Sbjct  683  TVDGEEFMSLFIDGKAELYIA  703



>ref|XP_011074733.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Sesamum indicum]
Length=703

 Score =   401 bits (1030),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 194/201 (97%), Positives = 200/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  503  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  562

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  563  ENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  622

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMSTQKDYSMATADVVDAEVRELV+RAY+RA QIITTHIDILHKLAQLLIEKE
Sbjct  623  GNPFLGQQMSTQKDYSMATADVVDAEVRELVDRAYTRAKQIITTHIDILHKLAQLLIEKE  682

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+VA
Sbjct  683  TVDGEEFMSLFIDGKAELYVA  703



>ref|XP_003523186.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Glycine max]
Length=694

 Score =   401 bits (1030),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 194/201 (97%), Positives = 200/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  494  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  553

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  554  ENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  613

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVERAYSRAT II+THIDILHKLAQLLIEKE
Sbjct  614  GNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYSRATHIISTHIDILHKLAQLLIEKE  673

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+VA
Sbjct  674  TVDGEEFMSLFIDGKAELYVA  694



>ref|XP_006473758.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Citrus sinensis]
Length=723

 Score =   401 bits (1031),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 195/201 (97%), Positives = 199/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  523  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  582

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  583  ENQMAVALGGRVAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  642

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVE AY+RA QIITTHIDILHKLAQLLIEKE
Sbjct  643  GNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYTRAKQIITTHIDILHKLAQLLIEKE  702

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAELFVA
Sbjct  703  TVDGEEFMSLFIDGKAELFVA  723



>ref|XP_006435323.1| hypothetical protein CICLE_v10000422mg [Citrus clementina]
 gb|ESR48563.1| hypothetical protein CICLE_v10000422mg [Citrus clementina]
 gb|KDO85046.1| hypothetical protein CISIN_1g004921mg [Citrus sinensis]
Length=723

 Score =   401 bits (1031),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 195/201 (97%), Positives = 199/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  523  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  582

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  583  ENQMAVALGGRVAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  642

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVE AY+RA QIITTHIDILHKLAQLLIEKE
Sbjct  643  GNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYTRAKQIITTHIDILHKLAQLLIEKE  702

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAELFVA
Sbjct  703  TVDGEEFMSLFIDGKAELFVA  723



>ref|NP_001058625.1| Os06g0725900 [Oryza sativa Japonica Group]
 sp|Q5Z974.1|FTSH1_ORYSJ RecName: Full=ATP-dependent zinc metalloprotease FTSH 1, chloroplastic; 
Short=OsFTSH1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD61706.1| putative chloroplast FtsH protease [Oryza sativa Japonica Group]
 dbj|BAF20539.1| Os06g0725900 [Oryza sativa Japonica Group]
 dbj|BAG89328.1| unnamed protein product [Oryza sativa Japonica Group]
Length=686

 Score =   399 bits (1024),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/201 (96%), Positives = 201/201 (100%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EK++LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  486  EKRRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  545

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  546  ENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  605

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRATQIITTHIDILHKLAQLL+EKE
Sbjct  606  GNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRATQIITTHIDILHKLAQLLMEKE  665

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AELFVA
Sbjct  666  TVDGEEFMSLFIDGQAELFVA  686



>gb|EAZ38336.1| hypothetical protein OsJ_22711 [Oryza sativa Japonica Group]
Length=686

 Score =   398 bits (1023),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/201 (96%), Positives = 201/201 (100%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EK++LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  486  EKRRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  545

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  546  ENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  605

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRATQIITTHIDILHKLAQLL+EKE
Sbjct  606  GNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRATQIITTHIDILHKLAQLLMEKE  665

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AELFVA
Sbjct  666  TVDGEEFMSLFIDGQAELFVA  686



>ref|XP_010527682.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Tarenaya hassleriana]
Length=715

 Score =   399 bits (1025),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 193/201 (96%), Positives = 199/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  515  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  574

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQM+VALGGR+AEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGG G
Sbjct  575  ENQMSVALGGRIAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGSG  634

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVERAY+RA QIITTHIDILHKLAQLLIEKE
Sbjct  635  GNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYARAKQIITTHIDILHKLAQLLIEKE  694

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAELFV+
Sbjct  695  TVDGEEFMSLFIDGKAELFVS  715



>ref|XP_010060660.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Eucalyptus grandis]
 gb|KCW67463.1| hypothetical protein EUGRSUZ_F01206 [Eucalyptus grandis]
Length=713

 Score =   399 bits (1024),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/201 (96%), Positives = 199/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  513  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  572

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  573  ENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  632

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMSTQKDYSMATADVVDAEVRELV+RAYSRA QI+TTH+DILHKLAQLLIEKE
Sbjct  633  GNPFLGQQMSTQKDYSMATADVVDAEVRELVDRAYSRAKQIMTTHVDILHKLAQLLIEKE  692

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+V+
Sbjct  693  TVDGEEFMSLFIDGKAELYVS  713



>ref|XP_010094593.1| ATP-dependent zinc metalloprotease FTSH [Morus notabilis]
 gb|EXB56347.1| ATP-dependent zinc metalloprotease FTSH [Morus notabilis]
Length=710

 Score =   397 bits (1021),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 193/201 (96%), Positives = 198/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  510  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  569

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  570  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  629

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVE AYSRA QI+TTHIDILHKLA LLIEKE
Sbjct  630  GNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYSRAKQILTTHIDILHKLALLLIEKE  689

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+V+
Sbjct  690  TVDGEEFMSLFIDGKAELYVS  710



>ref|XP_009777632.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana sylvestris]
Length=707

 Score =   397 bits (1020),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 193/201 (96%), Positives = 198/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  507  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  566

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GFSKKIGQ+AIGG G
Sbjct  567  ENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGFSKKIGQVAIGGGG  626

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAY RATQIITTHIDILHKLAQLLIEKE
Sbjct  627  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYERATQIITTHIDILHKLAQLLIEKE  686

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+++
Sbjct  687  TVDGEEFMSLFIDGKAELYIS  707



>ref|XP_011041264.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Populus euphratica]
Length=705

 Score =   397 bits (1019),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 191/201 (95%), Positives = 198/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  505  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  564

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  565  ENQMAVALGGRVAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  624

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVD EVRELVE AYSRA QI+TTHIDILHKLAQLLIEKE
Sbjct  625  GNPFLGQQMSSQKDYSMATADVVDTEVRELVETAYSRAKQIMTTHIDILHKLAQLLIEKE  684

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL++A
Sbjct  685  TVDGEEFMSLFIDGKAELYIA  705



>ref|XP_006342112.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Solanum tuberosum]
Length=708

 Score =   397 bits (1019),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 193/201 (96%), Positives = 198/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  508  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  567

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GFSKKIGQ+AIGG G
Sbjct  568  ENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGFSKKIGQVAIGGGG  627

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMSTQKDYSMATADVVDAEVRELVE+AY RATQIITTHIDILHKLAQLLIEKE
Sbjct  628  GNPFLGQQMSTQKDYSMATADVVDAEVRELVEKAYERATQIITTHIDILHKLAQLLIEKE  687

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAELF++
Sbjct  688  TVDGEEFMSLFIDGKAELFIS  708



>ref|XP_011034903.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH, chloroplastic [Populus euphratica]
Length=704

 Score =   396 bits (1018),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 191/201 (95%), Positives = 199/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  504  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  563

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  564  ENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  623

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVE AY+RA QIITTHIDILHKLAQLLIEKE
Sbjct  624  GNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYTRAKQIITTHIDILHKLAQLLIEKE  683

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            +VDGEEFMSLFIDGKAEL+V+
Sbjct  684  SVDGEEFMSLFIDGKAELYVS  704



>ref|XP_002301927.1| Cell division protein ftsH [Populus trichocarpa]
 gb|EEE81200.1| Cell division protein ftsH [Populus trichocarpa]
Length=704

 Score =   396 bits (1018),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 191/201 (95%), Positives = 199/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  504  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  563

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  564  ENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  623

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVE AY+RA QIITTHIDILHKLAQLLIEKE
Sbjct  624  GNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYTRAKQIITTHIDILHKLAQLLIEKE  683

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            +VDGEEFMSLFIDGKAEL+V+
Sbjct  684  SVDGEEFMSLFIDGKAELYVS  704



>emb|CDP07308.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   396 bits (1017),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 191/201 (95%), Positives = 199/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  506  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  565

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  566  ENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  625

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVD+EVRELVE+AYSRA QI+TTHIDILHKLAQLLIEKE
Sbjct  626  GNPFLGQQMSSQKDYSMATADVVDSEVRELVEKAYSRAKQIMTTHIDILHKLAQLLIEKE  685

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEF+SLFIDGKAEL+VA
Sbjct  686  TVDGEEFLSLFIDGKAELYVA  706



>emb|CDX96068.1| BnaA07g26630D [Brassica napus]
Length=675

 Score =   395 bits (1014),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 187/201 (93%), Positives = 199/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  475  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  534

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPG
Sbjct  535  ENQMAVALGGRVAEEVIFGDDNVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPG  594

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT IITTHIDILHKLAQLLIEKE
Sbjct  595  GNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATDIITTHIDILHKLAQLLIEKE  654

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AEL+V+
Sbjct  655  TVDGEEFMSLFIDGQAELYVS  675



>ref|XP_007017987.1| FtsH extracellular protease family isoform 1 [Theobroma cacao]
 gb|EOY15212.1| FtsH extracellular protease family isoform 1 [Theobroma cacao]
Length=702

 Score =   395 bits (1015),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 190/201 (95%), Positives = 198/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  502  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  561

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  562  ENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  621

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVD+EVRELVE AY+RA QIITTHIDILHKLAQLLIEKE
Sbjct  622  GNPFLGQQMSSQKDYSMATADVVDSEVRELVETAYTRAKQIITTHIDILHKLAQLLIEKE  681

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGK EL+V+
Sbjct  682  TVDGEEFMSLFIDGKTELYVS  702



>ref|XP_009395377.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=706

 Score =   395 bits (1015),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 193/201 (96%), Positives = 198/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  506  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  565

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGG G
Sbjct  566  ENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGSG  625

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRA QIITTH DILHKLAQLLIEKE
Sbjct  626  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRAKQIITTHSDILHKLAQLLIEKE  685

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDG+EFMSLFIDGKAEL+VA
Sbjct  686  TVDGDEFMSLFIDGKAELYVA  706



>gb|KHG14732.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Gossypium 
arboreum]
Length=699

 Score =   395 bits (1014),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 190/201 (95%), Positives = 199/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  499  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  558

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  559  QNQMAVALGGRIAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  618

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVR+LVE AYSRA QIITTHIDILHKLAQLL+EKE
Sbjct  619  GNPFLGQQMSSQKDYSMATADVVDAEVRDLVETAYSRAKQIITTHIDILHKLAQLLMEKE  678

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+V+
Sbjct  679  TVDGEEFMSLFIDGKAELYVS  699



>ref|XP_009105314.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Brassica rapa]
Length=703

 Score =   395 bits (1014),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 187/201 (93%), Positives = 199/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  503  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  562

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPG
Sbjct  563  ENQMAVALGGRVAEEVIFGDDNVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPG  622

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT IITTHIDILHKLAQLLIEKE
Sbjct  623  GNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATDIITTHIDILHKLAQLLIEKE  682

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AEL+V+
Sbjct  683  TVDGEEFMSLFIDGQAELYVS  703



>emb|CDY01840.1| BnaC06g28800D [Brassica napus]
Length=702

 Score =   395 bits (1014),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 187/201 (93%), Positives = 199/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  502  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  561

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPG
Sbjct  562  ENQMAVALGGRVAEEVIFGDDNVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPG  621

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT IITTHIDILHKLAQLLIEKE
Sbjct  622  GNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATDIITTHIDILHKLAQLLIEKE  681

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AEL+V+
Sbjct  682  TVDGEEFMSLFIDGQAELYVS  702



>ref|XP_002894238.1| hypothetical protein ARALYDRAFT_891950 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70497.1| hypothetical protein ARALYDRAFT_891950 [Arabidopsis lyrata subsp. 
lyrata]
Length=720

 Score =   394 bits (1013),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/201 (92%), Positives = 200/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  520  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  579

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPG
Sbjct  580  ENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPG  639

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKLAQLLIEKE
Sbjct  640  GNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKLAQLLIEKE  699

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AEL+++
Sbjct  700  TVDGEEFMSLFIDGQAELYIS  720



>ref|XP_010941398.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Elaeis guineensis]
Length=723

 Score =   394 bits (1013),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 192/201 (96%), Positives = 198/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  523  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  582

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  583  ENQMAVALGGRVAEEVIFGNDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  642

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRA QI+T +IDILHKLAQLLIEKE
Sbjct  643  GNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRAKQIMTDNIDILHKLAQLLIEKE  702

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+VA
Sbjct  703  TVDGEEFMSLFIDGKAELYVA  723



>gb|EMS62975.1| ATP-dependent zinc metalloprotease FTSH 1, chloroplastic [Triticum 
urartu]
Length=494

 Score =   387 bits (993),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/201 (93%), Positives = 196/201 (98%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +K+KLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  294  QKRKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  353

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGFSKKIGQ+AIG  G
Sbjct  354  ENQMAVALGGRVAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGFSKKIGQVAIGSSG  413

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATAD+VDAEVRELVE AYSRATQII THIDILH+LA LLIEKE
Sbjct  414  GNPFLGQQMSSQKDYSMATADIVDAEVRELVETAYSRATQIINTHIDILHRLANLLIEKE  473

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AELFVA
Sbjct  474  TVDGEEFMSLFIDGQAELFVA  494



>ref|XP_009418681.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=715

 Score =   394 bits (1011),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/201 (95%), Positives = 198/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  515  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  574

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFGE+ VTTGASNDFMQVSRVARQMVER GFSK+IGQ+AIGGPG
Sbjct  575  ENQMAVALGGRVAEEVIFGEEKVTTGASNDFMQVSRVARQMVERLGFSKRIGQVAIGGPG  634

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVD+EVRELVERAY+RA QIITTHIDILHKLAQLLIEKE
Sbjct  635  GNPFLGQQMSSQKDYSMATADVVDSEVRELVERAYARAKQIITTHIDILHKLAQLLIEKE  694

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+VA
Sbjct  695  TVDGEEFMSLFIDGKAELYVA  715



>ref|XP_010500575.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Camelina sativa]
Length=722

 Score =   394 bits (1012),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 185/201 (92%), Positives = 200/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  522  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  581

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPG
Sbjct  582  ENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPG  641

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKLAQLLIEKE
Sbjct  642  GNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKLAQLLIEKE  701

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AEL+++
Sbjct  702  TVDGEEFMSLFIDGQAELYIS  722



>ref|XP_010479476.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=723

 Score =   394 bits (1011),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 185/201 (92%), Positives = 200/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  523  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  582

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPG
Sbjct  583  ENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPG  642

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKLAQLLIEKE
Sbjct  643  GNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKLAQLLIEKE  702

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AEL+++
Sbjct  703  TVDGEEFMSLFIDGQAELYIS  723



>ref|XP_006306893.1| hypothetical protein CARUB_v10008446mg [Capsella rubella]
 gb|EOA39791.1| hypothetical protein CARUB_v10008446mg [Capsella rubella]
Length=718

 Score =   394 bits (1011),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 185/201 (92%), Positives = 200/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  518  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  577

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPG
Sbjct  578  ENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPG  637

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKLAQLLIEKE
Sbjct  638  GNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKLAQLLIEKE  697

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AEL+++
Sbjct  698  TVDGEEFMSLFIDGQAELYIS  718



>ref|XP_010479477.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=724

 Score =   394 bits (1011),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 185/201 (92%), Positives = 200/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  524  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  583

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPG
Sbjct  584  ENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPG  643

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKLAQLLIEKE
Sbjct  644  GNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKLAQLLIEKE  703

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AEL+++
Sbjct  704  TVDGEEFMSLFIDGQAELYIS  724



>ref|XP_006391231.1| hypothetical protein EUTSA_v10018191mg [Eutrema salsugineum]
 gb|ESQ28517.1| hypothetical protein EUTSA_v10018191mg [Eutrema salsugineum]
Length=722

 Score =   394 bits (1011),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 186/201 (93%), Positives = 199/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  522  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  581

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPG
Sbjct  582  ENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPG  641

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKLAQLLIEKE
Sbjct  642  GNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKLAQLLIEKE  701

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AEL+V+
Sbjct  702  TVDGEEFMSLFIDGQAELYVS  722



>ref|NP_564563.1| ATP-dependent zinc metalloprotease FTSH 1 [Arabidopsis thaliana]
 sp|Q39102.2|FTSH1_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 1, chloroplastic; 
Short=AtFTSH1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD50055.1|AC007980_20 ATP-dependent metalloprotease [Arabidopsis thaliana]
 gb|AAM14046.1| putative chloroplast FtsH protease [Arabidopsis thaliana]
 gb|AAM67567.1| putative chloroplast FtsH protease [Arabidopsis thaliana]
 gb|AEE32528.1| ATP-dependent zinc metalloprotease FTSH 1 [Arabidopsis thaliana]
Length=716

 Score =   393 bits (1010),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 185/201 (92%), Positives = 200/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  516  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  575

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPG
Sbjct  576  ENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPG  635

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKLAQLLIEKE
Sbjct  636  GNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKLAQLLIEKE  695

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AEL+++
Sbjct  696  TVDGEEFMSLFIDGQAELYIS  716



>ref|XP_002306970.2| Cell division protein ftsH [Populus trichocarpa]
 gb|EEE93966.2| Cell division protein ftsH [Populus trichocarpa]
Length=705

 Score =   392 bits (1007),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 189/201 (94%), Positives = 197/201 (98%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  505  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  564

