BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF024J17

Length=720
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614011.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    276   3e-84   Nicotiana tomentosiformis
ref|XP_009796493.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    276   3e-84   Nicotiana sylvestris
ref|XP_006342885.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    273   7e-83   Solanum tuberosum [potatoes]
gb|ABO31100.1|  ovule receptor-like kinase 28                           273   8e-83   Solanum chacoense
emb|CDO97777.1|  unnamed protein product                                272   1e-82   Coffea canephora [robusta coffee]
ref|XP_002533323.1|  leucine-rich repeat transmembrane protein ki...    269   4e-82   
ref|XP_004235517.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    271   4e-82   
ref|XP_004252624.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    268   4e-81   Solanum lycopersicum
ref|XP_009619763.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    266   2e-80   Nicotiana tomentosiformis
gb|KDP40614.1|  hypothetical protein JCGZ_24613                         266   4e-80   Jatropha curcas
gb|KDO53740.1|  hypothetical protein CISIN_1g0080551mg                  249   5e-80   Citrus sinensis [apfelsine]
ref|XP_006362102.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    265   6e-80   Solanum tuberosum [potatoes]
ref|XP_008465039.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    262   9e-80   
ref|XP_008372915.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    265   1e-79   Malus domestica [apple tree]
ref|XP_006465790.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    265   1e-79   Citrus sinensis [apfelsine]
ref|XP_006426818.1|  hypothetical protein CICLE_v10025011mg             265   1e-79   Citrus clementina [clementine]
ref|XP_008228094.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    264   3e-79   Prunus mume [ume]
ref|XP_006369070.1|  leucine-rich repeat transmembrane protein ki...    264   3e-79   
ref|XP_008465038.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    261   4e-79   
gb|EYU21255.1|  hypothetical protein MIMGU_mgv1a002171mg                263   4e-79   Erythranthe guttata [common monkey flower]
gb|EYU21256.1|  hypothetical protein MIMGU_mgv1a002171mg                262   7e-79   Erythranthe guttata [common monkey flower]
ref|XP_007217016.1|  hypothetical protein PRUPE_ppa002092mg             262   1e-78   Prunus persica
ref|XP_004303773.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    262   1e-78   Fragaria vesca subsp. vesca
ref|XP_009788970.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    261   2e-78   Nicotiana sylvestris
ref|XP_008465036.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    261   2e-78   
ref|XP_009788969.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    261   2e-78   Nicotiana sylvestris
ref|XP_008465035.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    261   4e-78   Cucumis melo [Oriental melon]
ref|XP_008465033.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    261   4e-78   
ref|XP_011048642.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    259   1e-77   Populus euphratica
ref|XP_004144448.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    259   1e-77   Cucumis sativus [cucumbers]
ref|XP_004165988.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    259   1e-77   
ref|NP_001241934.1|  protein STRUBBELIG-RECEPTOR FAMILY 6-like          256   2e-77   
ref|XP_010033635.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    258   3e-77   Eucalyptus grandis [rose gum]
ref|XP_006604929.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    258   3e-77   
ref|XP_006604928.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    258   4e-77   Glycine max [soybeans]
ref|XP_008462233.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    256   5e-77   Cucumis melo [Oriental melon]
ref|XP_006598761.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    257   6e-77   
gb|KHN01483.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    256   6e-77   Glycine soja [wild soybean]
gb|KHN16389.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    258   6e-77   Glycine soja [wild soybean]
ref|XP_007135353.1|  hypothetical protein PHAVU_010G122100g             257   6e-77   Phaseolus vulgaris [French bean]
ref|XP_004510591.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    257   7e-77   Cicer arietinum [garbanzo]
ref|XP_008462232.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    256   8e-77   
gb|KHG25534.1|  protein strubbelig-receptor family 6                    257   9e-77   Gossypium arboreum [tree cotton]
emb|CBI35784.3|  unnamed protein product                                257   9e-77   Vitis vinifera
ref|XP_004141737.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    255   1e-76   
ref|XP_010654359.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    257   1e-76   Vitis vinifera
ref|XP_008462231.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    257   1e-76   Cucumis melo [Oriental melon]
ref|XP_006583189.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    256   1e-76   Glycine max [soybeans]
gb|KEH18524.1|  strubbelig-receptor family 6 protein                    256   1e-76   Medicago truncatula
ref|XP_011072711.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    256   2e-76   Sesamum indicum [beniseed]
ref|XP_007139053.1|  hypothetical protein PHAVU_009G260900g             256   2e-76   Phaseolus vulgaris [French bean]
ref|XP_008783422.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    256   2e-76   Phoenix dactylifera
ref|XP_008380807.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    256   2e-76   
ref|XP_008783430.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    256   2e-76   Phoenix dactylifera
ref|XP_003627481.1|  Protein STRUBBELIG-RECEPTOR FAMILY                 256   2e-76   Medicago truncatula
gb|ADM07445.1|  leucine-rich repeat receptor-like protein kinase        255   4e-76   Glycine soja [wild soybean]
gb|AFW90526.1|  strubbelig-receptor family 6-like protein               254   5e-76   Phaseolus vulgaris [French bean]
gb|KGN45433.1|  hypothetical protein Csa_7G447950                       254   1e-75   Cucumis sativus [cucumbers]
ref|XP_004159012.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    254   1e-75   
ref|XP_004494892.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    254   1e-75   Cicer arietinum [garbanzo]
ref|XP_007024796.1|  Strubbelig-receptor family 6                       253   2e-75   
ref|XP_002304260.2|  hypothetical protein POPTR_0003s07130g             253   3e-75   
ref|XP_011031832.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    252   6e-75   Populus euphratica
gb|KHG18134.1|  protein strubbelig-receptor family 6                    251   1e-74   Gossypium arboreum [tree cotton]
ref|XP_010273793.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    251   2e-74   Nelumbo nucifera [Indian lotus]
gb|ADB93024.1|  leucine-rich repeat receptor-like protein kinase        238   2e-74   Dendrobium nobile
gb|KHG12210.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    249   4e-74   Gossypium arboreum [tree cotton]
gb|KJB70030.1|  hypothetical protein B456_011G054100                    250   4e-74   Gossypium raimondii
gb|KJB57112.1|  hypothetical protein B456_009G148500                    249   8e-74   Gossypium raimondii
gb|KHG12209.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    249   8e-74   Gossypium arboreum [tree cotton]
ref|XP_010939842.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    246   3e-73   
ref|XP_008800485.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    247   4e-73   
ref|XP_010939841.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    246   8e-73   Elaeis guineensis
emb|CAN80221.1|  hypothetical protein VITISV_027894                     245   1e-72   Vitis vinifera
ref|XP_010542346.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    246   1e-72   Tarenaya hassleriana [spider flower]
ref|XP_009777356.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    243   4e-72   Nicotiana sylvestris
ref|XP_009386772.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    244   6e-72   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH24658.1|  strubbelig-receptor family protein                      243   1e-71   Medicago truncatula
ref|XP_009777355.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    242   2e-71   Nicotiana sylvestris
ref|XP_009777352.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    242   2e-71   Nicotiana sylvestris
ref|XP_004983096.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    241   6e-71   Setaria italica
ref|XP_010685195.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    240   1e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009383597.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    240   2e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006836581.1|  hypothetical protein AMTR_s00131p00083660          239   4e-70   Amborella trichopoda
ref|NP_001167741.1|  uncharacterized protein LOC100381429 precursor     239   5e-70   Zea mays [maize]
gb|EPS61932.1|  ovule receptor-like kinase 28                           238   9e-70   Genlisea aurea
gb|ACG49227.1|  leucine-rich repeat transmembrane protein kinase 1      237   1e-69   Zea mays [maize]
gb|AAC27894.1|  leucine-rich repeat transmembrane protein kinase 1      237   2e-69   Zea mays [maize]
ref|XP_008651696.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    237   2e-69   Zea mays [maize]
ref|XP_008651693.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    238   2e-69   
ref|XP_006357429.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    237   3e-69   
ref|XP_004985465.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    237   3e-69   Setaria italica
ref|XP_006661732.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    236   4e-69   Oryza brachyantha
ref|XP_004985464.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    237   5e-69   Setaria italica
ref|XP_006392757.1|  hypothetical protein EUTSA_v10011271mg             236   6e-69   
ref|XP_006392758.1|  hypothetical protein EUTSA_v10011271mg             236   8e-69   Eutrema salsugineum [saltwater cress]
ref|XP_009591325.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    235   9e-69   Nicotiana tomentosiformis
ref|XP_002468389.1|  hypothetical protein SORBIDRAFT_01g045010          236   1e-68   Sorghum bicolor [broomcorn]
ref|XP_008659003.1|  PREDICTED: leucine-rich repeat transmembrane...    235   1e-68   
gb|ABB20817.1|  putative leucine-rich repeat transmembrane protei...    234   2e-68   Isatis tinctoria [woad]
ref|XP_006304699.1|  hypothetical protein CARUB_v10011957mg             234   2e-68   Capsella rubella
ref|NP_175777.1|  STRUBBELIG-receptor family 6                          234   2e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AFW89442.1|  putative STRUBBELIG family receptor protein kinase      234   2e-68   
gb|KFK35699.1|  hypothetical protein AALP_AA4G025700                    234   3e-68   Arabis alpina [alpine rockcress]
ref|XP_006649512.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    234   3e-68   
ref|NP_001064502.1|  Os10g0389800                                       234   3e-68   
gb|EEC66871.1|  hypothetical protein OsI_33412                          234   4e-68   Oryza sativa Indica Group [Indian rice]
gb|AAK52120.1|AC079936_16  Putative leucine-rich repeat transmemb...    234   5e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010479951.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    234   5e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010096526.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6               233   6e-68   
ref|NP_001049184.1|  Os03g0183800                                       233   1e-67   
emb|CDY02495.1|  BnaA08g01020D                                          233   1e-67   
ref|XP_009106960.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    233   1e-67   Brassica rapa
ref|XP_011079189.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    232   2e-67   Sesamum indicum [beniseed]
emb|CDY25686.1|  BnaC03g69890D                                          232   2e-67   Brassica napus [oilseed rape]
ref|XP_010501035.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    232   2e-67   Camelina sativa [gold-of-pleasure]
ref|NP_001104882.1|  leucine-rich repeat transmembrane protein ki...    231   3e-67   Zea mays [maize]
ref|XP_010534992.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    230   3e-67   Tarenaya hassleriana [spider flower]
ref|XP_010937238.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    231   4e-67   
ref|XP_003558655.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    231   5e-67   Brachypodium distachyon [annual false brome]
ref|XP_002467303.1|  hypothetical protein SORBIDRAFT_01g024160          231   5e-67   
ref|NP_001077716.1|  STRUBBELIG-receptor family 6                       231   5e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010937237.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    231   6e-67   Elaeis guineensis
ref|XP_010462281.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    231   6e-67   Camelina sativa [gold-of-pleasure]
ref|XP_002891770.1|  hypothetical protein ARALYDRAFT_474507             230   1e-66   
ref|XP_010487232.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    227   1e-66   Camelina sativa [gold-of-pleasure]
emb|CDY39110.1|  BnaA01g29460D                                          229   2e-66   Brassica napus [oilseed rape]
gb|EMS47769.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    228   2e-66   Triticum urartu
ref|XP_009116969.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    229   2e-66   Brassica rapa
emb|CDX97567.1|  BnaA05g25120D                                          229   2e-66   
ref|XP_010534991.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    229   2e-66   Tarenaya hassleriana [spider flower]
ref|XP_002885038.1|  hypothetical protein ARALYDRAFT_478852             229   3e-66   
ref|XP_009146380.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    229   4e-66   Brassica rapa
gb|KFK38799.1|  hypothetical protein AALP_AA3G161700                    228   4e-66   Arabis alpina [alpine rockcress]
ref|XP_004958321.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    228   6e-66   Setaria italica
ref|XP_006407090.1|  hypothetical protein EUTSA_v10020162mg             228   7e-66   Eutrema salsugineum [saltwater cress]
ref|XP_006657962.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    228   8e-66   
ref|XP_006845116.1|  hypothetical protein AMTR_s00005p00184950          220   9e-66   
ref|XP_006300068.1|  hypothetical protein CARUB_v10016296mg             227   1e-65   Capsella rubella
ref|XP_010501850.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    227   2e-65   Camelina sativa [gold-of-pleasure]
gb|ACN34179.1|  unknown                                                 211   2e-65   Zea mays [maize]
gb|EMT02096.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    226   2e-65   
ref|XP_010465325.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    226   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_001780717.1|  predicted protein                                  217   3e-65   
gb|ACN58180.1|  leucine-rich repeat protein                             214   4e-65   Dasypyrum villosum
gb|ABQ53156.1|  leucine-rich repeat protein                             214   5e-65   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009388758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    225   6e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388759.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    225   6e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002461023.1|  hypothetical protein SORBIDRAFT_02g039370          225   7e-65   Sorghum bicolor [broomcorn]
emb|CDX98445.1|  BnaC05g39300D                                          225   9e-65   
emb|CDY33226.1|  BnaC01g36990D                                          224   1e-64   Brassica napus [oilseed rape]
ref|NP_001173462.1|  Os03g0397700                                       211   2e-64   
ref|XP_001776313.1|  predicted protein                                  216   2e-64   
ref|XP_008653345.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    224   2e-64   Zea mays [maize]
ref|XP_008653346.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    223   2e-64   
gb|AAV64203.1|  leucine-rich repeat transmembrane protein kinase ...    223   2e-64   Zea mays [maize]
emb|CAA18116.1|  serine/threonine protein kinase like protein           214   5e-64   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974312.1|  STRUBBELIG-receptor family 7 protein                  222   5e-64   Arabidopsis thaliana [mouse-ear cress]
dbj|BAG99361.1|  unnamed protein product                                222   5e-64   Oryza sativa Japonica Group [Japonica rice]
ref|NP_974311.1|  STRUBBELIG-receptor family 7 protein                  222   5e-64   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC10113.1|  putative leucine-rich repeat transmembrane prote...    223   7e-64   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82450.1|  hypothetical protein OsI_26884                          222   8e-64   Oryza sativa Indica Group [Indian rice]
ref|XP_010235400.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    222   9e-64   
ref|NP_001060286.1|  Os07g0618400                                       222   9e-64   
ref|NP_188052.2|  STRUBBELIG-receptor family 7 protein                  222   1e-63   Arabidopsis thaliana [mouse-ear cress]
gb|AFQ91933.1|  leucine-rich repeat receptor-like kinase                221   1e-63   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_002965192.1|  hypothetical protein SELMODRAFT_83158              214   1e-63   
emb|CDY36601.1|  BnaC06g06540D                                          221   2e-63   Brassica napus [oilseed rape]
ref|XP_006449793.1|  hypothetical protein CICLE_v10014418mg             221   2e-63   
ref|XP_006449794.1|  hypothetical protein CICLE_v10014418mg             220   4e-63   Citrus clementina [clementine]
ref|XP_006467381.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    220   4e-63   Citrus sinensis [apfelsine]
emb|CDY24077.1|  BnaA06g00750D                                          220   4e-63   Brassica napus [oilseed rape]
gb|KDO78347.1|  hypothetical protein CISIN_1g005001mg                   220   5e-63   Citrus sinensis [apfelsine]
ref|XP_006467380.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    220   6e-63   Citrus sinensis [apfelsine]
ref|XP_002979973.1|  hypothetical protein SELMODRAFT_112070             211   6e-63   
dbj|BAJ87185.1|  predicted protein                                      218   6e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010538738.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    219   7e-63   Tarenaya hassleriana [spider flower]
gb|KJB67279.1|  hypothetical protein B456_010G183400                    218   8e-63   Gossypium raimondii
ref|XP_008355924.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    219   1e-62   
ref|XP_007026174.1|  STRUBBELIG-receptor family 8 isoform 2             217   1e-62   
gb|KJB67276.1|  hypothetical protein B456_010G183400                    219   2e-62   Gossypium raimondii
ref|XP_010928424.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    217   2e-62   
ref|XP_010686780.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    218   3e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009357210.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    218   3e-62   Pyrus x bretschneideri [bai li]
ref|XP_002518426.1|  Serine/threonine-protein kinase PBS1, putative     217   3e-62   
emb|CDP04441.1|  unnamed protein product                                218   4e-62   Coffea canephora [robusta coffee]
ref|XP_008799298.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    216   4e-62   Phoenix dactylifera
ref|XP_009147586.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    218   4e-62   Brassica rapa
ref|XP_010539270.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    217   4e-62   Tarenaya hassleriana [spider flower]
ref|XP_010539262.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    217   5e-62   Tarenaya hassleriana [spider flower]
ref|NP_001119030.1|  STRUBBELIG-receptor family 8 protein               214   5e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010539255.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    217   5e-62   Tarenaya hassleriana [spider flower]
ref|XP_007026173.1|  STRUBBELIG-receptor family 8 isoform 1             217   7e-62   
ref|XP_010928422.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    217   7e-62   
ref|XP_008458999.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    215   8e-62   Cucumis melo [Oriental melon]
ref|XP_008384096.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    217   8e-62   Malus domestica [apple tree]
ref|XP_011460016.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    217   9e-62   Fragaria vesca subsp. vesca
ref|XP_010244139.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    217   1e-61   Nelumbo nucifera [Indian lotus]
ref|XP_010943264.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    216   1e-61   
ref|XP_003562663.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    220   1e-61   Brachypodium distachyon [annual false brome]
ref|XP_007213628.1|  hypothetical protein PRUPE_ppa002088mg             216   1e-61   
ref|XP_008224758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    216   1e-61   Prunus mume [ume]
ref|XP_010052885.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    215   1e-61   Eucalyptus grandis [rose gum]
ref|XP_009357487.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    216   1e-61   Pyrus x bretschneideri [bai li]
dbj|BAK07184.1|  predicted protein                                      216   1e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP20703.1|  hypothetical protein JCGZ_21174                         216   2e-61   Jatropha curcas
ref|XP_010943263.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    216   2e-61   Elaeis guineensis
ref|XP_006284970.1|  hypothetical protein CARUB_v10006274mg             216   2e-61   Capsella rubella
ref|XP_004486188.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    215   2e-61   
ref|XP_010052884.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    216   2e-61   Eucalyptus grandis [rose gum]
ref|XP_004164349.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    215   2e-61   
ref|XP_010099162.1|  Protein STRUBBELIG-RECEPTOR FAMILY 8               216   2e-61   
ref|XP_006435523.1|  hypothetical protein CICLE_v10010883mg             207   2e-61   
gb|EEC72655.1|  hypothetical protein OsI_06182                          216   2e-61   Oryza sativa Indica Group [Indian rice]
ref|XP_006648399.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    216   2e-61   
ref|XP_008799289.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    216   2e-61   Phoenix dactylifera
ref|NP_001046150.1|  Os02g0190500                                       215   3e-61   
ref|XP_007147687.1|  hypothetical protein PHAVU_006G146100g             215   3e-61   Phaseolus vulgaris [French bean]
ref|XP_008803525.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    216   3e-61   Phoenix dactylifera
dbj|BAD37979.1|  putative leucine-rich repeat transmembrane prote...    213   3e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010448928.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    215   3e-61   Camelina sativa [gold-of-pleasure]
ref|XP_008458998.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    215   3e-61   Cucumis melo [Oriental melon]
ref|XP_011086205.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    214   3e-61   Sesamum indicum [beniseed]
ref|XP_011002570.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    215   3e-61   Populus euphratica
ref|XP_010439362.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    215   4e-61   Camelina sativa [gold-of-pleasure]
ref|XP_004241858.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    214   4e-61   Solanum lycopersicum
ref|XP_004951618.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    215   4e-61   Setaria italica
ref|XP_011002569.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    215   4e-61   Populus euphratica
ref|XP_006383864.1|  hypothetical protein POPTR_0004s00710g             213   4e-61   
ref|XP_002962278.1|  hypothetical protein SELMODRAFT_76873              214   4e-61   