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGFSKKIGQ+AIGG G
Sbjct  565  ENQMAVALGGRVAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGFSKKIGQVAIGGSG  624

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVD EVRELVE AYSRA QI+TTHIDILHKLAQLLIEKE
Sbjct  625  GNPFLGQQMSSQKDYSMATADVVDTEVRELVETAYSRAKQIMTTHIDILHKLAQLLIEKE  684

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL++A
Sbjct  685  TVDGEEFMSLFIDGKAELYIA  705



>ref|XP_008221155.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Prunus mume]
Length=719

 Score =   392 bits (1007),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 189/201 (94%), Positives = 199/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  519  DKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  578

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGAS+DFMQVSRVARQMVERFGFSKKIGQ+AIG  G
Sbjct  579  ENQMAVALGGRVAEEVIFGQENVTTGASSDFMQVSRVARQMVERFGFSKKIGQVAIGAGG  638

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AYSRATQIITTHIDILHKLAQLL+EKE
Sbjct  639  GNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYSRATQIITTHIDILHKLAQLLMEKE  698

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+VA
Sbjct  699  TVDGEEFMSLFIDGKAELYVA  719



>ref|XP_007221904.1| hypothetical protein PRUPE_ppa002083mg [Prunus persica]
 gb|EMJ23103.1| hypothetical protein PRUPE_ppa002083mg [Prunus persica]
Length=719

 Score =   392 bits (1007),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 189/201 (94%), Positives = 199/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  519  DKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  578

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGAS+DFMQVSRVARQMVERFGFSKKIGQ+AIG  G
Sbjct  579  ENQMAVALGGRVAEEVIFGQENVTTGASSDFMQVSRVARQMVERFGFSKKIGQVAIGAGG  638

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AYSRATQIITTHIDILHKLAQLL+EKE
Sbjct  639  GNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYSRATQIITTHIDILHKLAQLLMEKE  698

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+VA
Sbjct  699  TVDGEEFMSLFIDGKAELYVA  719



>ref|XP_006828956.1| hypothetical protein AMTR_s00001p00232760 [Amborella trichopoda]
 gb|ERM96372.1| hypothetical protein AMTR_s00001p00232760 [Amborella trichopoda]
Length=713

 Score =   392 bits (1007),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 191/201 (95%), Positives = 197/201 (98%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  513  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  572

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  573  ENQMAVALGGRVAEEVIFGKENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  632

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVD+EVRELV+ AYSRA  IITT IDILHKLAQLLIEKE
Sbjct  633  GNPFLGQQMSSQKDYSMATADVVDSEVRELVDEAYSRAKHIITTQIDILHKLAQLLIEKE  692

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAELFVA
Sbjct  693  TVDGEEFMSLFIDGKAELFVA  713



>ref|XP_008812082.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Phoenix dactylifera]
Length=724

 Score =   391 bits (1005),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 189/201 (94%), Positives = 199/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EK+KLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  524  EKRKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  583

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  584  ENQMAVALGGRVAEEVIFGKDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  643

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVD+EVRELVE+AYSRA QI++ +IDILHKLAQLLIEKE
Sbjct  644  GNPFLGQQMSSQKDYSMATADVVDSEVRELVEKAYSRALQIMSDNIDILHKLAQLLIEKE  703

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+VA
Sbjct  704  TVDGEEFMSLFIDGKAELYVA  724



>ref|XP_003563253.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Brachypodium distachyon]
Length=681

 Score =   389 bits (998),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 187/201 (93%), Positives = 198/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +K++LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  481  QKRRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  540

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIG  G
Sbjct  541  ENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGSSG  600

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATAD+VDAEVRELVE++YSRATQII THIDILHKLAQLLIEKE
Sbjct  601  GNPFLGQQMSSQKDYSMATADIVDAEVRELVEKSYSRATQIINTHIDILHKLAQLLIEKE  660

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AELFVA
Sbjct  661  TVDGEEFMSLFIDGQAELFVA  681



>ref|XP_004291222.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=711

 Score =   387 bits (995),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 186/201 (93%), Positives = 196/201 (98%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  511  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  570

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+ NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+A+G  G
Sbjct  571  ENQMAVALGGRVAEEVIFGQANVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAVGSSG  630

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKLA LLIEKE
Sbjct  631  GNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKLANLLIEKE  690

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            +VDGEEFMSLFIDGKAEL+V+
Sbjct  691  SVDGEEFMSLFIDGKAELYVS  711



>gb|EPS73399.1| precursor of protein cell division protease ftsh-like protein, 
partial [Genlisea aurea]
Length=694

 Score =   386 bits (992),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 186/198 (94%), Positives = 194/198 (98%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  497  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  556

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEE IFG D VTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  557  ENQMAVALGGRVAEEAIFGVDKVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  616

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMSTQKDYSMATAD+VDAEVRELV+RAY+RA QIITT+IDILH+LAQLLIEKE
Sbjct  617  GNPFLGQQMSTQKDYSMATADIVDAEVRELVDRAYARAKQIITTNIDILHRLAQLLIEKE  676

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVDGEEFMSLFIDGKA++
Sbjct  677  TVDGEEFMSLFIDGKAQM  694



>ref|XP_009618840.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana tomentosiformis]
Length=707

 Score =   386 bits (991),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 192/201 (96%), Positives = 198/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  507  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  566

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GFSKKIGQ+AIGG G
Sbjct  567  ENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGFSKKIGQVAIGGGG  626

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAY RAT+IITTHIDILHKLAQLLIEKE
Sbjct  627  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYERATEIITTHIDILHKLAQLLIEKE  686

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+++
Sbjct  687  TVDGEEFMSLFIDGKAELYIS  707



>ref|NP_001234196.1| FtsH-like protein precursor [Solanum lycopersicum]
 gb|AAQ93011.1| FtsH-like protein precursor [Solanum lycopersicum]
Length=708

 Score =   386 bits (991),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 192/201 (96%), Positives = 198/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  508  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  567

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GFSKKIGQ+AIGG G
Sbjct  568  ENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGFSKKIGQVAIGGGG  627

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMSTQKDYSMATADVVDAEVRELVE+AY RATQIITTHIDILHKLAQLLIEKE
Sbjct  628  GNPFLGQQMSTQKDYSMATADVVDAEVRELVEKAYERATQIITTHIDILHKLAQLLIEKE  687

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+++
Sbjct  688  TVDGEEFMSLFIDGKAELYIS  708



>gb|EMT09942.1| Cell division protease ftsH-like protein, chloroplastic [Aegilops 
tauschii]
Length=665

 Score =   384 bits (987),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 196/202 (97%), Gaps = 1/202 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +K+KLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  464  QKRKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  523

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGP-  334
            ENQMAVALGGRVAEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGFSKKIGQ+AIG   
Sbjct  524  ENQMAVALGGRVAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGFSKKIGQVAIGSSG  583

Query  333  GGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEK  154
            GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE AYSRATQII THIDILH+LA LLIEK
Sbjct  584  GGNPFLGQQMSSQKDYSMATADIVDAEVRELVETAYSRATQIINTHIDILHRLANLLIEK  643

Query  153  ETVDGEEFMSLFIDGKAELFVA  88
            ETVDGEEFMSLFIDG+AELFVA
Sbjct  644  ETVDGEEFMSLFIDGQAELFVA  665



>ref|XP_009767982.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana sylvestris]
Length=710

 Score =   385 bits (988),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 190/201 (95%), Positives = 199/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  510  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  569

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GFSKKIGQ+AIGG G
Sbjct  570  ENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGFSKKIGQVAIGGGG  629

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMSTQKDYSMATAD+VDAEVRELV++AY+RATQIITTHIDILHKLAQLLIEKE
Sbjct  630  GNPFLGQQMSTQKDYSMATADIVDAEVRELVDKAYARATQIITTHIDILHKLAQLLIEKE  689

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+++
Sbjct  690  TVDGEEFMSLFIDGKAELYIS  710



>ref|XP_009606853.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana tomentosiformis]
Length=715

 Score =   385 bits (988),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 190/201 (95%), Positives = 199/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  515  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  574

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GFSKKIGQ+AIGG G
Sbjct  575  ENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGFSKKIGQVAIGGGG  634

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMSTQKDYSMATAD+VDAEVRELV++AY+RATQIITTHIDILHKLAQLLIEKE
Sbjct  635  GNPFLGQQMSTQKDYSMATADIVDAEVRELVDKAYARATQIITTHIDILHKLAQLLIEKE  694

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+++
Sbjct  695  TVDGEEFMSLFIDGKAELYIS  715



>emb|CAA68141.1| chloroplast FtsH protease [Arabidopsis thaliana]
Length=709

 Score =   384 bits (987),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 193/194 (99%), Gaps = 0/194 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  516  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  575

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPG
Sbjct  576  ENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPG  635

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKLAQLLIEKE
Sbjct  636  GNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKLAQLLIEKE  695

Query  150  TVDGEEFMSLFIDG  109
            TVDGEEFMSLFIDG
Sbjct  696  TVDGEEFMSLFIDG  709



>ref|XP_008377091.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Malus domestica]
Length=718

 Score =   384 bits (987),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 186/201 (93%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  518  DKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  577

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGAS+DFMQVSRVARQMVERFGFSKKIGQ+AIG  G
Sbjct  578  ENQMAVALGGRVAEEVIFGQENVTTGASSDFMQVSRVARQMVERFGFSKKIGQVAIGASG  637

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVE AYSRA  I+TTHIDILH LAQLL+EKE
Sbjct  638  GNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYSRAKDIVTTHIDILHTLAQLLMEKE  697

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+VA
Sbjct  698  TVDGEEFMSLFIDGKAELYVA  718



>sp|O82150.2|FTSH_TOBAC RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
AltName: Full=DS9; Flags: Precursor [Nicotiana tabacum]
 dbj|BAA33755.2| chloroplast FtsH protease [Nicotiana tabacum]
Length=714

 Score =   383 bits (983),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 191/201 (95%), Positives = 197/201 (98%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  507  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  566

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALG RVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GFSKKIGQ+AIGG G
Sbjct  567  ENQMAVALGERVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGFSKKIGQVAIGGGG  626

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAY RAT+IITTHIDILHKLAQLLIEKE
Sbjct  627  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYERATEIITTHIDILHKLAQLLIEKE  686

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+++
Sbjct  687  TVDGEEFMSLFIDGKAELYIS  707



>ref|XP_009334277.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=721

 Score =   383 bits (983),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 185/200 (93%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGG TFFAPSEERLESGLYSRSYL
Sbjct  521  DKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGFTFFAPSEERLESGLYSRSYL  580

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQM VALGGRVAEEV FG++NVTTGAS+DFMQVSRVARQMVERFGFSKKIGQIA+G  G
Sbjct  581  ENQMVVALGGRVAEEVSFGQENVTTGASSDFMQVSRVARQMVERFGFSKKIGQIAVGASG  640

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATAD+VD EVRELVE AYSRATQIITTHIDILHKLAQLLIEKE
Sbjct  641  GNPFLGQQMSSQKDYSMATADIVDGEVRELVETAYSRATQIITTHIDILHKLAQLLIEKE  700

Query  150  TVDGEEFMSLFIDGKAELFV  91
            TVDGEEFMSLFIDGKAEL+V
Sbjct  701  TVDGEEFMSLFIDGKAELYV  720



>gb|KEH36287.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=706

 Score =   382 bits (981),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 189/201 (94%), Positives = 197/201 (98%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  506  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  565

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGG G
Sbjct  566  ENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGGG  625

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATAD+VD EVRELV++AY RATQII THIDILHKLAQLLIEKE
Sbjct  626  GNPFLGQQMSSQKDYSMATADIVDKEVRELVDKAYERATQIINTHIDILHKLAQLLIEKE  685

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+V+
Sbjct  686  TVDGEEFMSLFIDGKAELYVS  706



>gb|KJB14315.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=699

 Score =   381 bits (979),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 189/201 (94%), Positives = 198/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  499  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  558

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGG G
Sbjct  559  ENQMAVALGGRIAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGGG  618

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVR+LVE AY+RA QIITTHIDILHKLAQLL+EKE
Sbjct  619  GNPFLGQQMSSQKDYSMATADVVDAEVRDLVETAYTRAKQIITTHIDILHKLAQLLMEKE  678

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+V+
Sbjct  679  TVDGEEFMSLFIDGKAELYVS  699



>gb|KHG10496.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Gossypium 
arboreum]
Length=699

 Score =   381 bits (978),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 189/201 (94%), Positives = 198/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  499  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  558

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGG G
Sbjct  559  ENQMAVALGGRIAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGGG  618

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVR+LVE AY+RA QIITTHIDILHKLAQLL+EKE
Sbjct  619  GNPFLGQQMSSQKDYSMATADVVDAEVRDLVETAYTRAKQIITTHIDILHKLAQLLMEKE  678

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+V+
Sbjct  679  TVDGEEFMSLFIDGKAELYVS  699



>ref|XP_009334282.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=721

 Score =   380 bits (977),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 184/200 (92%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGG TFFAPSEERLESGLYSRSYL
Sbjct  521  DKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGFTFFAPSEERLESGLYSRSYL  580

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQM VALGGRVAEEV FG++NVTTGAS+DFMQVSRVARQMVERFGFSKKIGQIA+G  G
Sbjct  581  ENQMVVALGGRVAEEVSFGQENVTTGASSDFMQVSRVARQMVERFGFSKKIGQIAVGASG  640

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQ MS+QKDYSMATAD+VD EVRELVE AYSRATQIITTHIDILHKLAQLLIEKE
Sbjct  641  GNPFLGQMMSSQKDYSMATADIVDGEVRELVETAYSRATQIITTHIDILHKLAQLLIEKE  700

Query  150  TVDGEEFMSLFIDGKAELFV  91
            TVDGEEFMSLFIDGKAEL+V
Sbjct  701  TVDGEEFMSLFIDGKAELYV  720



>gb|EYU36827.1| hypothetical protein MIMGU_mgv1a002176mg [Erythranthe guttata]
Length=705

 Score =   376 bits (966),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 188/201 (94%), Positives = 197/201 (98%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KKKLVAYHEAGHALVGALMPEYD VAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  505  DKKKLVAYHEAGHALVGALMPEYDAVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  564

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGFSKKIGQ+AIGG G
Sbjct  565  ENQMAVALGGRIAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGFSKKIGQVAIGGGG  624

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G+PFLGQQMS+QKDYSMATADVVDAEVRELV+ AYSRA QIITTH+DILHKLAQLLIEKE
Sbjct  625  GDPFLGQQMSSQKDYSMATADVVDAEVRELVDTAYSRAKQIITTHVDILHKLAQLLIEKE  684

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAELFVA
Sbjct  685  TVDGEEFMSLFIDGKAELFVA  705



>sp|Q9BAE0.1|FTSH_MEDSA RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
Flags: Precursor [Medicago sativa]
 gb|AAK15322.1|AF332134_1 FtsH protease [Medicago sativa]
Length=706

 Score =   375 bits (964),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 188/201 (94%), Positives = 196/201 (98%), Gaps = 1/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  507  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  566

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEV FG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGG G
Sbjct  567  ENQMAVALGGRVAEEV-FGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGGG  625

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATAD+VD EVRELV++AY RATQII THIDILHKLAQLLIEKE
Sbjct  626  GNPFLGQQMSSQKDYSMATADIVDKEVRELVDKAYERATQIINTHIDILHKLAQLLIEKE  685

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+V+
Sbjct  686  TVDGEEFMSLFIDGKAELYVS  706



>gb|KEH36288.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=499

 Score =   363 bits (933),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 180/192 (94%), Positives = 188/192 (98%), Gaps = 0/192 (0%)
 Frame = -3

Query  663  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  484
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  308  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  367

Query  483  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  304
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQQM
Sbjct  368  GRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGGGGNPFLGQQM  427

Query  303  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  124
            S+QKDYSMATAD+VD EVRELV++AY RATQII THIDILHKLAQLLIEKETVDGEEFMS
Sbjct  428  SSQKDYSMATADIVDKEVRELVDKAYERATQIINTHIDILHKLAQLLIEKETVDGEEFMS  487

Query  123  LFIDGKAELFVA  88
            LFIDGKAEL+V+
Sbjct  488  LFIDGKAELYVS  499



>gb|KFK31340.1| hypothetical protein AALP_AA6G099600 [Arabis alpina]
Length=705

 Score =   367 bits (942),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 187/201 (93%), Positives = 198/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  505  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  564

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+A+GG G
Sbjct  565  ENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAVGGAG  624

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AY+RATQIITT IDILHKLAQLLIEKE
Sbjct  625  GNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYARATQIITTQIDILHKLAQLLIEKE  684

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AEL+V+
Sbjct  685  TVDGEEFMSLFIDGQAELYVS  705



>dbj|BAH20236.1| AT5G42270 [Arabidopsis thaliana]
Length=510

 Score =   360 bits (924),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 185/201 (92%), Positives = 196/201 (98%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  310  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  369

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+A+GG G
Sbjct  370  ENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAVGGAG  429

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY RA +IITT IDILHKLAQLLIEKE
Sbjct  430  GNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYVRAKEIITTQIDILHKLAQLLIEKE  489

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AEL+V+
Sbjct  490  TVDGEEFMSLFIDGQAELYVS  510



>ref|XP_002960384.1| hypothetical protein SELMODRAFT_139726 [Selaginella moellendorffii]
 ref|XP_002967332.1| hypothetical protein SELMODRAFT_144519 [Selaginella moellendorffii]
 gb|EFJ31931.1| hypothetical protein SELMODRAFT_144519 [Selaginella moellendorffii]
 gb|EFJ37923.1| hypothetical protein SELMODRAFT_139726 [Selaginella moellendorffii]
Length=628