gb|KFK28787.1|  hypothetical protein AALP_AA7G048200                    214   4e-61   Arabis alpina [alpine rockcress]
ref|XP_003571057.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    215   4e-61   Brachypodium distachyon [annual false brome]
ref|XP_010252506.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    215   4e-61   Nelumbo nucifera [Indian lotus]
ref|XP_004145432.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    215   4e-61   Cucumis sativus [cucumbers]
ref|XP_010052883.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    215   5e-61   Eucalyptus grandis [rose gum]
ref|XP_006348158.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    215   5e-61   Solanum tuberosum [potatoes]
ref|XP_004232684.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    215   5e-61   Solanum lycopersicum
ref|XP_010434074.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    214   5e-61   Camelina sativa [gold-of-pleasure]
gb|EMT22844.1|  hypothetical protein F775_52608                         213   5e-61   
ref|XP_002267170.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    214   6e-61   Vitis vinifera
ref|NP_193944.2|  STRUBBELIG-receptor family 8 protein                  214   6e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008645353.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    214   6e-61   Zea mays [maize]
gb|EMS51823.1|  Protein STRUBBELIG-RECEPTOR FAMILY 8                    213   8e-61   Triticum urartu
ref|XP_009777766.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    214   9e-61   Nicotiana sylvestris
gb|EMT07607.1|  Protein STRUBBELIG-RECEPTOR FAMILY 7                    218   9e-61   
ref|XP_001783845.1|  predicted protein                                  214   9e-61   
ref|XP_011046989.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    214   1e-60   Populus euphratica
ref|XP_002451696.1|  hypothetical protein SORBIDRAFT_04g006110          214   1e-60   Sorghum bicolor [broomcorn]
ref|XP_009613682.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    214   1e-60   Nicotiana tomentosiformis
ref|XP_006586762.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    214   1e-60   Glycine max [soybeans]
ref|XP_006413689.1|  hypothetical protein EUTSA_v10024563mg             213   1e-60   Eutrema salsugineum [saltwater cress]
ref|XP_002869840.1|  kinase                                             213   2e-60   Arabidopsis lyrata subsp. lyrata
gb|KEH36931.1|  strubbelig-receptor family protein                      213   2e-60   Medicago truncatula
gb|EEE66066.1|  hypothetical protein OsJ_22073                          213   2e-60   Oryza sativa Japonica Group [Japonica rice]
gb|KJB69228.1|  hypothetical protein B456_011G011800                    213   2e-60   Gossypium raimondii
gb|KHG11352.1|  protein strubbelig-receptor family 8                    213   2e-60   Gossypium arboreum [tree cotton]
ref|XP_006650171.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    213   3e-60   Oryza brachyantha
gb|EEC81030.1|  hypothetical protein OsI_23812                          212   3e-60   Oryza sativa Indica Group [Indian rice]
gb|AAP12946.1|  putative leucine-rich repeat transmembrane protei...    213   4e-60   Oryza sativa Japonica Group [Japonica rice]
emb|CDX82908.1|  BnaC01g13580D                                          212   4e-60   
emb|CDX79126.1|  BnaA01g11930D                                          212   4e-60   
gb|EAY90345.1|  hypothetical protein OsI_11922                          213   4e-60   Oryza sativa Indica Group [Indian rice]
ref|XP_009135627.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    212   4e-60   Brassica rapa
ref|XP_009385272.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    212   5e-60   
ref|XP_006657163.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    211   5e-60   
ref|XP_006377174.1|  hypothetical protein POPTR_0011s01540g             210   5e-60   
ref|XP_009108553.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    211   6e-60   Brassica rapa
gb|EYU33875.1|  hypothetical protein MIMGU_mgv1a002066mg                212   6e-60   Erythranthe guttata [common monkey flower]
ref|XP_009385265.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    212   6e-60   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX76385.1|  BnaA08g10150D                                          211   7e-60   
emb|CDY27444.1|  BnaC03g64840D                                          211   7e-60   Brassica napus [oilseed rape]
ref|XP_006597598.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    211   1e-59   Glycine max [soybeans]
ref|XP_009386651.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    211   1e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002316561.2|  hypothetical protein POPTR_0011s01540g             210   2e-59   
emb|CAN77920.1|  hypothetical protein VITISV_027646                     211   2e-59   Vitis vinifera
ref|XP_003563583.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    209   7e-59   
ref|XP_006850999.1|  hypothetical protein AMTR_s00025p00216900          207   2e-58   
dbj|BAJ88293.1|  predicted protein                                      202   3e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006488603.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    207   3e-58   Citrus sinensis [apfelsine]
ref|XP_006357471.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    193   3e-58   
ref|XP_004965804.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    205   1e-57   
gb|EPS69681.1|  hypothetical protein M569_05081                         204   2e-57   
ref|XP_008659800.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    203   4e-57   
ref|XP_001778654.1|  predicted protein                                  194   4e-57   
gb|KCW53999.1|  hypothetical protein EUGRSUZ_J03194                     203   5e-57   
gb|EMS53763.1|  Protein STRUBBELIG-RECEPTOR FAMILY 8                    202   7e-57   
gb|AFW87368.1|  putative STRUBBELIG family receptor protein kinase      203   7e-57   
gb|AFW76249.1|  putative STRUBBELIG family receptor protein kinase      201   7e-57   
gb|AFW87367.1|  putative STRUBBELIG family receptor protein kinase      203   7e-57   
ref|XP_008659801.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    203   7e-57   
gb|AFW76250.1|  putative STRUBBELIG family receptor protein kinase      200   8e-57   
ref|XP_010034888.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    203   8e-57   
ref|XP_002320001.2|  leucine-rich repeat transmembrane protein ki...    202   8e-57   
gb|EMT21016.1|  Protein STRUBBELIG-RECEPTOR FAMILY 8                    202   9e-57   
dbj|BAK02781.1|  predicted protein                                      203   1e-56   
ref|XP_002513297.1|  strubbelig receptor, putative                      202   1e-56   
ref|XP_011012291.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    201   3e-56   
ref|XP_008649053.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    201   3e-56   
ref|XP_008649054.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    201   3e-56   
ref|XP_001763842.1|  predicted protein                                  199   1e-55   
ref|XP_009406399.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    199   2e-55   
ref|XP_002465165.1|  hypothetical protein SORBIDRAFT_01g033190          199   3e-55   
ref|XP_010228525.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    197   6e-55   
ref|XP_010228524.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    197   6e-55   
ref|XP_006841742.1|  hypothetical protein AMTR_s00003p00260350          198   7e-55   
ref|XP_003557758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    197   7e-55   
ref|XP_009398616.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    196   7e-55   
ref|XP_008228078.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    197   7e-55   
ref|XP_002889223.1|  ATP binding protein                                197   9e-55   
ref|XP_006301930.1|  hypothetical protein CARUB_v10022406mg             197   1e-54   
emb|CDX87418.1|  BnaA07g34550D                                          197   1e-54   
ref|NP_178019.2|  STRUBBELIG-receptor family 5                          196   2e-54   
gb|KDP25030.1|  hypothetical protein JCGZ_22565                         196   3e-54   
ref|XP_007217699.1|  hypothetical protein PRUPE_ppa002458mg             196   3e-54   
ref|XP_009398615.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    195   3e-54   
ref|XP_009408730.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    196   3e-54   
gb|KFK42269.1|  hypothetical protein AALP_AA2G233600                    196   3e-54   
emb|CDX88495.1|  BnaC06g39390D                                          196   3e-54   
ref|XP_009398614.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    195   4e-54   
ref|XP_011011656.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    195   4e-54   
ref|XP_006389935.1|  hypothetical protein EUTSA_v10019668mg             195   4e-54   
ref|XP_009106613.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    195   4e-54   
ref|XP_010474484.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    195   5e-54   
ref|XP_010417514.1|  PREDICTED: LOW QUALITY PROTEIN: protein STRU...    195   5e-54   
ref|XP_004138532.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    194   7e-54   
gb|KGN45936.1|  hypothetical protein Csa_6G024930                       194   8e-54   
emb|CDO97730.1|  unnamed protein product                                195   8e-54   
ref|XP_008380426.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    192   1e-53   
ref|XP_008445635.1|  PREDICTED: LOW QUALITY PROTEIN: protein STRU...    194   2e-53   
gb|KHN38109.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5                    194   2e-53   
ref|XP_009344018.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    192   2e-53   
ref|XP_002310348.1|  leucine-rich repeat transmembrane protein ki...    193   2e-53   
ref|XP_011031253.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    193   2e-53   
ref|XP_009781364.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    192   4e-53   
ref|XP_008380425.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    192   4e-53   
ref|XP_004488910.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    192   5e-53   
ref|XP_006586431.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    192   5e-53   
ref|XP_009781363.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    192   5e-53   
ref|XP_003604115.1|  Protein STRUBBELIG-RECEPTOR FAMILY                 193   5e-53   
ref|XP_010928729.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    192   5e-53   
ref|XP_009781362.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    192   6e-53   
ref|XP_009346025.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    190   7e-53   
ref|XP_009344017.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    192   9e-53   
emb|CAN60971.1|  hypothetical protein VITISV_032050                     189   1e-52   
ref|XP_009346024.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    190   3e-52   
ref|XP_009616311.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    190   3e-52   
ref|XP_009616310.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    190   4e-52   
ref|XP_010245765.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    189   7e-52   
ref|XP_010655241.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    187   1e-51   
gb|EAZ27223.1|  hypothetical protein OsJ_11161                          189   1e-51   
ref|XP_007135872.1|  hypothetical protein PHAVU_010G165200g             188   1e-51   
ref|XP_007135873.1|  hypothetical protein PHAVU_010G165200g             188   1e-51   
emb|CBI18374.3|  unnamed protein product                                188   2e-51   
ref|XP_010655239.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    187   2e-51   
ref|XP_010087069.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5               187   2e-51   
ref|XP_010537759.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    186   3e-51   
ref|XP_009391183.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    187   4e-51   
ref|XP_010537758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    186   6e-51   
gb|AFW76248.1|  putative STRUBBELIG family receptor protein kinase      187   8e-51   