 Score =   363 bits (933),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            E+KKLVAYHEAGHALVGALMPEYDPVAKISIIPRG AGGLTFFAPSEERLESGLYSRSYL
Sbjct  428  ERKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGGAGGLTFFAPSEERLESGLYSRSYL  487

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEEVIFG +NVTTGASNDF QVSRVARQMVERFGFS KIGQ+A+GG G
Sbjct  488  ENQMAVALGGRIAEEVIFGPENVTTGASNDFQQVSRVARQMVERFGFSNKIGQVALGGSG  547

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQ+S Q DYSMATADVVDAEVRELVE AY+RA  +ITTH++ILHKLA LLIEKE
Sbjct  548  GNPFLGQQLSQQSDYSMATADVVDAEVRELVESAYARAKHLITTHVEILHKLANLLIEKE  607

Query  150  TVDGEEFMSLFIDGKAELFV  91
            TVDGEEF+SLF+DG AEL++
Sbjct  608  TVDGEEFLSLFVDGNAELYL  627



>ref|XP_010692838.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=705

 Score =   364 bits (934),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 188/201 (94%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  505  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  564

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGG G
Sbjct  565  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGGG  624

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQM++ KDYSMATADVVD EVRELVE AY RAT+I+ THIDILHKLAQLLIEKE
Sbjct  625  GNPFLGQQMASSKDYSMATADVVDGEVRELVETAYKRATEIVNTHIDILHKLAQLLIEKE  684

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+V+
Sbjct  685  TVDGEEFMSLFIDGKAELYVS  705



>ref|XP_006279579.1| hypothetical protein CARUB_v10025980mg [Capsella rubella]
 gb|EOA12477.1| hypothetical protein CARUB_v10025980mg [Capsella rubella]
Length=709

 Score =   364 bits (935),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 185/201 (92%), Positives = 197/201 (98%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  509  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  568

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+A+GG G
Sbjct  569  ENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAVGGAG  628

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY+RAT+IITT IDILHKLAQLL+EKE
Sbjct  629  GNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYARATEIITTQIDILHKLAQLLMEKE  688

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AEL+V+
Sbjct  689  TVDGEEFMSLFIDGQAELYVS  709



>ref|XP_010494162.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic 
[Camelina sativa]
Length=708

 Score =   364 bits (934),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 184/201 (92%), Positives = 197/201 (98%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  508  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  567

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+A+GG G
Sbjct  568  ENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAVGGAG  627

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY+RAT+I+TT IDILHKLAQLL+EKE
Sbjct  628  GNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYARATEIVTTQIDILHKLAQLLMEKE  687

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AEL+V+
Sbjct  688  TVDGEEFMSLFIDGQAELYVS  708



>ref|XP_010442152.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Camelina sativa]
Length=707

 Score =   363 bits (932),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 184/201 (92%), Positives = 197/201 (98%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  507  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  566

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+A+GG G
Sbjct  567  ENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAVGGAG  626

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY+RAT+I+TT IDILHKLAQLL+EKE
Sbjct  627  GNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYARATEIVTTQIDILHKLAQLLMEKE  686

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AEL+V+
Sbjct  687  TVDGEEFMSLFIDGQAELYVS  707



>ref|NP_568604.1| ATP-dependent zinc metalloprotease FTSH 5 [Arabidopsis thaliana]
 sp|Q9FH02.1|FTSH5_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 5, chloroplastic; 
Short=AtFTSH5; AltName: Full=Protein VARIEGATED 1; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10200.1| cell division protein FtsH [Arabidopsis thaliana]
 gb|AAM83215.1| AT5g42270/K5J14_7 [Arabidopsis thaliana]
 gb|AED94790.1| ATP-dependent zinc metalloprotease FTSH 5 [Arabidopsis thaliana]
Length=704

 Score =   362 bits (930),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 185/201 (92%), Positives = 196/201 (98%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  504  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  563

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+A+GG G
Sbjct  564  ENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAVGGAG  623

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY RA +IITT IDILHKLAQLLIEKE
Sbjct  624  GNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYVRAKEIITTQIDILHKLAQLLIEKE  683

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AEL+V+
Sbjct  684  TVDGEEFMSLFIDGQAELYVS  704



>ref|XP_002865544.1| hypothetical protein ARALYDRAFT_494803 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41803.1| hypothetical protein ARALYDRAFT_494803 [Arabidopsis lyrata subsp. 
lyrata]
Length=701

 Score =   362 bits (930),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 185/201 (92%), Positives = 196/201 (98%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  501  EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  560

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+A+GG G
Sbjct  561  ENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAVGGAG  620

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY RA +IITT IDILHKLAQLLIEKE
Sbjct  621  GNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYVRAKEIITTQIDILHKLAQLLIEKE  680

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AEL+V+
Sbjct  681  TVDGEEFMSLFIDGQAELYVS  701



>ref|XP_006409314.1| hypothetical protein EUTSA_v10022579mg [Eutrema salsugineum]
 gb|ESQ50767.1| hypothetical protein EUTSA_v10022579mg [Eutrema salsugineum]
Length=706

 Score =   362 bits (930),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 198/201 (99%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISI+PRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  506  EKKRLVAYHEAGHALVGALMPEYDPVAKISILPRGQAGGLTFFAPSEERLESGLYSRSYL  565

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+A+GG G
Sbjct  566  ENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAVGGAG  625

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY+RA +I+TT IDILHKLAQLLIEKE
Sbjct  626  GNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYARAKEIVTTQIDILHKLAQLLIEKE  685

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AEL+V+
Sbjct  686  TVDGEEFMSLFIDGQAELYVS  706



>dbj|BAN33747.1| ATP-dependent metalloprotease FtsH [Chrysanthemum x morifolium]
Length=698

 Score =   360 bits (923),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 189/201 (94%), Positives = 196/201 (98%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  498  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  557

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGG G
Sbjct  558  ENQMAVALGGRVAEEVIFGKDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGGG  617

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQ MS+QKDYSMATAD+VDAEVRELVERAY RAT IITT IDILHKLAQLLIEKE
Sbjct  618  GNPFLGQSMSSQKDYSMATADIVDAEVRELVERAYERATTIITTQIDILHKLAQLLIEKE  677

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+++
Sbjct  678  TVDGEEFMSLFIDGKAELYIS  698



>ref|XP_010482002.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Camelina sativa]
Length=710

 Score =   356 bits (914),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 181/201 (90%), Positives = 196/201 (98%), Gaps = 0/201 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMPEYD VAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  510  DKKRLVAYHEAGHALVGALMPEYDAVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  569

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+A+GG G
Sbjct  570  ENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAVGGAG  629

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQ MS+QKDYSMATADVVDAEVR+LVE+AY+RAT+I+TT IDILHKLAQLL+EKE
Sbjct  630  GNPFLGQSMSSQKDYSMATADVVDAEVRKLVEKAYARATEIVTTQIDILHKLAQLLMEKE  689

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDG+AEL+V+
Sbjct  690  TVDGEEFMSLFIDGQAELYVS  710



>sp|Q39444.1|FTSH_CAPAN RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
Flags: Precursor, partial [Capsicum annuum]
 emb|CAA62084.1| ATPase [Capsicum annuum]
Length=662

 Score =   353 bits (906),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 172/179 (96%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  484  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  543

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVER GFSKKIGQ+AIGG G
Sbjct  544  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERLGFSKKIGQVAIGGGG  603

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEK  154
            GNPFLGQQMSTQKDYSMATADVVD+EVRELVE+AY RA QIITTHIDILHKLAQLLIEK
Sbjct  604  GNPFLGQQMSTQKDYSMATADVVDSEVRELVEKAYERAKQIITTHIDILHKLAQLLIEK  662



>emb|CAA73318.1| ATPase [Arabidopsis thaliana]
Length=634

 Score =   349 bits (896),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHAL G   PEY+PVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  448  EKKRLVAYHEAGHALGGCSYPEYNPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  507

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMA +LGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPG
Sbjct  508  ENQMACSLGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPG  567

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKLAQLLIEKE
Sbjct  568  GNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKLAQLLIEKE  627

Query  150  TVDGEE  133
            TV GE+
Sbjct  628  TVAGED  633



>ref|XP_001760664.1| predicted protein [Physcomitrella patens]
 gb|EDQ74403.1| predicted protein [Physcomitrella patens]
Length=634

 Score =   344 bits (882),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EK+KLVAYHEAGHALVGALMPEYDPVAKISI+PRG AGGLTFFAPSEERLESGLYSRSYL
Sbjct  434  EKRKLVAYHEAGHALVGALMPEYDPVAKISIVPRGGAGGLTFFAPSEERLESGLYSRSYL  493

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEE+I+G +NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+++GG G
Sbjct  494  ENQMAVALGGRIAEELIYGAENVTTGASNDFMQVSRVARQMVERFGFSKKIGQLSLGGGG  553

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQ    Q D+SMATADV+DAEVRELVE AY+RA  I+ THIDILHKLA LL+EKE
Sbjct  554  GNPFLGQSAGQQSDHSMATADVIDAEVRELVETAYTRAKTIMETHIDILHKLAALLLEKE  613

Query  150  TVDGEEFMSLFIDGKAELFV  91
            TVDGEEF++LFIDG+AEL+V
Sbjct  614  TVDGEEFLNLFIDGQAELYV  633



>ref|XP_001753657.1| predicted protein [Physcomitrella patens]
 gb|EDQ81409.1| predicted protein [Physcomitrella patens]
Length=647

 Score =   342 bits (876),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EK+ LVAYHEAGHALVGALMPEYDPVAKISI+PRG AGGLTFFAPSEERLESGLYSRSYL
Sbjct  447  EKRTLVAYHEAGHALVGALMPEYDPVAKISIVPRGGAGGLTFFAPSEERLESGLYSRSYL  506

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEE+I+G +NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+++GG G
Sbjct  507  ENQMAVALGGRIAEELIYGTENVTTGASNDFMQVSRVARQMVERFGFSKKIGQLSLGGGG  566

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQ    Q D+SMATADV+DAEVRELVE AY+RA  I+ THIDILHKLA LL+EKE
Sbjct  567  GNPFLGQSAGQQSDHSMATADVIDAEVRELVETAYTRAKTIMETHIDILHKLAALLLEKE  626

Query  150  TVDGEEFMSLFIDGKAELFV  91
            TVDGEEF++LFIDG+AEL+V
Sbjct  627  TVDGEEFLNLFIDGQAELYV  646



>gb|AIS72760.1| ATP-dependent zinc metalloprotease chloroplastic-like protein, 
partial [Rhizophora apiculata]
Length=236

 Score =   326 bits (836),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  74   EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  133

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  134  ENQMAVALGGRVAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  193

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIIT  202
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AY+RA QI+T
Sbjct  194  GNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYTRAKQIVT  236



>gb|KJB14314.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=682

 Score =   334 bits (856),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 181/201 (90%), Gaps = 17/201 (8%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYH                 AKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  499  EKKKLVAYH-----------------AKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  541

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGG G
Sbjct  542  ENQMAVALGGRIAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGGG  601

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVR+LVE AY+RA QIITTHIDILHKLAQLL+EKE
Sbjct  602  GNPFLGQQMSSQKDYSMATADVVDAEVRDLVETAYTRAKQIITTHIDILHKLAQLLMEKE  661

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+V+
Sbjct  662  TVDGEEFMSLFIDGKAELYVS  682



>ref|XP_002510649.1| Cell division protease ftsH, putative [Ricinus communis]
 gb|EEF52836.1| Cell division protease ftsH, putative [Ricinus communis]
Length=692

 Score =   331 bits (849),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 173/201 (86%), Gaps = 27/201 (13%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKKKLVAYH                           AGGLTFFAPSEERLESGLYSRSYL
Sbjct  519  EKKKLVAYH---------------------------AGGLTFFAPSEERLESGLYSRSYL  551

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPG
Sbjct  552  ENQMAVALGGRVAEEVIFGDDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPG  611

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRA QIITTHIDILHKLAQLL+EKE
Sbjct  612  GNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRAKQIITTHIDILHKLAQLLVEKE  671

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVDGEEFMSLFIDGKAEL+V+
Sbjct  672  TVDGEEFMSLFIDGKAELYVS  692



>ref|XP_005650371.1| membrane AAA-metalloprotease [Coccomyxa subellipsoidea C-169]
 gb|EIE25827.1| membrane AAA-metalloprotease [Coccomyxa subellipsoidea C-169]
Length=736

 Score =   296 bits (759),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 169/199 (85%), Gaps = 0/199 (0%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            KK+LVAYHEAGHALVGALMPEYDPVAKISI+PRG AGGLTFFAPSEERLESGLYSRSYLE
Sbjct  521  KKRLVAYHEAGHALVGALMPEYDPVAKISIVPRGSAGGLTFFAPSEERLESGLYSRSYLE  580

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGR+AEE+IFGEDNVTTGASNDFMQV+R A+ MV + GFSKK+GQ+A  G GG
Sbjct  581  NQMAVALGGRIAEEIIFGEDNVTTGASNDFMQVARTAKMMVTQMGFSKKLGQVAWSGGGG  640

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLGQ M    D S  T+D +DAEV++LV+RAY RA  ++ ++I +LHK A++L+E+E 
Sbjct  641  PSFLGQSMGQPADCSGQTSDEIDAEVKQLVDRAYRRAKDLMQSNITVLHKTAEVLLEREQ  700

Query  147  VDGEEFMSLFIDGKAELFV  91
            +DG+EF+ L ++ +AE ++
Sbjct  701  IDGDEFLRLILESQAENYL  719



>gb|KJB57987.1| hypothetical protein B456_009G188700 [Gossypium raimondii]
Length=694

 Score =   295 bits (754),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  669  YHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVA  490
            + EAGHALVGAL+PEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVA
Sbjct  536  FTEAGHALVGALIPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVA  595

Query  489  LGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQ  310
            L GR+AEEVIFGE+NVTTGASNDFMQVSRVAR MVERFGFSKKIG++AIGGPGGNPFLGQ
Sbjct  596  LSGRIAEEVIFGEENVTTGASNDFMQVSRVARHMVERFGFSKKIGRVAIGGPGGNPFLGQ  655

Query  309  QMSTQKDYSMATADVVDAEVRELVERAYSRATQI  208
            QMS+QKDYSMATADVVDAEVR+LVE AYSRA QI
Sbjct  656  QMSSQKDYSMATADVVDAEVRDLVETAYSRAKQI  689



>ref|XP_007510744.1| cell division protein FtsH2 [Bathycoccus prasinos]
 emb|CCO18277.1| cell division protein FtsH2 [Bathycoccus prasinos]
Length=719

 Score =   294 bits (753),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 169/200 (85%), Gaps = 0/200 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHA+VGALMPEYDPVAKISI+PRG AGGLTFFAPSEERLESGLYSRSYL
Sbjct  507  KKKRLVAYHEAGHAIVGALMPEYDPVAKISIVPRGAAGGLTFFAPSEERLESGLYSRSYL  566

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVA+GGRVAEE+IFG ++VTTGAS DF QVS+ ARQM+E  GFSKKIGQIA+   G
Sbjct  567  ENQMAVAMGGRVAEELIFGAEDVTTGASGDFQQVSQTARQMIETMGFSKKIGQIALKTGG  626

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG +M    DY  ATAD+VD+EV+ELV +AY RA  +++ +ID+LHK+A +L+EKE
Sbjct  627  GQSFLGGEMGRSADYGPATADLVDSEVKELVTKAYRRAKDLVSINIDVLHKVADVLMEKE  686

Query  150  TVDGEEFMSLFIDGKAELFV  91
             +DG+EF  +  + K+EL++
Sbjct  687  NIDGDEFEKIMFNAKSELYL  706



>gb|KIY93255.1| cell division protease FtsH [Monoraphidium neglectum]
Length=548

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 164/200 (82%), Gaps = 0/200 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KKKLVAYHEAGHALVGALMP+YDPV KISI+PRG AGGLTFFAPSEERLESGLYSR+Y 
Sbjct  335  KKKKLVAYHEAGHALVGALMPDYDPVTKISIVPRGAAGGLTFFAPSEERLESGLYSRTYF  394

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEE+IFGED++TTGAS DF QV+R AR MV + GFSK +GQ+A    G
Sbjct  395  ENQMAVALGGRIAEELIFGEDDITTGASGDFQQVTRTARLMVTQLGFSKVLGQVAWSSGG  454

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLGQ M+   D+S  TAD +D EV+ LVERAY RA  +I ++IDILHK A +L+EKE
Sbjct  455  GNAFLGQSMAQPADFSSQTADEIDQEVKALVERAYRRAKDLIQSNIDILHKTAAVLLEKE  514

Query  150  TVDGEEFMSLFIDGKAELFV  91
             +DG+EF  + ++ +A+ ++
Sbjct  515  NIDGDEFQQIVLESQAQQYL  534



>ref|WP_025961749.1| hypothetical protein, partial [Prochlorococcus sp. scB245a_521C8]
Length=213

 Score =   273 bits (698),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 165/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  12   KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  71

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+KIG +A+G   
Sbjct  72   QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEKIGPVALGQSQ  131

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MST +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  132  GGMFLGRDMSTTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  191

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  192  TIDTEDIQDLL--NRSEVKVA  210



>dbj|BAH20250.1| AT5G42270 [Arabidopsis thaliana]
Length=215

 Score =   273 bits (698),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL
Sbjct  68   EKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  127

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+A+GG G
Sbjct  128  ENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAVGGAG  187

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVR  247
            GNPFLGQ MS+QKDYSMATADVVDAEVR
Sbjct  188  GNPFLGQSMSSQKDYSMATADVVDAEVR  215



>ref|WP_025929131.1| hypothetical protein, partial [Prochlorococcus sp. scB243_496A2]
Length=242

 Score =   273 bits (697),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 165/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  41   KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  100