gb|AFW76246.1|  putative STRUBBELIG family receptor protein kinas...    187   2e-50   
ref|XP_010696138.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    184   6e-50   
ref|XP_010696137.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    184   6e-50   
ref|XP_011467514.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    183   9e-50   
gb|EEE67594.1|  hypothetical protein OsJ_25142                          183   9e-50   
ref|XP_010322795.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    182   2e-49   
ref|XP_006357454.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    181   2e-49   
ref|XP_004241857.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    182   3e-49   
ref|XP_010278329.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    181   3e-49   
emb|CBI38492.3|  unnamed protein product                                171   8e-49   
ref|XP_010278322.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    181   8e-49   
ref|XP_010278328.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    181   8e-49   
ref|XP_006357453.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    180   9e-49   
ref|XP_006661536.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    179   1e-48   
ref|XP_007023605.1|  Strubbelig-receptor family 5 isoform 1             181   2e-48   
emb|CDP19685.1|  unnamed protein product                                179   2e-48   
ref|XP_010913800.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    178   5e-48   
ref|XP_010913799.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    178   5e-48   
emb|CDP14731.1|  unnamed protein product                                178   7e-48   
ref|XP_008781708.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    177   8e-48   
ref|XP_009775785.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    172   9e-48   
gb|ACN31809.1|  unknown                                                 167   1e-47   
ref|XP_010268782.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    177   1e-47   
ref|XP_010268781.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    177   2e-47   
ref|XP_010316717.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    176   4e-47   
gb|ACM89529.1|  leucine-rich repeat transmembrane protein kinase        169   4e-47   
dbj|BAD45956.1|  putative leucine-rich repeat transmembrane prote...    170   6e-47   
ref|XP_010316715.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    174   2e-46   
ref|XP_010316713.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    174   2e-46   
ref|XP_010316716.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    174   2e-46   
gb|KJB66324.1|  hypothetical protein B456_010G135500                    170   2e-46   
ref|XP_006447319.1|  hypothetical protein CICLE_v10014768mg             172   2e-46   
ref|NP_001141597.1|  uncharacterized protein LOC100273714               168   4e-46   
ref|XP_009789818.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    173   4e-46   
ref|XP_009789819.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    173   4e-46   
ref|XP_009789815.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    173   5e-46   
ref|XP_002517969.1|  lrr receptor-linked protein kinase, putative       172   7e-46   
ref|XP_011072790.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    172   8e-46   
ref|XP_002460659.1|  hypothetical protein SORBIDRAFT_02g032710          172   8e-46   
gb|KJB66323.1|  hypothetical protein B456_010G135500                    171   9e-46   
ref|XP_006491630.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    172   9e-46   
ref|XP_010696576.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    172   1e-45   
gb|KJB67278.1|  hypothetical protein B456_010G183400                    171   1e-45   
gb|KJB56462.1|  hypothetical protein B456_009G120500                    171   2e-45   
ref|XP_009625937.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    171   3e-45   
ref|XP_009593677.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    171   3e-45   
ref|XP_004959657.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    171   3e-45   
ref|XP_009593738.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    171   3e-45   
gb|KCW77015.1|  hypothetical protein EUGRSUZ_D01360                     171   3e-45   
ref|XP_009593450.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    171   3e-45   
gb|KDP20913.1|  hypothetical protein JCGZ_21384                         170   3e-45   
gb|KHG16784.1|  protein strubbelig-receptor family 5                    169   4e-45   
gb|ACN66753.1|  SRF3                                                    159   4e-45   
gb|EEE70214.1|  hypothetical protein OsJ_30326                          170   4e-45   
ref|XP_003576835.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    169   4e-45   
ref|NP_001063921.1|  Os09g0559900                                       170   5e-45   
ref|XP_003539524.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    170   6e-45   
gb|KHN04276.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                    170   8e-45   
ref|XP_006594332.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    169   1e-44   
ref|XP_006594333.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    169   1e-44   
ref|XP_003541551.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    169   1e-44   
gb|AFW87593.1|  putative STRUBBELIG family receptor protein kinase      157   1e-44   
gb|AAQ54536.1|  protein kinase                                          159   1e-44   
dbj|BAF00067.1|  SRF3                                                   163   1e-44   
gb|EPS62270.1|  hypothetical protein M569_12522                         157   1e-44   
gb|KHG30272.1|  protein strubbelig-receptor family 3                    166   2e-44   
gb|EEC85048.1|  hypothetical protein OsI_32379                          168   2e-44   
ref|XP_002521411.1|  lrr receptor-linked protein kinase, putative       168   2e-44   
ref|XP_010645355.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    156   2e-44   
ref|XP_011085359.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    169   2e-44   
gb|AFW70556.1|  putative STRUBBELIG family receptor protein kinase      167   2e-44   
ref|XP_007159275.1|  hypothetical protein PHAVU_002G224200g             167   3e-44   
ref|XP_008341914.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    167   3e-44   
gb|EPS68087.1|  hypothetical protein M569_06686                         167   5e-44   
gb|ABI81608.1|  strubbelig receptor family 1 protein isoform a          167   5e-44   
emb|CBI32990.3|  unnamed protein product                                157   5e-44   
ref|XP_009767606.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    167   5e-44   
gb|KHN36613.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                    167   6e-44   
ref|XP_004958051.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    167   6e-44   
ref|XP_008341912.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    167   6e-44   
ref|XP_004958054.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    167   6e-44   
ref|XP_006594861.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    167   7e-44   
ref|XP_003560082.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    167   8e-44   
ref|XP_011096273.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 1    166   9e-44   
gb|KHN07302.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                    166   1e-43   
ref|XP_010069855.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    166   1e-43   
ref|XP_003528433.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    166   1e-43   
gb|KCW89495.1|  hypothetical protein EUGRSUZ_A01788                     166   1e-43   
gb|KJB69230.1|  hypothetical protein B456_011G011800                    166   2e-43   
ref|XP_004487313.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    166   2e-43   
ref|XP_006371595.1|  hypothetical protein POPTR_0019s13490g             166   2e-43   
ref|XP_006371594.1|  leucine-rich repeat transmembrane protein ki...    166   3e-43   
gb|KJB31725.1|  hypothetical protein B456_005G204500                    165   3e-43   
ref|XP_006376519.1|  hypothetical protein POPTR_0013s14080g             164   3e-43   
dbj|BAJ87442.1|  predicted protein                                      166   3e-43   
emb|CDX79278.1|  BnaC06g20250D                                          161   3e-43   
gb|EMT09510.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                    164   3e-43   
gb|EMS55269.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                    165   4e-43   
ref|XP_008230238.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    165   4e-43   
ref|XP_007043518.1|  Strubbelig-receptor family 3 isoform 1             165   4e-43   
ref|XP_010313855.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    164   4e-43   
ref|NP_001167936.1|  uncharacterized LOC100381650                       153   5e-43   
ref|XP_009350761.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    164   5e-43   
ref|XP_011039760.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    164   5e-43   
ref|NP_001167726.1|  uncharacterized protein LOC100381414               161   5e-43   
gb|KJB31723.1|  hypothetical protein B456_005G204500                    165   6e-43   
ref|NP_565489.2|  strubbelig-receptor family 1 protein                  164   6e-43   
gb|AAL07025.1|  putative LRR receptor protein kinase                    164   7e-43   
ref|XP_002319371.2|  hypothetical protein POPTR_0013s14080g             164   7e-43   
emb|CDY48557.1|  BnaA09g01530D                                          164   7e-43   
gb|EYU27953.1|  hypothetical protein MIMGU_mgv1a002415mg                164   7e-43   
ref|XP_009416085.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    163   8e-43   
ref|XP_009357082.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    164   8e-43   
ref|XP_007149883.1|  hypothetical protein PHAVU_005G106800g             164   8e-43   
ref|XP_010323714.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    164   8e-43   
ref|XP_008356124.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    164   8e-43   
ref|XP_002305672.2|  hypothetical protein POPTR_0004s03720g             164   8e-43   
ref|XP_010499921.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    163   8e-43   
ref|XP_009350736.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    164   9e-43   
ref|XP_009416084.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    163   9e-43   
ref|XP_009350757.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    164   9e-43   
ref|XP_007217036.1|  hypothetical protein PRUPE_ppa001617mg             164   9e-43   
ref|XP_004251794.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    164   1e-42   
ref|XP_010487048.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    163   1e-42   
ref|XP_010465107.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 4    163   1e-42   
ref|XP_006594611.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    163   1e-42   
ref|XP_011039757.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    164   1e-42   
ref|XP_010057470.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    163   1e-42   
gb|KEH39081.1|  strubbelig receptor family protein                      164   1e-42   
gb|KHG09080.1|  protein strubbelig-receptor family 5                    162   2e-42   
ref|XP_006350044.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    163   2e-42   
ref|NP_001275442.1|  LRR receptor-like kinase precursor                 163   2e-42   
ref|XP_002988579.1|  hypothetical protein SELMODRAFT_21917              157   2e-42   
tpg|DAA63160.1|  TPA: putative STRUBBELIG family receptor protein...    162   2e-42   
ref|XP_010689695.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    163   2e-42   
ref|XP_011467796.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    162   3e-42   
ref|XP_010689694.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    163   3e-42   
ref|XP_010689690.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    163   3e-42   
gb|KDP24176.1|  hypothetical protein JCGZ_25833                         162   3e-42   
ref|XP_006300119.1|  hypothetical protein CARUB_v10016348mg             162   3e-42   
ref|XP_010905448.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    162   3e-42   



>ref|XP_009614011.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Nicotiana tomentosiformis]
Length=717

 Score =   276 bits (707),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLASLI D DQALN N+ SGYGAPEVAMSGQ+TIKSDVYSFGV MLELLTGR PFD  R 
Sbjct  561  GLASLIADVDQALNHNTGSGYGAPEVAMSGQFTIKSDVYSFGVVMLELLTGRKPFDGGRT  620

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDAL+KMVDPAL GLYPVKSLSRFADVIALCVQPEPEFRPPMSE
Sbjct  621  RSEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  680

Query  357  VVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  250
            VVEALVRLVQRANMS+RTFG D  +  G AD+Q+YE
Sbjct  681  VVEALVRLVQRANMSKRTFGVDQASPRGEADAQDYE  716



>ref|XP_009796493.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
sylvestris]
Length=718

 Score =   276 bits (707),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLASLI D DQALN N+ SGYGAPEVAMSGQ+TIKSDVYSFGV MLELLTGR PFD  R 
Sbjct  562  GLASLIADVDQALNHNTGSGYGAPEVAMSGQFTIKSDVYSFGVVMLELLTGRKPFDGGRS  621

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDAL+KMVDPAL GLYPVKSLSRFADVIALCVQPEPEFRPPMSE
Sbjct  622  RSEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  681

Query  357  VVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  250
            VVEALVRLVQRANMS+RTFG D  +  G AD+Q+YE
Sbjct  682  VVEALVRLVQRANMSKRTFGVDQASPRGEADAQDYE  717



>ref|XP_006342885.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Solanum 
tuberosum]
Length=711

 Score =   273 bits (698),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLASLI D DQALN N+ SGYGAPEVAMSG  TIKSDVYSFGV MLELLTGR PFDS+R 
Sbjct  555  GLASLIADADQALNHNTGSGYGAPEVAMSGLCTIKSDVYSFGVVMLELLTGRKPFDSART  614

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDAL+KMVDPAL GLYPVKSLSRFADVIALCVQPEPEFRPPMSE
Sbjct  615  RSEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  674

Query  357  VVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  250
            VVEALVRLVQRANMS+RTFGAD  T  G  D  +YE
Sbjct  675  VVEALVRLVQRANMSKRTFGADQGTSRGETDGPDYE  710



>gb|ABO31100.1| ovule receptor-like kinase 28 [Solanum chacoense]
Length=711

 Score =   273 bits (697),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLASLI D DQALN N+ SGYGAPEVAMSG  TIKSDVYSFGV MLELLTGR PFDS+R 
Sbjct  555  GLASLIADADQALNHNTGSGYGAPEVAMSGLCTIKSDVYSFGVVMLELLTGRKPFDSART  614

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDAL+KMVDPAL GLYPVKSLSRFADVIALCVQPEPEFRPPMSE
Sbjct  615  RSEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  674

Query  357  VVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  250
            VVEALVRLVQRANMS+RTFGAD  T  G  D  +YE
Sbjct  675  VVEALVRLVQRANMSKRTFGADQGTSRGETDGPDYE  710



>emb|CDO97777.1| unnamed protein product [Coffea canephora]
Length=712

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 141/156 (90%), Gaps = 2/156 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLASL+ D DQALNQN+ SGYGAPEV+MSGQYTIKSDVYSFGV MLELLTGR PFDSSR 
Sbjct  556  GLASLVHDIDQALNQNAGSGYGAPEVSMSGQYTIKSDVYSFGVVMLELLTGRQPFDSSRA  615

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMSE
Sbjct  616  RSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  675

Query  357  VVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  256
            VV+ALVRLVQRANMSRRT G D  S  RS ++D Q+
Sbjct  676  VVQALVRLVQRANMSRRTLGNDQGSSVRSNNSDDQD  711



>ref|XP_002533323.1| leucine-rich repeat transmembrane protein kinase, putative [Ricinus 
communis]
 gb|EEF29059.1| leucine-rich repeat transmembrane protein kinase, putative [Ricinus 
communis]
Length=607

 Score =   269 bits (687),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 142/158 (90%), Gaps = 2/158 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P+ +QALN N+ SGYGAPEVAMSGQYT+KSDVYSFGV MLELLTGR PFDSSR
Sbjct  449  SGLASFLPNAEQALNNNAGSGYGAPEVAMSGQYTLKSDVYSFGVVMLELLTGRKPFDSSR  508

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDALSKMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  509  PRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  568

Query  360  EVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQEY  253
            EVV+ALVRLVQRANMS+RT G D  +  +  +AD+ +Y
Sbjct  569  EVVQALVRLVQRANMSKRTVGNDQGASRQVDNADAHDY  606



>ref|XP_004235517.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Solanum lycopersicum]
Length=710

 Score =   271 bits (692),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLASLI D DQALN N+ SGYGAPEVAMSG  TIKSDVYSFGV MLELLTGR PFDS+R 
Sbjct  554  GLASLIADADQALNHNTGSGYGAPEVAMSGLCTIKSDVYSFGVVMLELLTGRKPFDSART  613

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQ LVRWATPQLHDIDAL+KMVDPAL GLYPVKSLSRFADVIALCVQPEPEFRPPMSE
Sbjct  614  RSEQDLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  673

Query  357  VVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  250
            VVEALVRLVQRANMS+RTFGAD  T  G  D  +YE
Sbjct  674  VVEALVRLVQRANMSKRTFGADQGTSRGETDGPDYE  709



>ref|XP_004252624.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Solanum lycopersicum]
Length=706

 Score =   268 bits (686),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 139/157 (89%), Gaps = 1/157 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLASLI D DQALN N+ SGYGAPEVAM GQ TIKSDVYSFGV MLELLTGRTPFDS R
Sbjct  550  SGLASLINDADQALNHNTGSGYGAPEVAMYGQCTIKSDVYSFGVVMLELLTGRTPFDSER  609

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKS+SRFADVIALCVQ EPEFRPPMS
Sbjct  610  PRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSISRFADVIALCVQSEPEFRPPMS  669

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  250
            EVVEALVRLVQRANMS+RT+  D R+  G  DSQ+ +
Sbjct  670  EVVEALVRLVQRANMSKRTYSID-RSSRGETDSQDNQ  705



>ref|XP_009619763.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
tomentosiformis]
Length=707

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 138/157 (88%), Gaps = 1/157 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLASLI D DQALN N+ SGYGAPE AM GQ TIKSDVYSFGV MLELLTGR PFDS R
Sbjct  551  SGLASLIDDADQALNHNTGSGYGAPEGAMYGQCTIKSDVYSFGVVMLELLTGRKPFDSER  610

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKS+SRFADVIALCVQPEPEFRPPMS
Sbjct  611  PRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSISRFADVIALCVQPEPEFRPPMS  670

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  250
            EVVEALVRLVQRANMS+RTF  D R+  G  D+Q+ +
Sbjct  671  EVVEALVRLVQRANMSKRTFSLD-RSSRGETDAQDNQ  706



>gb|KDP40614.1| hypothetical protein JCGZ_24613 [Jatropha curcas]
Length=714

 Score =   266 bits (679),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P+ DQALN +SASGYGAPEVAMSGQYT+KSDVYSFGV MLELLTGR PFDSSR
Sbjct  556  SGLASFLPNADQALNNDSASGYGAPEVAMSGQYTLKSDVYSFGVVMLELLTGRKPFDSSR  615