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+KIG +A+G   
Sbjct  101  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEKIGPVALGQSQ  160

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  161  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  220

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  221  TIDTEDIQDLL--NRSEVKVA  239



>gb|KIZ03250.1| cell division protease FtsH [Monoraphidium neglectum]
Length=732

 Score =   286 bits (733),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 164/200 (82%), Gaps = 0/200 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KKKLVAYHEAGHALVGALMP+YDPV KISI+PRG AGGLTFFAPSEERLESGLYSR+Y 
Sbjct  521  KKKKLVAYHEAGHALVGALMPDYDPVTKISIVPRGAAGGLTFFAPSEERLESGLYSRTYF  580

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEE+IFGED++TTGAS DF QV+R AR MV + GFSK +GQ+A    G
Sbjct  581  ENQMAVALGGRIAEELIFGEDDITTGASGDFQQVTRTARLMVTQLGFSKALGQVAWSSGG  640

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLGQ M+   D+S  TAD +D EV+ LVERAY RA  +I ++IDILHK A +L+EKE
Sbjct  641  GNAFLGQSMAQPADFSSQTADEIDQEVKSLVERAYRRAKDLIQSNIDILHKTAAVLLEKE  700

Query  150  TVDGEEFMSLFIDGKAELFV  91
             +DG+EF  + ++ +A+ ++
Sbjct  701  NIDGDEFQQIVLESQAQQYL  720



>ref|XP_002948337.1| hypothetical protein VOLCADRAFT_80122 [Volvox carteri f. nagariensis]
 gb|EFJ50744.1| hypothetical protein VOLCADRAFT_80122 [Volvox carteri f. nagariensis]
Length=722

 Score =   286 bits (731),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 133/200 (67%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +K++LVAYHEAGHALVGALMPEYDPV KISI+PRG AGGLTFFAPSEERLESGLYSR+YL
Sbjct  509  KKRRLVAYHEAGHALVGALMPEYDPVTKISIVPRGAAGGLTFFAPSEERLESGLYSRTYL  568

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEE+IFGED++TTGAS DF QV+R+AR MV + G SKK+GQ+A    G
Sbjct  569  ENQMAVALGGRIAEELIFGEDDITTGASGDFQQVTRIARLMVTQLGLSKKLGQVAWSSSG  628

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG   +   D+S ATAD +D EV+ELVERAY RA  ++ ++IDILHK+A +LIEKE
Sbjct  629  GAQFLGASAAQPADFSQATADEIDNEVKELVERAYRRAKDLVVSNIDILHKVAAVLIEKE  688

Query  150  TVDGEEFMSLFIDGKAELFV  91
             +DG+EF  + +  +A+ ++
Sbjct  689  NIDGDEFQQIVLASQAQQYL  708



>ref|WP_006518079.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7375]
 gb|EKV03719.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7375]
Length=614

 Score =   281 bits (720),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 164/198 (83%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGLT+F PSEERLESGLYSRSYL
Sbjct  413  KRKSLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGLTWFTPSEERLESGLYSRSYL  472

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE++FG++ VTTGASND  QV+RVARQMV RFG S+K+G +A+G   
Sbjct  473  KNQMAVALGGRLAEEIVFGDEEVTTGASNDLQQVARVARQMVTRFGMSEKLGPVALGRQQ  532

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLG+ ++T++D+S  TA V+DAEVR LV+ AYSRA Q++  +  +L +LA +L++KE
Sbjct  533  GNPFLGRDIATERDFSEETAAVIDAEVRSLVDVAYSRAKQVLVENRKVLDQLADMLVDKE  592

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD +E   L ID    +
Sbjct  593  TVDSDELQRLLIDNNVSM  610



>ref|XP_001690889.1| membrane AAA-metalloprotease [Chlamydomonas reinhardtii]
 gb|EDP05335.1| membrane AAA-metalloprotease [Chlamydomonas reinhardtii]
Length=727

 Score =   284 bits (726),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 164/200 (82%), Gaps = 0/200 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +K++LVAYHEAGHALVGALMPEYDPV KISI+PRG AGGLTFFAPSEERLESGLYSR+YL
Sbjct  514  KKRRLVAYHEAGHALVGALMPEYDPVTKISIVPRGAAGGLTFFAPSEERLESGLYSRTYL  573

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEE+IFGED++TTGAS DF QV+R+AR MV + G SKK+GQ+A    G
Sbjct  574  ENQMAVALGGRIAEELIFGEDDITTGASGDFQQVTRIARLMVTQLGLSKKLGQVAWSNQG  633

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG   +   D+S +TAD +D+EV+ELVERAY RA  ++  +IDILHK+A +LIEKE
Sbjct  634  GASFLGASAAQPADFSQSTADEIDSEVKELVERAYRRAKDLVEQNIDILHKVAAVLIEKE  693

Query  150  TVDGEEFMSLFIDGKAELFV  91
             +DG+EF  + +  +A+ + 
Sbjct  694  NIDGDEFQQIVLASQAQQYT  713



>ref|WP_023072541.1| membrane protease catalytic subunit [Leptolyngbya sp. Heron Island 
J]
 gb|ESA36713.1| membrane protease catalytic subunit [Leptolyngbya sp. Heron Island 
J]
Length=614

 Score =   281 bits (718),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGLT+F PSEERLESGLYSRSYL
Sbjct  413  KRKSLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGLTWFTPSEERLESGLYSRSYL  472

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE++FG++ VTTGASND  QV+RVARQM+ RFG S+K+G +A+G   
Sbjct  473  KNQMAVALGGRLAEEIVFGDEEVTTGASNDLQQVARVARQMITRFGMSEKLGPVALGRQQ  532

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLG+ ++T++D+S  TA V+DAEVR LV+ AYSRA Q++  +  +L +LA++L++KE
Sbjct  533  GNPFLGRDIATERDFSEETAAVIDAEVRGLVDVAYSRAKQVLVENRKVLDQLAEMLVDKE  592

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD +E   L ID    +
Sbjct  593  TVDSDELQRLLIDNNVSM  610



>ref|WP_029963924.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_526K3]
Length=337

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  136  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  195

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  196  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  255

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  256  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  315

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  316  TIDTEDIQDLL--NRSEVKVA  334



>ref|WP_025947145.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_528N8]
Length=347

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  146  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  205

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  206  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  265

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  266  GGMFLGRDMSSSRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  325

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  326  TIDTEDIQDLL--NRSEVKVA  344



>ref|XP_002505995.1| hypothetical protein MICPUN_106506 [Micromonas sp. RCC299]
 gb|ACO67253.1| hypothetical protein MICPUN_106506 [Micromonas sp. RCC299]
Length=718

 Score =   280 bits (717),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 133/200 (67%), Positives = 163/200 (82%), Gaps = 0/200 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHA+VGALMPEYDPV KISI+PRG AGGLTFFAPSEERLESGLYSR+YL
Sbjct  505  KKKRLVAYHEAGHAIVGALMPEYDPVTKISIVPRGAAGGLTFFAPSEERLESGLYSRTYL  564

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVA+GGRVAEE+IFG +NVTTGAS DF QVSR AR M+E+ GFS+KIGQIA+   G
Sbjct  565  ENQMAVAMGGRVAEELIFGAENVTTGASGDFQQVSRTARMMIEQMGFSEKIGQIALKTGG  624

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG       DYS ATAD+VD+EV+ LVE AY RA  ++  +I  LH +A++L++KE
Sbjct  625  GQTFLGNDAGRGADYSQATADIVDSEVQALVEVAYRRAKDLVQENIQCLHDVAEVLLDKE  684

Query  150  TVDGEEFMSLFIDGKAELFV  91
             +DG+EF  + +  KA+L++
Sbjct  685  NIDGDEFEQIMLKAKAKLYL  704



>ref|XP_003057154.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58799.1| predicted protein [Micromonas pusilla CCMP1545]
Length=731

 Score =   280 bits (715),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 161/200 (81%), Gaps = 0/200 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHA+VGALMPEYDPV KISI+PRG AGGLTFFAPSEERLESGLYSR+YL
Sbjct  516  KKKRLVAYHEAGHAIVGALMPEYDPVTKISIVPRGNAGGLTFFAPSEERLESGLYSRTYL  575

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVA+GGR+AEE+IFG +NVTTGAS DF QVS  AR MVE+ GFS+KIGQIA+   G
Sbjct  576  ENQMAVAMGGRIAEELIFGAENVTTGASGDFQQVSNTARMMVEQMGFSEKIGQIALKTGG  635

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG       DYS  TA++VD EV+ LVE AY RA  ++  +ID LH +A++L+EKE
Sbjct  636  GQSFLGNDAGRAADYSQTTANIVDDEVKILVETAYRRAKDLVQENIDCLHAVAEVLLEKE  695

Query  150  TVDGEEFMSLFIDGKAELFV  91
             +DG+EF  + +  +A+L++
Sbjct  696  NIDGDEFEEIMLKARAKLYL  715



>ref|WP_025970576.1| cell division protein FtsH, partial [Prochlorococcus sp. scB245a_521M10]
Length=396

 Score =   270 bits (691),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  195  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  254

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  255  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  314

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  315  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  374

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  375  TIDTEDIQDLL--NRSEVKVA  393



>ref|WP_044452063.1| cell division protein FtsH, partial [Mastigocladus laminosus]
 gb|KIY10627.1| cell division protein FtsH, partial [Mastigocladus laminosus 
UU774]
Length=405

 Score =   269 bits (688),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYL
Sbjct  204  KRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYL  263

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S+K+G +A+G   
Sbjct  264  ENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSEKLGPVALGRQQ  323

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ + +++D+S  TA  VD EVR+LV+ AY+RA +++T +  +L +LA++L+EKE
Sbjct  324  GNMFLGRDIMSERDFSEETAAAVDEEVRQLVDSAYARAKKVLTENRHVLDQLAEMLVEKE  383

Query  150  TVDGEEFMSLF  118
            TVD EE   L 
Sbjct  384  TVDAEELQDLL  394



>ref|WP_025954333.1| cell division protein FtsH, partial [Prochlorococcus sp. scB243_498C16]
Length=445

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 165/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  244  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  303

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+KIG +A+G   
Sbjct  304  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEKIGPVALGQSQ  363

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  364  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  423

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  424  TIDTEDIQELL--NRSEVKVA  442



>ref|WP_025971093.1| cell division protein FtsH, partial [Prochlorococcus sp. scB245a_521N5]
Length=471

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  270  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  329

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  330  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  389

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  390  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  449

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  450  TIDTEDIQDLL--NRSEVKVA  468



>ref|WP_006911156.1| cell division protein FtsH [Cyanobium sp. PCC 7001]
 gb|EDY39239.1| ATP-dependent metalloprotease FtsH [Cyanobium sp. PCC 7001]
Length=614

 Score =   273 bits (697),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            +K+LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ESGLYSR+YL+
Sbjct  414  RKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMESGLYSRAYLQ  473

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGRVAEE+I+G+D VTTGASND  QV+RVARQMV RFG S+K+G +A+G   G
Sbjct  474  NQMAVALGGRVAEEIIYGDDEVTTGASNDLQQVARVARQMVTRFGMSEKLGPVALGRSQG  533

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLG+ ++ ++D+S  TA  +D EV +LVE AY RAT+++T +  +L +LA LL+EKET
Sbjct  534  GMFLGRDIAAERDFSEDTAATIDEEVSQLVEEAYRRATEVLTNNRAVLDQLADLLVEKET  593

Query  147  VDGEEFMSLFI  115
            VD EE   L I
Sbjct  594  VDAEELQELLI  604



>gb|KGF94553.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9201]
Length=580

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 165/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  379  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  438

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  439  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  498

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T + ++L ++AQ+LIE+E
Sbjct  499  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRNVLDEMAQMLIERE  558

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  559  TIDTEDIQDLL--NRSEVKVA  577



>ref|WP_035992112.1| cell division protein FtsH [Leptolyngbya sp. KIOST-1]
Length=613

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+RLESGLYSRSYL
Sbjct  412  KRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRLESGLYSRSYL  471

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S K+G +A+G   
Sbjct  472  QNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDKLGPVALGRQQ  531

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ ++ ++D+S  TA  +DAEVR LV++AY+RA Q++T +  +L +LA++L++KE
Sbjct  532  GNMFLGRDIAAERDFSEETAATIDAEVRGLVDQAYARAKQVLTNNRHVLDQLAKMLVDKE  591

Query  150  TVDGEEFMSLF  118
            TVD EE   L 
Sbjct  592  TVDSEELQHLL  602



>ref|WP_025958220.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_527L15]
Length=538

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  337  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  396

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  397  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  456

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  457  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  516

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  517  TIDTEDIQDLL--NRSEVKVA  535



>ref|WP_009455956.1| MULTISPECIES: cell division protein FtsH [Fischerella]
 gb|EHC16019.1| ATP-dependent metalloprotease FtsH [Fischerella sp. JSC-11]
Length=614

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYL
Sbjct  413  KRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYL  472

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S K+G +A+G   
Sbjct  473  ENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDKLGPVALGRQQ  532

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ + +++D+S  TA  +D EVR+LV+ AY+RA Q++T +  +L +LAQ+L+EKE
Sbjct  533  GNMFLGRDIMSERDFSEETAAAIDEEVRQLVDSAYARAKQVLTDNRHVLDQLAQMLVEKE  592

Query  150  TVDGEEFMSLF  118
            TVD EE   L 
Sbjct  593  TVDAEELQELL  603



>ref|WP_025944375.1| cell division protein FtsH [Prochlorococcus sp. scB241_529C4]
Length=617

 Score =   271 bits (694),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEERLESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERLESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_017297226.1| cell division protein FtsH [Nodosilinea nodulosa]
Length=613

 Score =   271 bits (694),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+RLESGLYSRSYL
Sbjct  412  KRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRLESGLYSRSYL  471

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S K+G +A+G   
Sbjct  472  QNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDKLGPVALGRQQ  531

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ ++ ++D+S  TA  +D+EVR LV++AY+RA Q++T +  +L +LA +L++KE
Sbjct  532  GNMFLGRDIAAERDFSEETAATIDSEVRGLVDQAYTRAKQVLTNNRHVLDQLANMLVDKE  591

Query  150  TVDGEEFMSLF  118
            TVD EE   L 
Sbjct  592  TVDSEELQQLL  602



>ref|WP_032522853.1| cell division protein FtsH [Prochlorococcus marinus]
Length=617

 Score =   271 bits (694),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 165/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T + ++L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRNVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>gb|KGG03814.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9321]
 gb|KGG10073.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9401]
Length=580

 Score =   270 bits (690),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  379  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  438

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  439  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  498

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+E
Sbjct  499  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRSVLDEMAQMLIERE  558

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  559  TIDTEDIQDLL--NRSEVVVA  577



>ref|WP_044106285.1| cell division protein FtsH [cyanobacterium endosymbiont of Epithemia 
turgida]
 dbj|BAP17558.1| cell division protein [cyanobacterium endosymbiont of Epithemia 
turgida isolate EtSB Lake Yunoko]
Length=616

 Score =   271 bits (692),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL
Sbjct  415  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYL  474

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  475  QNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQMVSRFGMSDRLGPVALGRQN  534

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +++ +D+S  TA V+D EVR+LV  AY RA  ++  +  IL KLA++L+EKE
Sbjct  535  GNVFLGRDIASDRDFSDETAAVIDEEVRQLVNNAYIRAKDVLVNNRHILDKLAEMLVEKE  594

Query  150  TVDGEEFMSLF  118
            TVD EE  S+ 
Sbjct  595  TVDAEELQSIL  605



>ref|WP_032519670.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGG08326.1| Cell division protein FtsH [Prochlorococcus marinus str. SB]
Length=617

 Score =   271 bits (692),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>gb|KGG06312.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9322]
Length=600

 Score =   270 bits (691),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  399  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  458

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  459  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  518

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+E
Sbjct  519  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRSVLDEMAQMLIERE  578

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  579  TIDTEDIQDLL--NRSEVVVA  597



>ref|WP_025951376.1| cell division protein FtsH [Prochlorococcus sp. scB243_495N4]
Length=617

 Score =   271 bits (692),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSSRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_032515715.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGG01911.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9314]
Length=617

 Score =   271 bits (692),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025971671.1| cell division protein FtsH [Prochlorococcus sp. scB241_527L22]
Length=617

 Score =   271 bits (692),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_015191439.1| ATP-dependent metalloprotease FtsH [Stanieria cyanosphaera]
 gb|AFZ33766.1| ATP-dependent metalloprotease FtsH [Stanieria cyanosphaera PCC 
7437]
Length=616

 Score =   271 bits (692),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL
Sbjct  415  KRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYL  474

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  475  QNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVTRVARQMVTRFGMSDRLGPVALGRQS  534

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +++ +D+S  TA  +D EVR LV++AY RA +++  +  IL KLA +L+EKE
Sbjct  535  GNVFLGRDIASDRDFSDETAAAIDEEVRNLVDQAYRRAKEVLVGNRHILDKLADMLVEKE  594

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD EEF  L  +   ++
Sbjct  595  TVDSEEFQDLLANNDVKM  612



>ref|WP_025969610.1| cell division protein FtsH [Prochlorococcus sp. scB245a_520E22]
Length=617

 Score =   271 bits (692),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKQLVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025964562.1| cell division protein FtsH [Prochlorococcus sp. scB243_498P15]
Length=617

 Score =   271 bits (692),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025922112.1| cell division protein FtsH [Prochlorococcus sp. scB241_529D18]
Length=617

 Score =   271 bits (692),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 165/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025959316.1| cell division protein FtsH [Prochlorococcus sp. scB241_527I9]
Length=617

 Score =   271 bits (692),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025980194.1| cell division protein FtsH [Prochlorococcus sp. scB243_498F21]
Length=617

 Score =   270 bits (691),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025935637.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   270 bits (691),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 165/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025892538.1| cell division protein FtsH [Prochlorococcus sp. scB241_527N11]
Length=617

 Score =   270 bits (691),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_011862269.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABO16871.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9301]
Length=617

 Score =   270 bits (691),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025900256.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   270 bits (691),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 165/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQELL--NRSEVKVA  614



>ref|WP_025890345.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   270 bits (691),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025967396.1| cell division protein FtsH [Prochlorococcus sp. scB243_498P3]
Length=617

 Score =   270 bits (691),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGLFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025939914.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   270 bits (691),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025924120.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   270 bits (691),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_032517345.1| cell division protein FtsH [Prochlorococcus marinus]
Length=617

 Score =   270 bits (691),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRSVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVVVA  614



>ref|WP_036973151.1| cell division protein FtsH, partial [Prochlorococcus sp. MIT 
0703]
Length=402

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            +K+LVAYHE+GHALVGALMP+YD V KISIIPRGQAGGLTFF PSEER+ESGLYSR+YL+
Sbjct  202  RKQLVAYHESGHALVGALMPDYDSVQKISIIPRGQAGGLTFFTPSEERMESGLYSRAYLQ  261

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G +A+G   G
Sbjct  262  NQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLGPVALGRSQG  321

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLG+ +++++D+S  TA ++DAEV +LV+ AY RAT+++  +  +L +LA LL+EKET
Sbjct  322  GMFLGRDIASERDFSEDTAAIIDAEVSDLVDVAYKRATKVLIENRSVLDELADLLVEKET  381

Query  147  VDGEEFMSLFI  115
            VD ++   L I
Sbjct  382  VDAQDLQELLI  392



>gb|ABX08179.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9211]
Length=602

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            +K+LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ESGLYSRSYL 
Sbjct  402  RKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMESGLYSRSYLH  461

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G +A+G   G
Sbjct  462  NQMAVALGGRVAEEIVYGEDEVTTGASNDLKQVAQVARQMVTRFGMSDKLGPVALGRSQG  521

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLG+ +++++D+S  TA  +D EV +LV+ AY RAT+++T +  +L +LA++L+EKET
Sbjct  522  GMFLGRDIASERDFSEDTAATIDEEVSQLVDMAYKRATKVLTNNRQVLDQLAEMLVEKET  581

Query  147  VDGEEFMSLFIDGKAEL  97
            V+ E+   L I  + E+
Sbjct  582  VNSEDLQDLLIQSQVEV  598



>gb|KGG30054.1| cell division protein FtsH2 [Prochlorococcus sp. MIT 0703]
Length=397

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            +K+LVAYHE+GHALVGALMP+YD V KISIIPRGQAGGLTFF PSEER+ESGLYSR+YL+
Sbjct  197  RKQLVAYHESGHALVGALMPDYDSVQKISIIPRGQAGGLTFFTPSEERMESGLYSRAYLQ  256

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G +A+G   G
Sbjct  257  NQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLGPVALGRSQG  316

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLG+ +++++D+S  TA ++DAEV +LV+ AY RAT+++  +  +L +LA LL+EKET
Sbjct  317  GMFLGRDIASERDFSEDTAAIIDAEVSDLVDVAYKRATKVLIENRSVLDELADLLVEKET  376

Query  147  VDGEEFMSLFI  115
            VD ++   L I
Sbjct  377  VDAQDLQELLI  387



>ref|WP_017320405.1| cell division protein FtsH [cyanobacterium PCC 7702]
Length=614

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYL
Sbjct  413  KRKQLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYL  472

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV R+G S+K+G +A+G   
Sbjct  473  ENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRYGMSEKLGPVALGRQQ  532

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +  ++D+S  TA  +D EVR+LV+ AY RA Q++T +  IL +LAQLL+EKE
Sbjct  533  GNMFLGRDIMAERDFSEETAAAIDEEVRKLVDAAYKRAKQVLTENRHILDQLAQLLMEKE  592

Query  150  TVDGEEFMSLF  118
            TVD EE   L 
Sbjct  593  TVDAEELQELL  603



>ref|WP_041391000.1| cell division protein FtsH [Prochlorococcus marinus]
Length=615

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            +K+LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ESGLYSRSYL 
Sbjct  415  RKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMESGLYSRSYLH  474

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G +A+G   G
Sbjct  475  NQMAVALGGRVAEEIVYGEDEVTTGASNDLKQVAQVARQMVTRFGMSDKLGPVALGRSQG  534

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLG+ +++++D+S  TA  +D EV +LV+ AY RAT+++T +  +L +LA++L+EKET
Sbjct  535  GMFLGRDIASERDFSEDTAATIDEEVSQLVDMAYKRATKVLTNNRQVLDQLAEMLVEKET  594

Query  147  VDGEEFMSLFIDGKAEL  97
            V+ E+   L I  + E+
Sbjct  595  VNSEDLQDLLIQSQVEV  611



>gb|KGF88464.1| cell division protein FtsH2 [Prochlorococcus marinus str. GP2]
Length=580

 Score =   269 bits (687),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  379  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  438

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  439  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  498

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV +LV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  499  GGMFLGRDMSSTRDFSEDTAATIDVEVSDLVDVAYKRATKVLTDNRTVLDEMAQMLIERE  558

Query  150  TVDGEEFMSLF  118
            T+D E+   L 
Sbjct  559  TIDTEDIQDLL  569



>ref|WP_025956453.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQM+VALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMSVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_017312914.1| cell division protein FtsH [Fischerella sp. PCC 9339]
Length=614

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYL
Sbjct  413  KRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYL  472

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S+K+G +A+G   
Sbjct  473  ENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSEKLGPVALGRQQ  532

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ + +++D+S  TA  VD EVR+LV+ AY+RA +++T +  +L +LA++L+EKE
Sbjct  533  GNMFLGRDIMSERDFSEETAAAVDEEVRQLVDSAYARAKKVLTENRHVLDQLAEMLVEKE  592

Query  150  TVDGEEFMSLF  118
            TVD EE   L 
Sbjct  593  TVDAEELQDLL  603



>ref|WP_012593655.1| MULTISPECIES: cell division protein FtsH [Cyanothece]
 gb|ACK64378.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 8801]
 gb|ACU99241.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 8802]
Length=616

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL
Sbjct  415  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYL  474

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  475  QNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQMVSRFGMSDRLGPVALGRQN  534

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +++ +D+S  TA  +D EVR+LV++AY RA  ++  +  IL KLAQ+L+EKE
Sbjct  535  GNVFLGRDIASDRDFSDETAAAIDEEVRQLVDQAYKRAKDVLVNNRHILDKLAQMLVEKE  594

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD +E   +    + ++
Sbjct  595  TVDADELQEILTSNEVKM  612



>ref|WP_025937982.1| cell division protein FtsH [Prochlorococcus sp. scB245a_519A13]
Length=617

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV +LV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSDLVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQELL--NRSEVTVA  614



>ref|WP_025922823.1| cell division protein FtsH [Prochlorococcus sp. scB243_495D8]
Length=617

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRIVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025925903.1| cell division protein FtsH [Prochlorococcus sp. scB241_528J8]
Length=617

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_016862523.1| cell division protein FtsH [Fischerella muscicola]
Length=614

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYL
Sbjct  413  KRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYL  472

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S+K+G +A+G   
Sbjct  473  ENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSEKLGPVALGRQQ  532

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ + +++D+S  TA  VD EVR+LV+ AY+RA +++T +  +L +LA++L+EKE
Sbjct  533  GNMFLGRDIMSERDFSEETAAAVDEEVRQLVDSAYARAKKVLTENRHVLDQLAEMLVEKE  592

Query  150  TVDGEEFMSLF  118
            TVD EE   L 
Sbjct  593  TVDAEELQDLL  603



>gb|AIQ94296.1| Cell division protein FtsH [Prochlorococcus sp. MIT 0604]
Length=603

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  402  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  461

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  462  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  521

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+E
Sbjct  522  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEMAQMLIERE  581

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  582  TIDTEDIQDLL--NRSEVKVA  600



>ref|WP_025979191.1| cell division protein FtsH [Prochlorococcus sp. scB243_497E17]
Length=617

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_012007029.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABV49865.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9215]
Length=617

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025941250.1| cell division protein FtsH [Prochlorococcus sp. scB245a_518O7]
Length=617

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV +LV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSQLVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_042849723.1| cell division protein FtsH [Prochlorococcus sp. MIT 0604]
Length=617

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025937318.1| cell division protein FtsH [Prochlorococcus sp. scB245a_519O21]
Length=617

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_002806664.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|EEE40173.1| ATP-dependent metallopeptidase HflB subfamily protein [Prochlorococcus 
marinus str. MIT 9202]
Length=617

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_011817719.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABM69535.1| cell division protein FtsH2 [Prochlorococcus marinus str. AS9601]
Length=617

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025933036.1| cell division protein FtsH [Prochlorococcus sp. scB243_498A3]
Length=617

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025971407.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_527L16]
Length=598

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  397  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  456

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  457  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  516

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  517  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  576

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T++ E+   L    ++E+ VA
Sbjct  577  TINTEDIQDLL--NRSEVKVA  595



>ref|WP_025921388.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025914082.1| cell division protein FtsH [Prochlorococcus sp. scB245a_520K10]
Length=617

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_032523992.1| cell division protein FtsH [Prochlorococcus marinus]
Length=617

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV +LV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSDLVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLF  118
            T+D E+   L 
Sbjct  596  TIDTEDIQDLL  606



>ref|WP_026723275.1| cell division protein FtsH [Fischerella sp. PCC 9431]
Length=614

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYL
Sbjct  413  KRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYL  472

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S+K+G +A+G   
Sbjct  473  ENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSEKLGPVALGRQQ  532

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ + +++D+S  TA  +D EVR+LV+ AY+RA +++T +  +L +LA++L+EKE
Sbjct  533  GNMFLGRDIMSERDFSEETAAAIDEEVRQLVDSAYARAKKVLTDNRHVLDQLAEMLVEKE  592

Query  150  TVDGEEFMSLF  118
            TVD EE   L 
Sbjct  593  TVDAEELQDLL  603



>ref|WP_025965256.1| cell division protein FtsH [Prochlorococcus sp. scB243_496M6]
Length=617

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDIAYKRATKVLSDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025929709.1| cell division protein FtsH [Prochlorococcus sp. scB241_528O2]
Length=617

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHAIVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  IL ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDEEVSELVDMAYKRATKVLSDNRTILDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025981174.1| cell division protein FtsH [Prochlorococcus sp. scB245a_521B10]
Length=617

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T++ E+   L    ++E+ VA
Sbjct  596  TINTEDIQDLL--NRSEVKVA  614



>ref|WP_025925013.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T++ E+   L    ++E+ VA
Sbjct  596  TINTEDIQDLL--NRSEVKVA  614



>ref|WP_010871638.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 ref|NP_440330.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 sp|P72991.1|FTSH3_SYNY3 RecName: Full=ATP-dependent zinc metalloprotease FtsH 3 [Synechocystis 
sp. PCC 6803 substr. Kazusa]
 dbj|BAA17010.1| cell division protein; FtsH [Synechocystis sp. PCC 6803]
 dbj|BAK49182.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 dbj|BAL28181.1| cell division protein FtsH [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL31351.1| cell division protein FtsH [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL34520.1| cell division protein FtsH [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 dbj|BAM50723.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 gb|AGF50699.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
Length=616

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL
Sbjct  415  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYL  474

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G  G
Sbjct  475  QNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQG  534

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ +++ +D+S  TA  +D EV +LV++AY RA Q++  +  IL +LA++L+EKE
Sbjct  535  GGVFLGRDIASDRDFSDETAAAIDEEVSQLVDQAYQRAKQVLVENRGILDQLAEILVEKE  594

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD EE  +L  +  A+L
Sbjct  595  TVDSEELQTLLANNNAKL  612



>dbj|GAL91410.1| cell division protein FtsH [Microcystis aeruginosa NIES-44]
Length=617

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSR+YL
Sbjct  416  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRAYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  476  QNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQN  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +LAQ+L+EKE
Sbjct  536  GNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRTILDQLAQMLVEKE  595

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD EE  ++  +   ++
Sbjct  596  TVDAEELQNILANNDVKM  613



>ref|WP_015188582.1| membrane protease FtsH catalytic subunit [Gloeocapsa sp. PCC 
7428]
 gb|AFZ30709.1| membrane protease FtsH catalytic subunit [Gloeocapsa sp. PCC 
7428]
Length=612

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+E+GLYSRSYL
Sbjct  411  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMETGLYSRSYL  470

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  471  ENQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQQ  530

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +  ++D+S  TA  +D EVRELVE AY RA +++ ++  IL +LAQ+LI+KE
Sbjct  531  GNMFLGRDIVAERDFSEETAAAIDDEVRELVEVAYRRAKEVLVSNRHILDQLAQMLIDKE  590

Query  150  TVDGEEFMSLF  118
            TVD EE   L 
Sbjct  591  TVDAEELQELL  601



>ref|WP_008275101.1| cell division protein FtsH [Cyanothece sp. CCY0110]
 gb|EAZ91781.1| cell division protein; FtsH [Cyanothece sp. CCY0110]
Length=617

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL
Sbjct  416  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  476  QNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQN  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +++ +D+S  TA  +D EVR+LV+ AYSRA  ++ ++  IL +LA +L+EKE
Sbjct  536  GNVFLGRDIASDRDFSNETASTIDNEVRQLVDTAYSRAKDVLESNRHILDRLADMLVEKE  595

Query  150  TVDGEEFMSLF  118
            TVD +E   + 
Sbjct  596  TVDSDELQEIL  606



>ref|XP_011396167.1| ATP-dependent zinc metalloprotease FTSH 5, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM23297.1| ATP-dependent zinc metalloprotease FTSH 5, chloroplastic [Auxenochlorella 
protothecoides]
Length=726

 Score =   271 bits (693),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 159/199 (80%), Gaps = 0/199 (0%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            K++LVAYHE GHALVGALMPEYD V+KISI+PRG AGGLTFFAPSEERLE+GLYSRSYLE
Sbjct  510  KRRLVAYHEGGHALVGALMPEYDAVSKISIVPRGNAGGLTFFAPSEERLENGLYSRSYLE  569

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQM+VALGGRVAEE+I G DNVTTGAS DF QV+RVAR MVE+ GFS  +GQ+A    GG
Sbjct  570  NQMSVALGGRVAEELILGPDNVTTGASGDFQQVTRVARMMVEQMGFSDSLGQVAWSQSGG  629

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLG QM+   + S  T D++D EV+ LV+RAY RA  +I  +I +LH+ A++L+EKE 
Sbjct  630  GSFLGAQMAQPANCSGETQDIIDKEVKSLVDRAYRRAKDLIQNNISVLHRTAEILLEKEQ  689

Query  147  VDGEEFMSLFIDGKAELFV  91
            +DGEE  +L ++ ++E ++
Sbjct  690  MDGEELQALLLEAQSEQYL  708



>ref|WP_016867387.1| cell division protein FtsH [Fischerella muscicola]
Length=614

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYL
Sbjct  413  KRKQLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYL  472

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S K+G +A+G   
Sbjct  473  ENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDKLGPVALGRQQ  532

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ + +++D+S  TA  +D EV +LV+ AY+RA Q++T +  IL +LA++L+EKE
Sbjct  533  GNMFLGRDIMSERDFSEETAAAIDEEVHQLVDSAYARAKQVLTDNRHILDQLAEMLVEKE  592

Query  150  TVDGEEFMSLF  118
            TVD EE   L 
Sbjct  593  TVDAEELQELL  603



>ref|WP_011375794.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABB49290.1| membrane protease FtsH catalytic subunit [Prochlorococcus marinus 
str. MIT 9312]
 gb|KGG00943.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9311]
Length=617

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDIAYKRATKVLSDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLF  118
            T+D E+   L 
Sbjct  596  TIDTEDIQDLL  606



>ref|WP_036901462.1| cell division protein FtsH [Prochlorococcus sp. MIT 0601]
 gb|KGG13140.1| Cell division protein FtsH [Prochlorococcus sp. MIT 0601]
Length=615

 Score =   268 bits (685),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 166/200 (83%), Gaps = 2/200 (1%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            +K+LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ESGLYSRSYL+
Sbjct  415  RKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMESGLYSRSYLQ  474

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG S+K+G +A+G   G
Sbjct  475  NQMAVALGGRVAEEIVYGEDEVTTGASNDLTQVAQVARQMVTRFGMSEKLGPVALGRSQG  534

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLG+ +++++D+S  TA  +D EV +LV+ AY RAT+++  +  +L +LA++L+EKET
Sbjct  535  GMFLGRDIASERDFSEDTAATIDEEVSQLVDFAYKRATKVLIDNRKVLDELAEMLVEKET  594

Query  147  VDGEEFMSLFIDGKAELFVA  88
            VD E+  +L I  K+E+ +A
Sbjct  595  VDSEQLQNLLI--KSEVKIA  612



>ref|WP_002784350.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa]
 emb|CCI13887.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9806]
Length=617

 Score =   268 bits (685),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSR+YL
Sbjct  416  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRAYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  476  QNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQN  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +LAQ+L+EKE
Sbjct  536  GNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRAILDQLAQMLVEKE  595

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD EE  ++  +   ++
Sbjct  596  TVDAEELQNILANNDVKM  613



>ref|WP_028953545.1| cell division protein FtsH [Synechococcus sp. CC9616]
Length=615

 Score =   268 bits (685),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 155/191 (81%), Gaps = 0/191 (0%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            KK+LVAYHEAGHALVGALMP+YDPV KISIIPRG AGGLTFF PSEER+ESGLYSR+YL+
Sbjct  415  KKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGNAGGLTFFTPSEERMESGLYSRAYLQ  474