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQ EPEFRPPMS
Sbjct  616  PRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQSEPEFRPPMS  675

Query  360  EVVEALVRLVQRANMSRRTFGAD  292
            EVV+ALVRLVQRANMS+RT G D
Sbjct  676  EVVQALVRLVQRANMSKRTVGND  698



>gb|KDO53740.1| hypothetical protein CISIN_1g0080551mg, partial [Citrus sinensis]
Length=148

 Score =   249 bits (635),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 131/147 (89%), Gaps = 3/147 (2%)
 Frame = -1

Query  684  ALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRPRPEQSLVRWAT  505
            ALN ++ SGYGAPEVAMSGQY IKSDVYSFGV MLELLTGR PFDSSRPR EQSLVRWAT
Sbjct  1    ALNNDAGSGYGAPEVAMSGQYNIKSDVYSFGVVMLELLTGRKPFDSSRPRLEQSLVRWAT  60

Query  504  PQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVEALVRLVQR  325
            PQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMSEVV+ALVRLVQR
Sbjct  61   PQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQR  120

Query  324  ANMSRRTFGAD---SRTRSGSADSQEY  253
            ANMS+RT G D   +  R  + D+Q+Y
Sbjct  121  ANMSKRTIGNDQGPTTPRGDNQDTQDY  147



>ref|XP_006362102.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Solanum 
tuberosum]
Length=706

 Score =   265 bits (678),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 138/156 (88%), Gaps = 2/156 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLASLI D DQALN N+ SGYGAPEVAM GQ TIKSDVYSFGV MLELLTGRTPFDS R
Sbjct  550  SGLASLINDADQALNHNTGSGYGAPEVAMYGQCTIKSDVYSFGVVMLELLTGRTPFDSER  609

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKS+SRFADVIALCVQ EPEFRPPMS
Sbjct  610  PRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSISRFADVIALCVQSEPEFRPPMS  669

Query  360  EVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQ  259
            EVVEALVRLVQRANMS+RT+  D  SR  + + D+Q
Sbjct  670  EVVEALVRLVQRANMSKRTYSIDRGSRGETDALDNQ  705



>ref|XP_008465039.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 isoform X5 [Cucumis 
melo]
Length=584

 Score =   262 bits (669),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLAS I + DQAL+Q + SGY APEV MSGQYT+KSDVYSFGV MLELL+GR PFDSSRP
Sbjct  427  GLASFITNLDQALDQQTGSGYSAPEVTMSGQYTLKSDVYSFGVVMLELLSGRKPFDSSRP  486

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADV+ALCVQPEPEFRPPMSE
Sbjct  487  RAEQSLVRWATPQLHDIDALTKMVDPALKGLYPVKSLSRFADVVALCVQPEPEFRPPMSE  546

Query  357  VVEALVRLVQRANMSRRTFGAD  292
            VVEALVRLVQR+NMSRRTFG+D
Sbjct  547  VVEALVRLVQRSNMSRRTFGSD  568



>ref|XP_008372915.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Malus domestica]
 ref|XP_008372916.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Malus domestica]
Length=714

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 139/157 (89%), Gaps = 2/157 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS IP+ DQAL+ N+ SGY APEVAMSGQYT+KSDVY FGV MLELL+GR PFD+S+
Sbjct  555  SGLASSIPNADQALDHNAGSGYSAPEVAMSGQYTLKSDVYCFGVVMLELLSGRKPFDNSK  614

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDALSKMVDP L+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  615  PRSEQSLVRWATPQLHDIDALSKMVDPELKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  674

Query  360  EVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  256
            EVVEALVRLVQRANMSRRT G D  S    G+AD+Q+
Sbjct  675  EVVEALVRLVQRANMSRRTVGNDQGSSHGGGNADAQD  711



>ref|XP_006465790.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Citrus 
sinensis]
Length=723

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 140/158 (89%), Gaps = 3/158 (2%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLAS +P+ D+ALN ++ SGYGAPEVAMSGQY IKSDVYSFGV MLELLTGR PFDSSRP
Sbjct  565  GLASNMPNADEALNNDAGSGYGAPEVAMSGQYNIKSDVYSFGVVMLELLTGRKPFDSSRP  624

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMSE
Sbjct  625  RLEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  684

Query  357  VVEALVRLVQRANMSRRTFGAD---SRTRSGSADSQEY  253
            VV+ALVRLVQRANMS+RT G D   +  R  + D+Q+Y
Sbjct  685  VVQALVRLVQRANMSKRTIGNDQGPTTPRGDNQDTQDY  722



>ref|XP_006426818.1| hypothetical protein CICLE_v10025011mg [Citrus clementina]
 gb|ESR40058.1| hypothetical protein CICLE_v10025011mg [Citrus clementina]
Length=723

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 140/158 (89%), Gaps = 3/158 (2%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLAS +P+ D+ALN ++ SGYGAPEVAMSGQY IKSDVYSFGV MLELLTGR PFDSSRP
Sbjct  565  GLASNMPNADEALNNDAGSGYGAPEVAMSGQYNIKSDVYSFGVVMLELLTGRKPFDSSRP  624

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMSE
Sbjct  625  RLEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  684

Query  357  VVEALVRLVQRANMSRRTFGAD---SRTRSGSADSQEY  253
            VV+ALVRLVQRANMS+RT G D   +  R  + D+Q+Y
Sbjct  685  VVQALVRLVQRANMSKRTIGNDQGPTTPRGDNQDTQDY  722



>ref|XP_008228094.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Prunus mume]
Length=717

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 137/157 (87%), Gaps = 2/157 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            +GLAS IP+ DQAL  N+ SGY APEVAMSGQYT+KSDVY FGV MLEL++GR PFDSS+
Sbjct  558  TGLASFIPNADQALEHNAGSGYSAPEVAMSGQYTLKSDVYGFGVVMLELISGRKPFDSSK  617

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDALSKMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  618  PRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  677

Query  360  EVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  256
            EVVEALVRLVQRANMSRRT G D     R  +A+ Q+
Sbjct  678  EVVEALVRLVQRANMSRRTIGNDQGGSQRGDNANGQD  714



>ref|XP_006369070.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP65639.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=715

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 138/158 (87%), Gaps = 2/158 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  DQ LNQN+ SGYGAPEVAMSG YT+KSDVYSFG  MLELLTGR PFDSSR
Sbjct  556  SGLASCLPHADQVLNQNAGSGYGAPEVAMSGHYTLKSDVYSFGAVMLELLTGRKPFDSSR  615

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDALSKMVDP L+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  616  PRSEQSLVRWATPQLHDIDALSKMVDPELKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  675

Query  360  EVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQEY  253
            EVV+ALVRLVQRANMS+RT G +     R+ + D+Q+Y
Sbjct  676  EVVQALVRLVQRANMSKRTIGNEQGETPRAVNPDTQDY  713



>ref|XP_008465038.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 isoform X4 [Cucumis 
melo]
Length=637

 Score =   261 bits (668),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLAS I + DQAL+Q + SGY APEV MSGQYT+KSDVYSFGV MLELL+GR PFDSSRP
Sbjct  480  GLASFITNLDQALDQQTGSGYSAPEVTMSGQYTLKSDVYSFGVVMLELLSGRKPFDSSRP  539

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADV+ALCVQPEPEFRPPMSE
Sbjct  540  RAEQSLVRWATPQLHDIDALTKMVDPALKGLYPVKSLSRFADVVALCVQPEPEFRPPMSE  599

Query  357  VVEALVRLVQRANMSRRTFGAD  292
            VVEALVRLVQR+NMSRRTFG+D
Sbjct  600  VVEALVRLVQRSNMSRRTFGSD  621



>gb|EYU21255.1| hypothetical protein MIMGU_mgv1a002171mg [Erythranthe guttata]
Length=705

 Score =   263 bits (672),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 137/154 (89%), Gaps = 5/154 (3%)
 Frame = -1

Query  714  LASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRPR  535
            LASL+ D DQ      ASGY APEVAMSGQYTIKSDVYSFGV MLELLTGRTPFDS+R R
Sbjct  555  LASLVRDPDQV-----ASGYSAPEVAMSGQYTIKSDVYSFGVVMLELLTGRTPFDSARQR  609

Query  534  PEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSEV  355
             EQSLVRWATPQLHDIDALSKMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMSEV
Sbjct  610  SEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEV  669

Query  354  VEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            V+ALVRLVQRANMS+RTFG +   RS SAD++EY
Sbjct  670  VQALVRLVQRANMSKRTFGNEGAARSDSADAEEY  703



>gb|EYU21256.1| hypothetical protein MIMGU_mgv1a002171mg [Erythranthe guttata]
Length=704

 Score =   262 bits (670),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 137/154 (89%), Gaps = 6/154 (4%)
 Frame = -1

Query  714  LASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRPR  535
            LASL+ D DQA      SGY APEVAMSGQYTIKSDVYSFGV MLELLTGRTPFDS+R R
Sbjct  555  LASLVRDPDQA------SGYSAPEVAMSGQYTIKSDVYSFGVVMLELLTGRTPFDSARQR  608

Query  534  PEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSEV  355
             EQSLVRWATPQLHDIDALSKMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMSEV
Sbjct  609  SEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEV  668

Query  354  VEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            V+ALVRLVQRANMS+RTFG +   RS SAD++EY
Sbjct  669  VQALVRLVQRANMSKRTFGNEGAARSDSADAEEY  702



>ref|XP_007217016.1| hypothetical protein PRUPE_ppa002092mg [Prunus persica]
 gb|EMJ18215.1| hypothetical protein PRUPE_ppa002092mg [Prunus persica]
Length=717

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 136/157 (87%), Gaps = 2/157 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            +GLAS IP+ DQAL  N  SGY APEVAMSGQYT+KSDVY FGV MLEL++GR PFDSS+
Sbjct  558  TGLASFIPNADQALEHNVGSGYSAPEVAMSGQYTLKSDVYGFGVVMLELISGRKPFDSSK  617

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDALSKMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  618  PRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  677

Query  360  EVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  256
            EVVEALVRLVQRANMSRRT G D     R  +A+ Q+
Sbjct  678  EVVEALVRLVQRANMSRRTVGNDQGGSQRGDNANGQD  714



>ref|XP_004303773.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Fragaria vesca 
subsp. vesca]
Length=717

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 138/157 (88%), Gaps = 2/157 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS IP+ DQAL+ N+ SGY APEVAMSGQYT+KSDVYSFGV MLEL++GR PFDSS+
Sbjct  558  SGLASSIPNADQALDHNAGSGYSAPEVAMSGQYTLKSDVYSFGVVMLELISGRKPFDSSK  617

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDALSKMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  618  SRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  677

Query  360  EVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  256
            EVV+ALVRLVQRANMSRRT G D     R  S D+Q+
Sbjct  678  EVVQALVRLVQRANMSRRTVGNDQGGSQRGDSTDAQD  714



>ref|XP_009788970.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009788971.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Nicotiana sylvestris]
Length=698

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 136/157 (87%), Gaps = 1/157 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLA LI D DQA N N+ SGYGAPE AM GQ TIKSDVYSFGV MLELLTGR PFDS R
Sbjct  542  SGLAILIDDADQARNHNTGSGYGAPEGAMYGQCTIKSDVYSFGVVMLELLTGRKPFDSER  601

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKS+SRFADVIALCVQPEPEFRPPMS
Sbjct  602  PRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSISRFADVIALCVQPEPEFRPPMS  661

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  250
            EVVEALVRLVQRANMS+RTF  D R+  G  D+Q+ +
Sbjct  662  EVVEALVRLVQRANMSKRTFSLD-RSSRGETDAQDNQ  697



>ref|XP_008465036.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X3 [Cucumis 
melo]
 ref|XP_008465037.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X3 [Cucumis 
melo]
Length=686

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLAS I + DQAL+Q + SGY APEV MSGQYT+KSDVYSFGV MLELL+GR PFDSSRP
Sbjct  529  GLASFITNLDQALDQQTGSGYSAPEVTMSGQYTLKSDVYSFGVVMLELLSGRKPFDSSRP  588

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADV+ALCVQPEPEFRPPMSE
Sbjct  589  RAEQSLVRWATPQLHDIDALTKMVDPALKGLYPVKSLSRFADVVALCVQPEPEFRPPMSE  648

Query  357  VVEALVRLVQRANMSRRTFGAD  292
            VVEALVRLVQR+NMSRRTFG+D
Sbjct  649  VVEALVRLVQRSNMSRRTFGSD  670



>ref|XP_009788969.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
Length=705

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 136/157 (87%), Gaps = 1/157 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLA LI D DQA N N+ SGYGAPE AM GQ TIKSDVYSFGV MLELLTGR PFDS R
Sbjct  549  SGLAILIDDADQARNHNTGSGYGAPEGAMYGQCTIKSDVYSFGVVMLELLTGRKPFDSER  608

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKS+SRFADVIALCVQPEPEFRPPMS
Sbjct  609  PRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSISRFADVIALCVQPEPEFRPPMS  668

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  250
            EVVEALVRLVQRANMS+RTF  D R+  G  D+Q+ +
Sbjct  669  EVVEALVRLVQRANMSKRTFSLD-RSSRGETDAQDNQ  704



>ref|XP_008465035.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X2 [Cucumis 
melo]
Length=722

 Score =   261 bits (666),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLAS I + DQAL+Q + SGY APEV MSGQYT+KSDVYSFGV MLELL+GR PFDSSRP
Sbjct  565  GLASFITNLDQALDQQTGSGYSAPEVTMSGQYTLKSDVYSFGVVMLELLSGRKPFDSSRP  624

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADV+ALCVQPEPEFRPPMSE
Sbjct  625  RAEQSLVRWATPQLHDIDALTKMVDPALKGLYPVKSLSRFADVVALCVQPEPEFRPPMSE  684

Query  357  VVEALVRLVQRANMSRRTFGAD  292
            VVEALVRLVQR+NMSRRTFG+D
Sbjct  685  VVEALVRLVQRSNMSRRTFGSD  706



>ref|XP_008465033.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Cucumis 
melo]
 ref|XP_008465034.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Cucumis 
melo]
Length=726

 Score =   261 bits (666),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLAS I + DQAL+Q + SGY APEV MSGQYT+KSDVYSFGV MLELL+GR PFDSSRP
Sbjct  569  GLASFITNLDQALDQQTGSGYSAPEVTMSGQYTLKSDVYSFGVVMLELLSGRKPFDSSRP  628

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADV+ALCVQPEPEFRPPMSE
Sbjct  629  RAEQSLVRWATPQLHDIDALTKMVDPALKGLYPVKSLSRFADVVALCVQPEPEFRPPMSE  688

Query  357  VVEALVRLVQRANMSRRTFGAD  292
            VVEALVRLVQR+NMSRRTFG+D
Sbjct  689  VVEALVRLVQRSNMSRRTFGSD  710



>ref|XP_011048642.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Populus euphratica]
Length=715

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 137/158 (87%), Gaps = 2/158 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  DQ LNQN+ SGY APEVAMSG YT+KSDVYSFG  MLELLTGR PFDSSR
Sbjct  556  SGLASCLPHADQVLNQNAGSGYVAPEVAMSGHYTLKSDVYSFGAVMLELLTGRKPFDSSR  615

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDALSKMVDP L+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  616  PRSEQSLVRWATPQLHDIDALSKMVDPELKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  675

Query  360  EVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQEY  253
            EVV+ALVRLVQRANMS+RT G +     R+ + D+Q+Y
Sbjct  676  EVVQALVRLVQRANMSKRTIGNEQGETPRAVNPDTQDY  713



>ref|XP_004144448.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cucumis 
sativus]
Length=726

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLAS I + D AL+Q + SGY APEV MSGQYT+KSDVYSFGV MLELL+GR PFDSSRP
Sbjct  569  GLASFITNLDHALDQQAGSGYSAPEVTMSGQYTLKSDVYSFGVVMLELLSGRKPFDSSRP  628

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADV+ALCVQPEPEFRPPMSE
Sbjct  629  RAEQSLVRWATPQLHDIDALTKMVDPALKGLYPVKSLSRFADVVALCVQPEPEFRPPMSE  688

Query  357  VVEALVRLVQRANMSRRTFGAD  292
            VVEALVRLVQR+NMSRRTFG+D
Sbjct  689  VVEALVRLVQRSNMSRRTFGSD  710



>ref|XP_004165988.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cucumis 
sativus]
Length=726

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLAS I + D AL+Q + SGY APEV MSGQYT+KSDVYSFGV MLELL+GR PFDSSRP
Sbjct  569  GLASFITNLDHALDQQAGSGYSAPEVTMSGQYTLKSDVYSFGVVMLELLSGRKPFDSSRP  628

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADV+ALCVQPEPEFRPPMSE
Sbjct  629  RAEQSLVRWATPQLHDIDALTKMVDPALKGLYPVKSLSRFADVVALCVQPEPEFRPPMSE  688

Query  357  VVEALVRLVQRANMSRRTFGAD  292
            VVEALVRLVQR+NMSRRTFG+D
Sbjct  689  VVEALVRLVQRSNMSRRTFGSD  710



>ref|NP_001241934.1| protein STRUBBELIG-RECEPTOR FAMILY 6-like [Glycine max]
 gb|ACM89564.1| leucine-rich repeat transmembrane protein kinase [Glycine max]
Length=603

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 135/156 (87%), Gaps = 1/156 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS IP+ +Q LN N+ SGY APEV +SG YT+KSDVYSFGV MLELL+GR PFDSSR
Sbjct  444  SGLASYIPNANQVLNNNAGSGYEAPEVGLSGHYTLKSDVYSFGVVMLELLSGRKPFDSSR  503

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQ+LVRWATPQLHDIDAL+KMVDPAL GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  504  PRSEQALVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMS  563

Query  360  EVVEALVRLVQRANMSRRTFGAD-SRTRSGSADSQE  256
            EVV+ALVRLVQR NMS+RTFG D   +  G  D+Q+
Sbjct  564  EVVQALVRLVQRTNMSKRTFGTDQGGSNRGGDDNQD  599



>ref|XP_010033635.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Eucalyptus 
grandis]
 gb|KCW53334.1| hypothetical protein EUGRSUZ_J02582 [Eucalyptus grandis]
Length=728