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGRVAEE+I+GED VTTGASND  QV++VARQM+ RFG S K+G +A+G   G
Sbjct  475  NQMAVALGGRVAEEIIYGEDEVTTGASNDLQQVAQVARQMITRFGMSDKLGPVALGRSQG  534

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLG+ ++ ++D+S  TA  +D EV +LV+ AY RATQ++  +  +L +LA LL+EKET
Sbjct  535  GMFLGRDIAAERDFSEDTASTIDQEVYDLVDVAYKRATQVLVDNRSVLDELADLLVEKET  594

Query  147  VDGEEFMSLFI  115
            VD EE   L I
Sbjct  595  VDAEELQELLI  605



>ref|WP_002797753.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI26104.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9809]
Length=617

 Score =   268 bits (685),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSR+YL
Sbjct  416  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRAYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  476  QNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQN  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +LAQ+L+EKE
Sbjct  536  GNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRAILDQLAQMLVEKE  595

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD EE  ++  +   ++
Sbjct  596  TVDAEELQNILANNDVKM  613



>ref|WP_002763074.1| MULTISPECIES: cell division protein FtsH [Microcystis]
 emb|CCH99625.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9717]
 emb|CCI33922.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis sp. T1-4]
Length=617

 Score =   268 bits (685),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSR+YL
Sbjct  416  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRAYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  476  QNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQN  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +LAQ+L+EKE
Sbjct  536  GNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRAILDQLAQMLVEKE  595

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD EE  ++  +   ++
Sbjct  596  TVDAEELQNILANNDVKM  613



>ref|WP_032514590.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGF89182.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9107]
 gb|KGF89938.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9116]
 gb|KGF95373.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9123]
Length=617

 Score =   268 bits (684),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEERLESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERLESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ M++ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+E
Sbjct  536  GGMFLGRDMTSSRDFSEDTAATIDEEVSELVDIAYKRATKVLSDNRTVLDEMAQMLIERE  595

Query  150  TVDGEEFMSLF  118
            T+D E+   L 
Sbjct  596  TIDTEDIQDLL  606



>ref|WP_002801795.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI35504.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9701]
Length=617

 Score =   268 bits (684),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSR+YL
Sbjct  416  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRAYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  476  QNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQN  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +LAQ+L+EKE
Sbjct  536  GNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRVILDQLAQMLVEKE  595

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD EE  ++  +   ++
Sbjct  596  TVDAEELQNILANNDVKM  613



>ref|WP_002771354.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI04533.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9443]
Length=617

 Score =   268 bits (684),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSR+YL
Sbjct  416  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRAYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  476  QNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQN  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +LAQ+L+EKE
Sbjct  536  GNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRAILDQLAQMLVEKE  595

Query  150  TVDGEEFMSLF  118
            TVD EE  ++ 
Sbjct  596  TVDAEELQNIL  606



>ref|WP_016876546.1| cell division protein FtsH [Chlorogloeopsis fritschii]
Length=614

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYL
Sbjct  413  KRKQLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYL  472

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S+ +G +A+G   
Sbjct  473  ENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSETLGPVALGRQQ  532

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ + +++D+S  TA  +D EVR+LV+ AY RA Q++T +  +L +LA++L+EKE
Sbjct  533  GNMFLGRDIMSERDFSEETAAAIDEEVRKLVDAAYKRAKQVLTDNRHVLDQLAEMLVEKE  592

Query  150  TVDGEEFMSLF  118
            TVD EE   L 
Sbjct  593  TVDAEELQELL  603



>ref|WP_006453661.1| cell division protein FtsH [Synechococcus sp. PCC 7335]
 gb|EDX83917.1| ATP-dependent metallopeptidase HflB subfamily [Synechococcus 
sp. PCC 7335]
Length=613

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEERLESGLYSRSYL
Sbjct  412  KRKVLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEERLESGLYSRSYL  471

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE++FG++ VTTGASND  QV+  ARQMV RFG S  +G +A+G   
Sbjct  472  QNQMAVALGGRLAEEIVFGDEEVTTGASNDLQQVANTARQMVTRFGMSDILGPVALGRQQ  531

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GNPFLG+ +++++D+S  TA  +DAEVR LV++AY+R  Q++  +  IL +LA +L++KE
Sbjct  532  GNPFLGRDIASERDFSEKTAASIDAEVRALVDQAYARCKQVLVENRHILDQLADMLVDKE  591

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD EE  +L  +  A++
Sbjct  592  TVDSEELQTLLANSNAKM  609



>ref|WP_002793446.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI24284.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9808]
Length=617

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSR+YL
Sbjct  416  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRAYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  476  QNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQN  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +LAQ+L+EKE
Sbjct  536  GNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRAILDQLAQMLVEKE  595

Query  150  TVDGEEFMSLF  118
            TVD EE  ++ 
Sbjct  596  TVDAEELQNIL  606



>ref|WP_015220601.1| membrane protease FtsH catalytic subunit [Cyanobacterium aponinum]
 gb|AFZ54879.1| membrane protease FtsH catalytic subunit [Cyanobacterium aponinum 
PCC 10605]
Length=615

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 163/198 (82%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHALVGALMP+YDP+ KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL
Sbjct  414  KRKELVAYHEAGHALVGALMPDYDPIQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYL  473

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE++FGE+ VTTGASND  QV+RVARQM+ RFG S+++G +A+G   
Sbjct  474  QNQMAVALGGRVAEEIVFGEEEVTTGASNDLQQVARVARQMITRFGMSERLGPVALGRQN  533

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +++ +D+S +TA ++D EV++LV+ AY RA  ++  + ++L  LAQ+L+EKE
Sbjct  534  GNVFLGRDIASDRDFSDSTAAMIDEEVKKLVDVAYQRAKDVLQNNREVLDTLAQMLVEKE  593

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD EE   L  +   +L
Sbjct  594  TVDSEELQELLNNNDVKL  611



>ref|WP_002737367.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa]
 gb|ELP54710.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
TAIHU98]
Length=617

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSR+YL
Sbjct  416  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRAYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  476  QNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQN  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +LAQ+L+EKE
Sbjct  536  GNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRAILDQLAQMLVEKE  595

Query  150  TVDGEEFMSLF  118
            TVD EE  ++ 
Sbjct  596  TVDAEELQNIL  606



>ref|WP_012264056.1| cell division protein FtsH [Microcystis aeruginosa]
 dbj|BAG00204.1| cell division protein [Microcystis aeruginosa NIES-843]
Length=617

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSR+YL
Sbjct  416  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRAYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  476  QNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQN  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +LAQ+L+EKE
Sbjct  536  GNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRVILDQLAQMLVEKE  595

Query  150  TVDGEEFMSLF  118
            TVD EE  ++ 
Sbjct  596  TVDAEELQNIL  606



>ref|WP_002742170.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CAO87142.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 emb|CCH94297.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9432]
 emb|CCI05461.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 7941]
 emb|CCI18127.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9807]
 gb|ELS49082.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
DIANCHI905]
 gb|EPF21392.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
SPC777]
Length=617

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSR+YL
Sbjct  416  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRAYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  476  QNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQN  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +LAQ+L+EKE
Sbjct  536  GNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRAILDQLAQMLVEKE  595

Query  150  TVDGEEFMSLF  118
            TVD EE  ++ 
Sbjct  596  TVDAEELQNIL  606



>ref|WP_017303138.1| cell division protein FtsH [Spirulina subsalsa]
Length=616

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYL
Sbjct  415  KRKQLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYL  474

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  475  QNQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQQ  534

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+++++ +D+S  TA  +D EVR+LV++AYSRA  +++++  IL  LA +L+EKE
Sbjct  535  GNVFLGREIASDRDFSDETAAAIDEEVRKLVDQAYSRAKDVLSSNRHILDALADMLVEKE  594

Query  150  TVDGEEFMSLF  118
            TVD EE  ++ 
Sbjct  595  TVDAEELQNIL  605



>ref|WP_013320241.1| cell division protein FtsH [Cyanothece sp. PCC 7822]
 gb|ADN12131.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7822]
Length=616

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL
Sbjct  415  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYL  474

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  475  QNQMAVALGGRLAEEIVFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQN  534

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+++++ +D+S  TA  +D EVR LV++AY RA +++  +  IL KLA +LIEKE
Sbjct  535  GNVFLGREIASDRDFSDETAAAIDEEVRNLVDQAYRRAKEVLVNNRHILDKLADMLIEKE  594

Query  150  TVDGEEFMSLF  118
            TVD EE   + 
Sbjct  595  TVDAEELQDVL  605



>ref|WP_015109466.1| ATP-dependent metalloprotease FtsH [Cyanobium gracile]
 gb|AFY29018.1| ATP-dependent metalloprotease FtsH [Cyanobium gracile PCC 6307]
Length=614

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            +K+LVAYHE+GHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ESGLYSRSYL+
Sbjct  414  RKRLVAYHESGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMESGLYSRSYLQ  473

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGRVAEE+++GED VTTGASND  QV+RVARQMV RFG S ++G +A+G   G
Sbjct  474  NQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRAQG  533

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLG+ ++ ++D+S  TA  +D EV +LV  AY RAT+++  +  +L +LA+LL+EKET
Sbjct  534  GMFLGRDIAAERDFSEDTAAAIDEEVSQLVADAYRRATEVLLANRAVLDELAELLVEKET  593

Query  147  VDGEEFMSLFI  115
            VD EE   L I
Sbjct  594  VDAEELQELLI  604



>ref|WP_028949001.1| cell division protein FtsH [Synechocystis sp. PCC 6714]
 gb|AIE73467.1| Cell division protein FtsH [Synechocystis sp. PCC 6714]
Length=616

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL
Sbjct  415  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYL  474

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G  G
Sbjct  475  QNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQG  534

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ +++ +D+S  TA  +D EV +LV++AY RA +++  +  IL +LA++L+EKE
Sbjct  535  GGVFLGRDIASDRDFSDETAAAIDEEVSQLVDQAYQRAKRVLVENRGILDQLAEMLVEKE  594

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD EE  +L     A+L
Sbjct  595  TVDSEELQTLLASNNAKL  612



>ref|WP_006102026.1| cell division protein FtsH [Coleofasciculus chthonoplastes]
 gb|EDX74695.1| ATP-dependent metallopeptidase HflB subfamily [Coleofasciculus 
chthonoplastes PCC 7420]
Length=612

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHALVGALMP+YDPV K+SIIPRG+AGGLT+F PSE+R++SGLYSRSYL
Sbjct  411  KRKRLVAYHEAGHALVGALMPDYDPVQKVSIIPRGRAGGLTWFTPSEDRMDSGLYSRSYL  470

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQM+ RFG S ++G +A+G   
Sbjct  471  QNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMITRFGMSDRLGPVALGRQN  530

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +++ +D+S  TA  +D EVR+LV+ AY+RA  ++  +  IL KL+ +LIEKE
Sbjct  531  GNMFLGRDIASDRDFSNTTAATIDEEVRKLVDEAYNRAKDVLVGNKHILDKLSAMLIEKE  590

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD EE   L  +   ++
Sbjct  591  TVDAEELQELLAENDVKM  608



>ref|WP_035832496.1| cell division protein FtsH [Cyanobium sp. CACIAM 14]
 gb|KEF41405.1| cell division protein FtsH [Cyanobium sp. CACIAM 14]
Length=614

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            +K+LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ESGLYSR+YL+
Sbjct  414  RKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMESGLYSRAYLQ  473

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGRVAEE+++GED VTTGASND  QV+RVARQMV RFG S ++G +A+G   G
Sbjct  474  NQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRAQG  533

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLG+ ++ ++D+S  TA  +D EV  LV  AY RAT ++  +  +L +LA+LL+EKET
Sbjct  534  GMFLGRDIAAERDFSEDTAAAIDEEVSALVAEAYRRATDVLVANRSVLDELAELLVEKET  593

Query  147  VDGEEFMSLFI  115
            VD EE   L I
Sbjct  594  VDAEELQELLI  604



>ref|WP_009545257.1| MULTISPECIES: cell division protein FtsH [Cyanothece]
 gb|ACB52927.1| cell division protein [Cyanothece sp. ATCC 51142]
Length=617

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL
Sbjct  416  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  476  QNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQN  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +++ +D+S  TA  +D EVR+LV+ AY RA  ++ ++  IL +LA +L+EKE
Sbjct  536  GNVFLGRDIASDRDFSNETASTIDEEVRQLVDTAYKRAKDVLESNRHILDRLADMLVEKE  595

Query  150  TVDGEEFMSLF  118
            TVD +E   + 
Sbjct  596  TVDSDELQEIL  606



>ref|WP_009556886.1| ATP-dependent metalloprotease FtsH [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ68121.1| ATP-dependent metalloprotease FtsH [Oscillatoriales cyanobacterium 
JSC-12]
Length=624

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYL
Sbjct  423  KRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYL  482

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  483  QNQMAVALGGRIAEELVFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQQ  542

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ ++ ++D+S  TA  +D EVR LV++AY RA  ++T +  +L KLAQ+L+EKE
Sbjct  543  GNMFLGRDIAAERDFSEETAAAIDDEVRNLVDQAYRRAKAVLTQNRAVLDKLAQMLVEKE  602

Query  150  TVDGEEFMSLF  118
            TVD EE   L 
Sbjct  603  TVDAEELQDLL  613



>gb|ADF81075.1| FtsH [Corallina officinalis]
Length=221

 Score =   254 bits (649),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 158/200 (79%), Gaps = 1/200 (1%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            +K LVAYHEAGHA+VGAL P+YD VAKI+IIPRG AGGLTFFAP+E+R++SGLYSR +LE
Sbjct  17   RKALVAYHEAGHAIVGALTPDYDQVAKITIIPRGGAGGLTFFAPNEQRVDSGLYSRQFLE  76

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
             Q+AVALGGR+AEE+IFG++N+TTGASND  +V++VARQMV RFG SKK+GQI     GG
Sbjct  77   GQLAVALGGRIAEEIIFGDENITTGASNDLQRVTQVARQMVTRFGMSKKVGQIVHSSDGG  136

Query  327  NPFLGQQMSTQKDYSMATADV-VDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            NPFLG+QM++Q     +T  + +D EVR LV+ AY+RA  ++TT+  +L  LA++LIEKE
Sbjct  137  NPFLGRQMASQSPQIGSTTKMAIDDEVRRLVDIAYNRAKTLLTTNRSLLDDLAKMLIEKE  196

Query  150  TVDGEEFMSLFIDGKAELFV  91
            TV  +EF  L    K E+ +
Sbjct  197  TVSADEFQRLLATSKVEMMM  216



>ref|WP_017293936.1| cell division protein FtsH [Geminocystis herdmanii]
Length=615

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL
Sbjct  414  KRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYL  473

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQM+ RFG S ++G +A+G   
Sbjct  474  QNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMITRFGMSDRLGPVALGRQN  533

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN F+G+ +++ +D+S +TA  +D EV++LV++AY RA Q++  +  +L KLA +L+EKE
Sbjct  534  GNVFMGRDIASDRDFSDSTASAIDDEVKKLVDQAYQRAKQVLVENRAVLDKLANMLVEKE  593

Query  150  TVDGEEFMSLF  118
            TVD +E   + 
Sbjct  594  TVDADELQDIL  604



>ref|WP_019474071.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   266 bits (680),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 165/200 (83%), Gaps = 2/200 (1%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIPRGQAGGLTFF PSEERLESGLYSRSYL+
Sbjct  417  KKELVAYHEAGHAIVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERLESGLYSRSYLQ  476

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+KIG +A+G   G
Sbjct  477  NQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEKIGPVALGRSQG  536

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLG+ +++++D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET
Sbjct  537  GMFLGRDIASERDFSEDTAATIDVEVSELVDVAYKRATKVLTENRGMLDEMAQMLIERET  596

Query  147  VDGEEFMSLFIDGKAELFVA  88
            +D E+   L    ++E+ VA
Sbjct  597  IDTEDIQDLI--NRSEVKVA  614



>ref|WP_026730933.1| cell division protein FtsH [Fischerella sp. PCC 9605]
Length=613

 Score =   266 bits (680),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            +K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYLE
Sbjct  413  RKQLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYLE  472

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S K+G +A+G   G
Sbjct  473  NQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDKLGPVALGRQQG  532

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
            N FLG+ + +++D+S  TA  +D EVR+LV+ AY+RA  ++T +  +L +LA +L+EKET
Sbjct  533  NMFLGRDIMSERDFSEETAAAIDEEVRKLVDAAYARAKTVLTDNRHVLDQLADMLVEKET  592

Query  147  VDGEEFMSLF  118
            VD EE   L 
Sbjct  593  VDAEELQELL  602



>ref|WP_006511599.1| ATP-dependent metalloprotease FtsH [Xenococcus sp. PCC 7305]
 gb|ELS01218.1| ATP-dependent metalloprotease FtsH [Xenococcus sp. PCC 7305]
Length=616

 Score =   266 bits (680),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL
Sbjct  415  KRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYL  474

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  475  QNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVTRVARQMVTRFGMSDRLGPVALGRQN  534

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +++ +D+S  TA  +D E+R LV++AY RA +++  +  IL +LA++L++KE
Sbjct  535  GNVFLGRDIASDRDFSDETASAIDEEIRNLVDQAYRRAKEVLVENRSILDRLAEMLVDKE  594

Query  150  TVDGEEFMSLF  118
            TVD +E   L 
Sbjct  595  TVDSDELQDLL  605



>ref|WP_019476442.1| cell division protein FtsH [Prochlorococcus sp. W4]
Length=617

 Score =   266 bits (680),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 165/200 (83%), Gaps = 2/200 (1%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIPRGQAGGLTFF PSEERLESGLYSRSYL+
Sbjct  417  KKELVAYHEAGHAIVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERLESGLYSRSYLQ  476

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+KIG +A+G   G
Sbjct  477  NQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEKIGPVALGRSQG  536

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLG+ +++++D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET
Sbjct  537  GMFLGRDIASERDFSEDTAATIDVEVSELVDIAYKRATKVLTENRGMLDEMAQMLIERET  596

Query  147  VDGEEFMSLFIDGKAELFVA  88
            +D E+   L    ++E+ VA
Sbjct  597  IDTEDIQDLI--NRSEVKVA  614



>ref|WP_039726378.1| MULTISPECIES: cell division protein FtsH [Oscillatoriophycideae]
 gb|KIF14597.1| cell division protein FtsH [Aphanocapsa montana BDHKU210001]
 gb|KIF39523.1| cell division protein FtsH [Lyngbya confervoides BDU141951]
Length=613

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            +K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEERLESGLYSR+YL+
Sbjct  413  RKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEERLESGLYSRAYLQ  472

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGR+AEE+++G + VTTGASND  QV+RVARQM+ RFG S ++G +A+G   G
Sbjct  473  NQMAVALGGRIAEEIVYGNEEVTTGASNDLQQVARVARQMITRFGMSGELGPVALGRQQG  532

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
            N FLG+ ++ ++D+S  TA ++DAEVR LV++AY RA Q++  +  IL KLA +L+EKET
Sbjct  533  NMFLGRDITAERDFSEETAAIIDAEVRSLVDQAYDRAKQVLVENRAILDKLAGMLVEKET  592

Query  147  VDGEEFMSLF  118
            VD EE   L 
Sbjct  593  VDSEELQELL  602



>ref|WP_019478058.1| cell division protein FtsH [Prochlorococcus sp. W8]
Length=618

 Score =   266 bits (680),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 165/200 (83%), Gaps = 2/200 (1%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+
Sbjct  418  KKELVAYHEAGHAIVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQ  477

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G
Sbjct  478  NQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGRSQG  537

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLG+ +++++D+S  TA  +D+EV ELV+ AY RAT+++T +  +L ++A++LIE+ET
Sbjct  538  GMFLGRDIASERDFSEDTAATIDSEVSELVDSAYKRATKVLTDNRGMLDEMAEMLIERET  597

Query  147  VDGEEFMSLFIDGKAELFVA  88
            +D E+   L    ++E+ VA
Sbjct  598  IDSEDIQDLI--NRSEVKVA  615



>ref|WP_039716361.1| cell division protein FtsH [Scytonema millei]
 gb|KIF18854.1| cell division protein FtsH [Scytonema millei VB511283]
Length=612

 Score =   266 bits (679),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+++GLYSRSYL
Sbjct  411  KRKQLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDTGLYSRSYL  470

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQM+ RFG S ++G +A+G   
Sbjct  471  ENQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMITRFGMSDRLGPVALGRQQ  530

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +  ++D+S  TA V+D EV +LV+ AY RA  ++T +  IL +LAQ+L+EKE
Sbjct  531  GNMFLGRDIVAERDFSEETAAVIDEEVHQLVDTAYKRAKSVLTNNRAILDRLAQMLVEKE  590

Query  150  TVDGEEFMSLF  118
            TVD +E   L 
Sbjct  591  TVDADELQELL  601



>ref|WP_032527521.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGF96190.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9302]
Length=617

 Score =   266 bits (679),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  416  KKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  475

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  476  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  535

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV +LV+ AY RAT++++ +  +L ++A++LIE+E
Sbjct  536  GGMFLGRDMSSTRDFSEDTAATIDEEVSDLVDIAYKRATKVLSDNRTVLDEMAEMLIERE  595

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  596  TIDTEDIQDLL--NRSEVKVA  614



>ref|WP_019477234.1| cell division protein FtsH [Prochlorococcus sp. W7]
Length=618

 Score =   266 bits (679),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 165/200 (83%), Gaps = 2/200 (1%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+
Sbjct  418  KKELVAYHEAGHAIVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQ  477

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G
Sbjct  478  NQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGRSQG  537

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLG+ +++++D+S  TA  +D+EV ELV+ AY RAT+++T +  +L ++A++LIE+ET
Sbjct  538  GMFLGRDIASERDFSEDTAATIDSEVSELVDSAYKRATKVLTENRGMLDEMAEMLIERET  597

Query  147  VDGEEFMSLFIDGKAELFVA  88
            +D E+   L    ++E+ VA
Sbjct  598  IDSEDIQDLI--NRSEVKVA  615



>ref|WP_038542994.1| cell division protein FtsH [Synechococcus sp. KORDI-100]
 gb|AII42342.1| cell division protein FtsH [Synechococcus sp. KORDI-100]
Length=615

 Score =   266 bits (679),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 156/192 (81%), Gaps = 0/192 (0%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            KK+LVAYHEAGHALVGALMP+YDPV KISIIPRG AGGLTFF PSEER+ESGLYSR+YL+
Sbjct  415  KKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGNAGGLTFFTPSEERMESGLYSRAYLQ  474

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGRVAEE+I+GED VTTGASND  QV++VARQM+ RFG S K+G +A+G   G
Sbjct  475  NQMAVALGGRVAEEIIYGEDEVTTGASNDLQQVAQVARQMITRFGMSDKLGPVALGRSQG  534

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLG+ ++ ++D+S  TA  +D EV +LV+ AY RAT+++  +  +L +LA LL+EKET
Sbjct  535  GMFLGRDIAAERDFSEDTASTIDQEVYDLVDVAYKRATKVLVDNRLVLDELADLLVEKET  594

Query  147  VDGEEFMSLFID  112
            VD EE   L I+
Sbjct  595  VDAEELQELLIN  606



>ref|WP_036922150.1| cell division protein FtsH [Prochlorococcus marinus]
Length=618

 Score =   266 bits (679),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 165/200 (83%), Gaps = 2/200 (1%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+
Sbjct  418  KKELVAYHEAGHAIVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQ  477

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G
Sbjct  478  NQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGRSQG  537

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLG+ +++++D+S  TA  +D+EV ELV+ AY RAT+++T +  +L ++A++LIE+ET
Sbjct  538  GMFLGRDIASERDFSEDTAATIDSEVSELVDSAYKRATKVLTENRGMLDEMAEMLIERET  597

Query  147  VDGEEFMSLFIDGKAELFVA  88
            +D E+   L    ++E+ VA
Sbjct  598  IDSEDIQDLI--NRSEVKVA  615



>ref|WP_011936606.1| cell division protein FtsH [Synechococcus sp. RCC307]
 emb|CAK29096.1| Cell division protein FtsH [Synechococcus sp. RCC307]
Length=618

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHE+GHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  417  KRKRLVAYHESGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMESGLYSRSYL  476

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GED VTTGASND  QV+RVARQMV RFG S K+G +A+G   
Sbjct  477  QNQMAVALGGRVAEELVYGEDEVTTGASNDLQQVARVARQMVTRFGMSDKLGPVALGRSQ  536

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ ++ ++D+S  TA  +D EV  LV+ AY+RA Q+++ +  +L +LA++L+E E
Sbjct  537  GGMFLGRDIAAERDFSEDTAATIDKEVSSLVDAAYTRAVQVLSDNRALLDELAEMLVEME  596

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD E+   L I   A++
Sbjct  597  TVDAEQLQELLISRDAKV  614



>ref|XP_001419590.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97883.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=651

 Score =   266 bits (680),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 133/200 (67%), Positives = 162/200 (81%), Gaps = 0/200 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KKKLVAYHEAGHALVGALMP+YD V KISI+PRG AGGLTFFAPSEERLESGLYSR+YL
Sbjct  439  KKKKLVAYHEAGHALVGALMPDYDAVTKISIVPRGNAGGLTFFAPSEERLESGLYSRTYL  498

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVA+GGRVAEE+IFG ++VTTGAS DF QV+R AR M+E+ GFSK+IGQIAI   G
Sbjct  499  ENQMAVAMGGRVAEELIFGAEDVTTGASGDFQQVTRTARMMIEQMGFSKRIGQIAIKSGG  558

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG  M    DYS ATA +VD EV+ LV  AY RA  ++  ++D+LH +A +L+EKE
Sbjct  559  GNSFLGNDMGRAADYSAATAAIVDEEVKILVTAAYRRAKDLVQLNMDVLHAVADVLMEKE  618

Query  150  TVDGEEFMSLFIDGKAELFV  91
             +DG+EF  + +  K+EL++
Sbjct  619  NIDGDEFERIMLGAKSELYL  638



>ref|WP_015156116.1| membrane protease FtsH catalytic subunit [Chroococcidiopsis thermalis]
 gb|AFY89574.1| membrane protease FtsH catalytic subunit [Chroococcidiopsis thermalis 
PCC 7203]
Length=612

 Score =   265 bits (678),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+++GLYSRSYL
Sbjct  411  KRKQLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDTGLYSRSYL  470

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQM+ RFG S ++G +A+G   
Sbjct  471  ENQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMITRFGMSDRLGPVALGRQQ  530

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +  ++D+S  TA V+D EV +LV+ AY RA  ++T +  IL +LAQ+L+EKE
Sbjct  531  GNMFLGRDIVAERDFSEETAAVIDEEVHQLVDTAYKRAKSVLTDNRAILDRLAQMLVEKE  590

Query  150  TVDGEEFMSLF  118
            TVD +E   L 
Sbjct  591  TVDADELQELL  601



>ref|WP_027255466.1| cell division protein FtsH [Planktothrix agardhii]
Length=612

 Score =   265 bits (677),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEER++SGL+SRSYL
Sbjct  411  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFMPSEERMDSGLFSRSYL  470

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQM+ R+G S ++G +A+G   
Sbjct  471  ENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVTRVARQMITRYGMSDRLGPVALGRQQ  530

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ + +++D+S  TA  +DAEVR LV+ AY RA Q++  +  +L++LA +LI+KE
Sbjct  531  GNVFLGRDIMSERDFSEETASTIDAEVRILVDAAYKRAKQVLVENRHVLNQLANILIDKE  590

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD +E   L  + + ++
Sbjct  591  TVDADELQELLANNEVKM  608



>ref|WP_015955558.1| cell division protein FtsH [Cyanothece sp. PCC 7424]
 gb|ACK71965.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7424]
Length=616

 Score =   265 bits (677),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGL+SRSYL
Sbjct  415  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLFSRSYL  474

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  475  QNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQN  534

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+++++ +D+S  TA  +D EVR LV++AY RA +++  +  IL +LA +LIEKE
Sbjct  535  GNVFLGREIASDRDFSDETAAAIDEEVRNLVDQAYRRAKEVLMNNRPILDQLASMLIEKE  594

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD EE   +  +   ++
Sbjct  595  TVDAEELQDILANNDVKM  612



>ref|WP_026794256.1| MULTISPECIES: cell division protein FtsH [Planktothrix]
Length=612

 Score =   265 bits (677),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEER++SGL+SRSYL
Sbjct  411  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFMPSEERMDSGLFSRSYL  470

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQM+ R+G S ++G +A+G   
Sbjct  471  ENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVTRVARQMITRYGMSDRLGPVALGRQQ  530

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ + +++D+S  TA  +DAEVR LV+ AY RA Q++  +  +L++LA +LI+KE
Sbjct  531  GNVFLGRDIMSERDFSEETASTIDAEVRILVDAAYKRAKQVLVENRHVLNQLANVLIDKE  590

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD +E   L  + + ++
Sbjct  591  TVDADELQELLANNEVKM  608



>ref|WP_026097926.1| cell division protein FtsH [Geitlerinema sp. PCC 7105]
Length=614

 Score =   265 bits (677),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG AGGLT+F PSEER++SGLYSRSYL
Sbjct  413  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGAAGGLTWFTPSEERMDSGLYSRSYL  472

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S+++G +A+G   
Sbjct  473  QNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSERLGPVALGRQQ  532

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ ++ ++D+S  TA  +D EV +LV+ AY+RA Q+++ +  +L +L+++L+EKE
Sbjct  533  GNMFLGRDIAAERDFSEETAAAIDEEVSKLVDEAYTRAKQVLSENRSVLDRLSEMLVEKE  592

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD EE   L  +   ++
Sbjct  593  TVDAEELQDLLANSDVKM  610



>ref|WP_007100703.1| cell division protein FtsH [Synechococcus sp. RS9917]
 gb|EAQ68631.1| cell division protein [Synechococcus sp. RS9917]
Length=616

 Score =   265 bits (677),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            +K+LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ESGLYSR+YL+
Sbjct  416  RKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMESGLYSRAYLQ  475

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G +A+G   G
Sbjct  476  NQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLGPVALGRAQG  535

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLG+ ++ ++D+S  TA  +D EV +LV  AY RATQ++T +  +L +LA++L+++ET
Sbjct  536  GMFLGRDIAAERDFSEDTAATIDEEVSDLVSVAYKRATQVLTQNRSVLDELAEMLVDQET  595

Query  147  VDGEEFMSLFI  115
            VD E+   L +
Sbjct  596  VDAEDLQELLM  606



>ref|WP_042152619.1| cell division protein FtsH [Planktothrix agardhii]
 gb|KEI66190.1| FtsH [Planktothrix agardhii NIVA-CYA 126/8]
Length=612

 Score =   265 bits (676),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEER++SGL+SRSYL
Sbjct  411  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFMPSEERMDSGLFSRSYL  470

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQM+ R+G S ++G +A+G   
Sbjct  471  ENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVTRVARQMITRYGMSDRLGPVALGRQQ  530

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ + +++D+S  TA  +DAEVR LV+ AY RA Q++  +  +L++LA +LI+KE
Sbjct  531  GNVFLGRDIMSERDFSEETASTIDAEVRILVDAAYKRAKQVLVENRHVLNQLADVLIDKE  590

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD +E   L  + + ++
Sbjct  591  TVDADELQELLANNEVKM  608



>ref|WP_027249137.1| cell division protein FtsH [Planktothrix agardhii]
Length=612

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEER++SGL+SRSYL
Sbjct  411  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFMPSEERMDSGLFSRSYL  470

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQM+ R+G S ++G +A+G   
Sbjct  471  ENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVTRVARQMITRYGMSDRLGPVALGRQQ  530

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ + +++D+S  TA  +DAEVR LV+ AY RA Q++  +  +L++LA +LI+KE
Sbjct  531  GNVFLGRDIMSERDFSEETASTIDAEVRILVDAAYKRAKQVLVENRHVLNQLADVLIDKE  590

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD +E   L  + + ++
Sbjct  591  TVDADELQELLANNEVKM  608



>ref|WP_011055986.1| cell division protein FtsH [Thermosynechococcus elongatus]
 ref|NP_680922.1| cell division protein [Thermosynechococcus elongatus BP-1]
 dbj|BAC07684.1| cell division protein [Thermosynechococcus elongatus BP-1]
Length=612

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            +KKLVAYHEAGHALVGALMP+YDPV K+SIIPRG+AGGLT+F P+E++++SGLYSR+YL+
Sbjct  412  RKKLVAYHEAGHALVGALMPDYDPVQKVSIIPRGRAGGLTWFTPNEDQMDSGLYSRAYLQ  471

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGR+AEE++FGED VTTGASND  QV+RVARQMV RFG S ++G +A+G   G
Sbjct  472  NQMAVALGGRIAEEIVFGEDEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQTG  531

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
            N FLG+ +  ++D+S  TA  +D EVR LVE+AY RA +++  +  +L ++AQ+LIEKET
Sbjct  532  NVFLGRDIMAERDFSEETAATIDDEVRNLVEQAYRRAKEVLVNNRHVLDQIAQVLIEKET  591

Query  147  VDGEEFMSLF  118
            +D EE  S+ 
Sbjct  592  IDAEELQSIL  601



>ref|WP_024125602.1| ATP-dependent metalloprotease FtsH3 [Thermosynechococcus sp. 
NK55a]
 gb|AHB89224.1| ATP-dependent metalloprotease FtsH3 [Thermosynechococcus sp. 
NK55a]
Length=612

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            +KKLVAYHEAGHALVGALMP+YDPV K+SIIPRG+AGGLT+F P+E++++SGLYSR+YL+
Sbjct  412  RKKLVAYHEAGHALVGALMPDYDPVQKVSIIPRGRAGGLTWFTPNEDQMDSGLYSRAYLQ  471

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGR+AEE++FGED VTTGASND  QV+RVARQMV RFG S ++G +A+G   G
Sbjct  472  NQMAVALGGRIAEEIVFGEDEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQTG  531

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
            N FLG+ +  ++D+S  TA  +D EVR LVE+AY RA +++  +  +L ++AQ+LIEKET
Sbjct  532  NVFLGRDIMAERDFSEETAATIDDEVRNLVEQAYRRAKEVLVNNRHVLDQIAQVLIEKET  591

Query  147  VDGEEFMSLF  118
            +D EE  S+ 
Sbjct  592  IDAEELQSIL  601



>gb|KIE06858.1| cell division protein FtsH [Tolypothrix bouteillei VB521301]
Length=614

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+++GLYSR+YL
Sbjct  413  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDTGLYSRAYL  472

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  473  ENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQQ  532

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ + +++D+S  TA  +D EVR+LVE AY RA +++  +  IL KLA++L+EKE
Sbjct  533  GNMFLGRDIMSERDFSEETAAAIDEEVRQLVETAYRRAKEVLENNRHILDKLAEMLVEKE  592

Query  150  TVDGEEFMSLF  118
            TVD EE   + 
Sbjct  593  TVDAEELQDVL  603



>ref|WP_011826974.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABM79116.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9303]
Length=615

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            +K+LVAYHE+GHALVGALMP+YD V KISIIPRGQAGGLTFF PSEER+ESGLYSR+YL+
Sbjct  415  RKQLVAYHESGHALVGALMPDYDSVQKISIIPRGQAGGLTFFTPSEERMESGLYSRAYLQ  474

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G +A+G   G
Sbjct  475  NQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLGPVALGRSQG  534

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLG+ +++++D+S  TA ++DAEV +LV+ AY RAT+++  +  +L +LA LL+EKET
Sbjct  535  GMFLGRDIASERDFSEDTAAIIDAEVSDLVDVAYKRATKVLIENRSVLDELADLLVEKET  594

Query  147  VDGEEFMSLFI  115
            VD ++   L I
Sbjct  595  VDAQDLQDLLI  605



>emb|CCH67048.1| Cell division protein FtsH [Richelia intracellularis HH01]
Length=465

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            +K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F P+E+R++SGLYSRSYLE
Sbjct  265  RKLLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPNEDRMDSGLYSRSYLE  324

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGR+AEE+IFG++ VTTGASND  QV+RVARQMV RFG S ++G +A+G   G
Sbjct  325  NQMAVALGGRLAEEIIFGDEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQQG  384

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
            N FLG+ + +++D+S  TA  +D EVR+LV+ AY RA Q++  +  IL++LA +L+EKET
Sbjct  385  NMFLGRDIMSERDFSEETAATIDEEVRQLVDAAYIRAKQVLEENRHILNQLADILVEKET  444

Query  147  VDGEEFMSLF  118
            VD EE   + 
Sbjct  445  VDAEELQDIL  454



>ref|WP_036913475.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
 gb|KGG26507.1| cell division protein FtsH2 [Prochlorococcus sp. MIT 0701]
 gb|KGG29359.1| cell division protein FtsH2 [Prochlorococcus sp. MIT 0702]
Length=615

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            +K+LVAYHE+GHALVGALMP+YD V KISIIPRGQAGGLTFF PSEER+ESGLYSR+YL+
Sbjct  415  RKQLVAYHESGHALVGALMPDYDSVQKISIIPRGQAGGLTFFTPSEERMESGLYSRAYLQ  474

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G +A+G   G
Sbjct  475  NQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLGPVALGRSQG  534

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLG+ +++++D+S  TA ++DAEV +LV+ AY RAT+++  +  +L +LA LL+EKET
Sbjct  535  GMFLGRDIASERDFSEDTAAIIDAEVSDLVDVAYKRATKVLIENRSVLDELADLLVEKET  594

Query  147  VDGEEFMSLFI  115
            VD ++   L I
Sbjct  595  VDAQDLQELLI  605



>ref|WP_011243527.1| MULTISPECIES: cell division protein FtsH [Synechococcus]
 dbj|BAD79405.1| ATP-dependent Zn protease [Synechococcus elongatus PCC 6301]
 gb|ABB56329.1| FtsH peptidase homologue, chloroplast. Metallo peptidase. MEROPS 
family M41 [Synechococcus elongatus PCC 7942]
 gb|AJD56622.1| cell division protein FtsH [Synechococcus sp. UTEX 2973]
Length=613

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEER+ESGLYSR+YL
Sbjct  412  KRKVLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEERMESGLYSRTYL  471

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  472  QNQMAVALGGRLAEEIVFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQQ  531

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ ++ ++D+S  TA  +D EVR+LV+ AY RA +++  +  IL +LA++L+EKE
Sbjct  532  GNMFLGRDIAAERDFSEETAATIDDEVRQLVDVAYDRAKKVLIENRSILDQLAKMLVEKE  591

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD EE   L  + +  +
Sbjct  592  TVDAEELQDLLNNNEVRM  609



>ref|WP_038331075.1| cell division protein FtsH [filamentous cyanobacterium ESFC-1]
Length=618

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEER++SGLYSR+YL
Sbjct  417  KRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEERMDSGLYSRAYL  476

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  477  QNQMAVALGGRVAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQN  536

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN F+G+ +++ +D+S  TA  +D EVR+LV++AY R  +++  +  IL KLA++L+E E
Sbjct  537  GNMFMGRDIASDRDFSDETASAIDEEVRKLVDQAYERTVEVLKGNRQILDKLAEMLVEAE  596

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD EE  +L  +   ++
Sbjct  597  TVDSEELQNLLAESDVKM  614



>ref|WP_006042287.1| cell division protein FtsH [Synechococcus sp. WH 7805]
 gb|EAR19163.1| cell division protein FtsH2 [Synechococcus sp. WH 7805]
Length=616

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            +K+LVAYHEAGHALVGALMP+YDPV KISIIPRG AGGLTFF PSEER+ESGLYSR+YL+
Sbjct  416  RKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGNAGGLTFFTPSEERMESGLYSRTYLQ  475

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G +A+G   G
Sbjct  476  NQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLGPVALGRSQG  535

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLG+ ++ ++D+S  TA  +D EV +LV+ AY RAT+++ ++  +L ++A++L+E+ET
Sbjct  536  GMFLGRDIAAERDFSEDTAATIDEEVSDLVDVAYKRATKVLVSNRSVLDEIAEMLVEQET  595

Query  147  VDGEEFMSLFI  115
            VD EE   L I
Sbjct  596  VDAEELQELLI  606



>ref|WP_026786321.1| cell division protein FtsH [Planktothrix rubescens]
Length=612

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVG+LMP+YDPV KISIIPRG+AGGLT+F PSEER++SGL+SRSYL
Sbjct  411  KRKTLVAYHEAGHALVGSLMPDYDPVQKISIIPRGRAGGLTWFMPSEERMDSGLFSRSYL  470

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            ENQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQM+ R+G S ++G +A+G   
Sbjct  471  ENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVTRVARQMITRYGMSDRLGPVALGRQQ  530

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ + +++D+S  TA  +DAEVR LV+ AY RA Q++  +  +L++LA +LI+KE
Sbjct  531  GNVFLGRDIMSERDFSEETASTIDAEVRILVDAAYKRAKQVLVENRHVLNQLANVLIDKE  590

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD +E   L  + + ++
Sbjct  591  TVDADELQELLANNEVKM  608



>ref|WP_017715041.1| cell division protein FtsH [Oscillatoria sp. PCC 10802]
Length=613

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYL
Sbjct  412  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYL  471

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG S+++G +A+G   
Sbjct  472  QNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQMVMRFGMSERLGPVALGRQQ  531

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +  ++D+S  TA V+D EV  LVE+AY RA +++ ++  +L  LA +L+EKE
Sbjct  532  GNMFLGRDIMAERDFSEETASVIDEEVSTLVEQAYRRAKEVLVSNRHVLDTLADMLVEKE  591

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD EE   L  +   ++
Sbjct  592  TVDSEELQDLLANSDVKM  609



>ref|WP_011932280.1| cell division protein FtsH [Synechococcus sp. WH 7803]
 emb|CAK22781.1| Cell division protein FtsH [Synechococcus sp. WH 7803]
Length=617

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            +K+LVAYHEAGHALVGALMP+YDPV KISIIPRG AGGLTFF PSEER+ESGLYSR+YL+
Sbjct  417  RKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGNAGGLTFFTPSEERMESGLYSRTYLQ  476

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G +A+G   G
Sbjct  477  NQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLGPVALGRSQG  536

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLG+ ++ ++D+S  TA  +D EV ELV+ AY RAT+++  +  +L +LA++L+E+ET
Sbjct  537  GMFLGRDIAAERDFSEDTAATIDEEVSELVDVAYKRATKVLVGNRSVLDELAEMLVEQET  596

Query  147  VDGEEFMSLFI  115
            VD E+   L I
Sbjct  597  VDAEQLQELLI  607



>ref|WP_019506377.1| cell division protein FtsH [Pleurocapsa sp. PCC 7319]
Length=616

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL
Sbjct  415  KRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYL  474

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+I+GE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  475  QNQMAVALGGRLAEEIIYGEEEVTTGASNDLQQVTRVARQMVTRFGMSDRLGPVALGRQN  534

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN F+G+ +++ +D+S  TA  +D EVR  V++AYSRA +++  + +IL +LA++LIEKE
Sbjct  535  GNVFMGRDIASDRDFSNETAAAIDEEVRNYVDQAYSRAKKVLLDNRNILDRLAEMLIEKE  594

Query  150  TVDGEEFMSLFIDGKAEL  97
            TV+ +E   +  +   ++
Sbjct  595  TVEADELQDILANNDVKM  612



>ref|WP_015204207.1| membrane protease FtsH catalytic subunit [Crinalium epipsammum]
 gb|AFZ14101.1| membrane protease FtsH catalytic subunit [Crinalium epipsammum 
PCC 9333]
Length=613

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 157/198 (79%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG AGGLT+F PSE+RL+SGLYSRSYL
Sbjct  412  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGNAGGLTWFTPSEDRLDSGLYSRSYL  471

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFG++ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  472  QNQMAVALGGRIAEEIIFGDEEVTTGASNDLQQVARVARQMVMRFGMSDRLGPVALGRQQ  531

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ ++ ++D+S  TA  +D EV  LVE+AY RA +++  +  +L KLA +LIEKE
Sbjct  532  GNMFLGRDINAERDFSDETAATIDDEVHNLVEQAYKRAKEVLVNNKHVLDKLAVMLIEKE  591

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD EE   L  +   ++
Sbjct  592  TVDSEELQELLANNDVKM  609



>ref|WP_017291153.1| cell division protein FtsH [Leptolyngbya boryana]
Length=613

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 163/201 (81%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYL
Sbjct  412  KRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYL  471

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVA+QMV RFG S ++G +A+G   
Sbjct  472  QNQMAVALGGRIAEEIVFGEEEVTTGASNDLQQVARVAKQMVTRFGMSDRLGPVALGRQQ  531

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ ++ ++D+S  TA  +D EVR LVE+AY RA  ++  +  +L KLA++L++KE
Sbjct  532  GNMFLGRDIAAERDFSEETAAAIDDEVRNLVEQAYRRAKAVLVQNRPVLDKLAEMLVDKE  591

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            TVD EE   L   G +++ +A
Sbjct  592  TVDAEELQELL--GNSDVQIA  610



>ref|WP_012305681.1| MULTISPECIES: cell division protein FtsH [Synechococcus]
 gb|ACA98057.1| ATP-dependent metalloprotease FtsH subfamily [Synechococcus sp. 
PCC 7002]
Length=620

 Score =   264 bits (674),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSR+YL
Sbjct  415  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRAYL  474

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+ VARQM+ RFG S ++G +A+G   
Sbjct  475  QNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVANVARQMITRFGMSDRLGPVALGRQN  534

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN F+G+ +++ +D+S  TA V+D EVR LVE AY RA  ++  +  +L KLA +L+EKE
Sbjct  535  GNVFMGRDIASDRDFSDETAAVIDEEVRGLVEEAYKRAKDVLVGNRSVLDKLAAMLVEKE  594

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD EE  +L ++   ++
Sbjct  595  TVDAEELQTLLMESDVQM  612



>ref|WP_015180805.1| ATP-dependent metalloprotease FtsH [Microcoleus sp. PCC 7113]
 gb|AFZ16642.1| ATP-dependent metalloprotease FtsH [Microcoleus sp. PCC 7113]
Length=612

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 158/198 (80%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+++GLYSRSYL
Sbjct  411  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDTGLYSRSYL  470

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   
Sbjct  471  QNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVTRVARQMVTRFGMSDRLGPVALGRQN  530

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+++++ +D+S  TA  +D EVR LV+ AY RA  ++  +  IL KLA +LIEKE
Sbjct  531  GNMFLGREIASDRDFSDTTAATIDEEVRRLVDEAYERAKNVLLGNKHILDKLAGMLIEKE  590

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD +E   L  +   ++
Sbjct  591  TVDSDELQELLANNDVKI  608



>ref|WP_011131165.1| cell division protein FtsH [Prochlorococcus marinus]
 emb|CAE21973.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9313]
Length=615

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -3

Query  687  KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLE  508
            +K+LVAYHE+GHALVGALMP+YD V KISIIPRGQAGGLTFF PSEER+ESGLYSR+YL+
Sbjct  415  RKRLVAYHESGHALVGALMPDYDSVQKISIIPRGQAGGLTFFTPSEERMESGLYSRAYLQ  474

Query  507  NQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGG  328
            NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G +A+G   G
Sbjct  475  NQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLGPVALGRSQG  534

Query  327  NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKET  148
              FLG+ +++++D+S  TA ++DAEV +LV+ AY RAT+++  +  +L +LA LL+EKET
Sbjct  535  GMFLGRDIASERDFSEDTAAIIDAEVSDLVDVAYKRATKVLIENRSVLDELADLLVEKET  594

Query  147  VDGEEFMSLFI  115
            +D ++   L I
Sbjct  595  LDAQDLQELLI  605



>ref|WP_015224048.1| membrane protease FtsH catalytic subunit [Cyanobacterium stanieri]
 gb|AFZ48735.1| membrane protease FtsH catalytic subunit [Cyanobacterium stanieri 
PCC 7202]
Length=615

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL
Sbjct  414  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYL  473

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE+IFG++ VTTGASND  QV+RVARQM+ RFG S ++G +A+G   
Sbjct  474  QNQMAVALGGRIAEEIIFGQEEVTTGASNDLQQVARVARQMITRFGMSDRLGPVALGRQN  533

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN F+G+ +++ +D+S  TA  +D EV +LVERAY RA  ++  +  IL KLA++L+EKE
Sbjct  534  GNVFMGRDIASDRDFSDTTAATIDEEVSQLVERAYQRAKDVLVQNRPILDKLAEMLVEKE  593

Query  150  TVDGEEFMSLF  118
            TV+ +E   + 
Sbjct  594  TVEADELQEIL  604



>ref|WP_006623490.1| cell division protein FtsH [Arthrospira sp. PCC 8005]
 emb|CCE19163.1| ATP-dependent zinc-metalloprotease [Arthrospira sp. PCC 8005]
 gb|EKD09489.1| ATP-dependent metalloprotease FtsH [Arthrospira platensis C1]
 emb|CDM97762.1| ATP-dependent zinc-metalloprotease [Arthrospira sp. PCC 8005]
Length=600

 Score =   263 bits (671),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 155/191 (81%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYL
Sbjct  399  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFMPSEDRMDSGLYSRSYL  458

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVARQM+ RFG S ++G +A+G   
Sbjct  459  QNQMAVALGGRLAEEIVFGEEEVTTGASNDLQQVTRVARQMITRFGMSDRLGPVALGRQQ  518

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ + +++D+S  TA  +D EVR LV+ AY RA Q++  +  +L  LA++LIEKE
Sbjct  519  GNVFLGRDIMSERDFSEETASAIDEEVRALVDEAYKRARQVLEENRPVLDSLAEMLIEKE  578

Query  150  TVDGEEFMSLF  118
            TVD EE   L 
Sbjct  579  TVDSEELQELL  589



>ref|WP_022606782.1| ATP-dependent metalloprotease FtsH [Rubidibacter lacunae]
 gb|ERN41527.1| ATP-dependent metalloprotease FtsH [Rubidibacter lacunae KORDI 
51-2]
Length=616

 Score =   263 bits (672),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 156/198 (79%), Gaps = 0/198 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K+LVAYHEAGHAL GALMP+YDPV KISIIPRG AGGLT+F PSE+RL+SGLYSRSYL
Sbjct  415  KRKQLVAYHEAGHALCGALMPDYDPVQKISIIPRGAAGGLTWFTPSEDRLDSGLYSRSYL  474

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVARQMV R G S ++G +A+G   
Sbjct  475  QNQMAVALGGRIAEEIVFGEEEVTTGASNDLQQVARVARQMVTRLGMSDRLGPVALGRSN  534

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ +++ +D+S  TA  +D EVR LV+RAY R   ++ ++  IL KLA  L+EKE
Sbjct  535  GNVFLGRDIASDRDFSDETAAAIDEEVRSLVDRAYQRCKDVLVSNRHILDKLAAALVEKE  594

Query  150  TVDGEEFMSLFIDGKAEL  97
            TVD +E   L  + + ++
Sbjct  595  TVDADELQQLLTENEVKM  612



>ref|WP_011819579.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABM71467.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9515]
Length=619

 Score =   263 bits (672),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 161/201 (80%), Gaps = 2/201 (1%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            +KK+LVAYHEAGHALVGA MP+YD VAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL
Sbjct  418  KKKELVAYHEAGHALVGACMPDYDAVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYL  477

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   
Sbjct  478  QNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQ  537

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++A +LIE+E
Sbjct  538  GGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRSVLDEMAMMLIERE  597

Query  150  TVDGEEFMSLFIDGKAELFVA  88
            T+D E+   L    ++E+ VA
Sbjct  598  TIDTEDIQDLL--NRSEVKVA  616



>ref|WP_006669335.1| MULTISPECIES: cell division protein FtsH [Arthrospira]
 gb|EDZ94639.1| ATP-dependent metalloprotease FtsH [Arthrospira maxima CS-328]
Length=612

 Score =   263 bits (671),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 155/191 (81%), Gaps = 0/191 (0%)
 Frame = -3

Query  690  EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL  511
            ++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYL
Sbjct  411  KRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFMPSEDRMDSGLYSRSYL  470

Query  510  ENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPG  331
            +NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVARQM+ RFG S ++G +A+G   
Sbjct  471  QNQMAVALGGRLAEEIVFGEEEVTTGASNDLQQVTRVARQMITRFGMSDRLGPVALGRQQ  530

Query  330  GNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKE  151
            GN FLG+ + +++D+S  TA  +D EVR LV+ AY RA Q++  +  +L  LA++LIEKE
Sbjct  531  GNVFLGRDIMSERDFSEETASAIDEEVRALVDEAYKRARQVLEENRPVLDSLAEMLIEKE  590

Query  150  TVDGEEFMSLF  118
            TVD EE   L 
Sbjct  591  TVDSEELQELL  601



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520