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLAS +P+ +Q LNQN  SGY APEVAMSGQYT+KSDVY FGV MLELLTGR PFDSS+ 
Sbjct  570  GLASYLPNAEQILNQNMGSGYSAPEVAMSGQYTLKSDVYGFGVVMLELLTGRQPFDSSKG  629

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQ EPEFRPPMSE
Sbjct  630  RSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQAEPEFRPPMSE  689

Query  357  VVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  250
            VV+ALVRLVQRANMS+RTFG + R      D+  YE
Sbjct  690  VVQALVRLVQRANMSKRTFGNEHRASQKFDDADAYE  725



>ref|XP_006604929.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Glycine max]
Length=708

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS IP+ DQ LN N  SGY APEVA+SGQYT+KSDVYSFGV MLELL+GR PFDSSR
Sbjct  549  SGLASYIPNADQILNHNVGSGYDAPEVALSGQYTLKSDVYSFGVVMLELLSGRNPFDSSR  608

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDAL+KMVDPA++GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  609  PRSEQSLVRWATPQLHDIDALAKMVDPAMKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  668

Query  360  EVVEALVRLVQRANMSRRTFGA  295
            EVV+ALVRLVQRANMS+RTF +
Sbjct  669  EVVQALVRLVQRANMSKRTFSS  690



>ref|XP_006604928.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Glycine max]
 gb|KHN11358.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=721

 Score =   258 bits (659),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS IP+ DQ LN N  SGY APEVA+SGQYT+KSDVYSFGV MLELL+GR PFDSSR
Sbjct  562  SGLASYIPNADQILNHNVGSGYDAPEVALSGQYTLKSDVYSFGVVMLELLSGRNPFDSSR  621

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDAL+KMVDPA++GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  622  PRSEQSLVRWATPQLHDIDALAKMVDPAMKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  681

Query  360  EVVEALVRLVQRANMSRRTFGA  295
            EVV+ALVRLVQRANMS+RTF +
Sbjct  682  EVVQALVRLVQRANMSKRTFSS  703



>ref|XP_008462233.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X3 [Cucumis melo]
Length=655

 Score =   256 bits (654),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGL S IP+ DQAL+ + +SGY APEV MSGQYT+KSDVYSFGV MLELLTGR PFDSSR
Sbjct  498  SGLESFIPNTDQALDGSGSSGYTAPEVTMSGQYTLKSDVYSFGVVMLELLTGRKPFDSSR  557

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDAL+KMVDP L+GLYPVKSLSRFADVIALCVQ EPEFRPPMS
Sbjct  558  PRSEQSLVRWATPQLHDIDALTKMVDPELKGLYPVKSLSRFADVIALCVQTEPEFRPPMS  617

Query  360  EVVEALVRLVQRANMSRRTFGADSRT  283
            EVVEALVRLVQRANMS+RT+G+D+ T
Sbjct  618  EVVEALVRLVQRANMSKRTYGSDNAT  643



>ref|XP_006598761.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Glycine max]
 gb|KHN15854.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=715

 Score =   257 bits (657),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 136/158 (86%), Gaps = 1/158 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS IP+ +Q LN N+ SGY APEV +SG YT+KSDVYSFGV MLELL+GR PFDSSR
Sbjct  556  SGLASYIPNANQVLNNNAGSGYEAPEVGLSGHYTLKSDVYSFGVVMLELLSGRKPFDSSR  615

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQ+LVRWATPQLHDIDAL+KMVDPAL GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  616  PRSEQALVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMS  675

Query  360  EVVEALVRLVQRANMSRRTFGAD-SRTRSGSADSQEYE  250
            EVV+ALVRLVQR NMS+RTFG D   +  G  D+Q+ +
Sbjct  676  EVVQALVRLVQRTNMSKRTFGTDQGGSNRGGDDNQDTQ  713



>gb|KHN01483.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=675

 Score =   256 bits (655),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS IP+ +Q LN N+ SGY APEV +SG YT+KSDVYSFGV MLELL+GR PFDSSR
Sbjct  517  SGLASYIPNANQVLNNNAGSGYEAPEVGLSGHYTLKSDVYSFGVVMLELLSGRKPFDSSR  576

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQ+LVRWATPQLHDIDAL+KMVDP L GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  577  PRSEQALVRWATPQLHDIDALAKMVDPTLEGLYPVKSLSRFADVIALCVQPEPEFRPPMS  636

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  250
            EVV+ALVRLVQR NMS+RTFG D    +   D Q+ +
Sbjct  637  EVVQALVRLVQRTNMSKRTFGTDQGGSNRGGDDQDTQ  673



>gb|KHN16389.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=722

 Score =   258 bits (658),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS IP+ DQ LN N  SGY APEVA+SGQYT+KSDVYSFGV MLELL+GR PFDSSR
Sbjct  563  SGLASYIPNADQILNHNVGSGYDAPEVALSGQYTLKSDVYSFGVVMLELLSGRKPFDSSR  622

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDAL+KMVDPA++GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  623  PRSEQSLVRWATPQLHDIDALAKMVDPAMKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  682

Query  360  EVVEALVRLVQRANMSRRTFGA  295
            EVV+ALVRLVQRANMS+RTF +
Sbjct  683  EVVQALVRLVQRANMSKRTFSS  704



>ref|XP_007135353.1| hypothetical protein PHAVU_010G122100g [Phaseolus vulgaris]
 gb|ESW07347.1| hypothetical protein PHAVU_010G122100g [Phaseolus vulgaris]
Length=718

 Score =   257 bits (657),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 134/156 (86%), Gaps = 1/156 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS IP+ +Q LN NS SGY APEV MSGQYT+KSDV+SFGV MLELL+GR PFDSSR
Sbjct  559  SGLASYIPNANQVLNNNSGSGYEAPEVGMSGQYTLKSDVFSFGVIMLELLSGRKPFDSSR  618

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQ LVRWATPQLHDIDAL+KMVDPAL GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  619  PRSEQGLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMS  678

Query  360  EVVEALVRLVQRANMSRR-TFGADSRTRSGSADSQE  256
            EVV+ALVRLVQR NMS+R TFG D    +   D+QE
Sbjct  679  EVVQALVRLVQRTNMSKRTTFGTDQGGSNRGGDNQE  714



>ref|XP_004510591.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cicer arietinum]
Length=711

 Score =   257 bits (656),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS IP+ +Q LN N+ SGY APEV +SGQYT KSDVYSFGV MLELL+GR PFDSSR
Sbjct  554  SGLASYIPNANQVLNNNAGSGYDAPEVGLSGQYTFKSDVYSFGVVMLELLSGRKPFDSSR  613

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL+KMVDPAL GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  614  SRFEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMS  673

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  250
            EVV+ALVRLVQR NMS+RTFG D +  S   D QE +
Sbjct  674  EVVQALVRLVQRTNMSKRTFGTD-QGGSNRGDDQETQ  709



>ref|XP_008462232.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X2 [Cucumis melo]
Length=692

 Score =   256 bits (655),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGL S IP+ DQAL+ + +SGY APEV MSGQYT+KSDVYSFGV MLELLTGR PFDSSR
Sbjct  535  SGLESFIPNTDQALDGSGSSGYTAPEVTMSGQYTLKSDVYSFGVVMLELLTGRKPFDSSR  594

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDAL+KMVDP L+GLYPVKSLSRFADVIALCVQ EPEFRPPMS
Sbjct  595  PRSEQSLVRWATPQLHDIDALTKMVDPELKGLYPVKSLSRFADVIALCVQTEPEFRPPMS  654

Query  360  EVVEALVRLVQRANMSRRTFGADSRT  283
            EVVEALVRLVQRANMS+RT+G+D+ T
Sbjct  655  EVVEALVRLVQRANMSKRTYGSDNAT  680



>gb|KHG25534.1| protein strubbelig-receptor family 6 [Gossypium arboreum]
Length=724

 Score =   257 bits (657),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 135/158 (85%), Gaps = 6/158 (4%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDS  547
            SGLA+  P+ DQ LN +  + SGYGAPEV MSGQY++KSDVYSFGV MLELLTGR PFDS
Sbjct  560  SGLATFFPNADQVLNHDDVTMSGYGAPEVTMSGQYSLKSDVYSFGVVMLELLTGRKPFDS  619

Query  546  SRPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPP  367
            +RPR EQSLVRWATPQLHDIDALSKMVDPAL GLYPVKSLSRFADVIALCVQPEPEFRPP
Sbjct  620  TRPRLEQSLVRWATPQLHDIDALSKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPP  679

Query  366  MSEVVEALVRLVQRANMSRRTFGAD----SRTRSGSAD  265
            MSEVVEALVRLVQRANMS+RT G D     RT +  AD
Sbjct  680  MSEVVEALVRLVQRANMSKRTIGTDQGASQRTDNAVAD  717



>emb|CBI35784.3| unnamed protein product [Vitis vinifera]
Length=708

 Score =   257 bits (656),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 137/157 (87%), Gaps = 2/157 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLAS IP+ DQ LN N+ SGY APEVAMSGQYT+KSDVYSFGV MLELL+GR PFDSSR 
Sbjct  550  GLASFIPNADQVLNHNAGSGYSAPEVAMSGQYTLKSDVYSFGVVMLELLSGRKPFDSSRS  609

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMSE
Sbjct  610  RSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  669

Query  357  VVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQEY  253
            VV+ALVRLVQRANMS+RT   +  +  R  + D+Q++
Sbjct  670  VVQALVRLVQRANMSKRTISNEQGASPRGDNPDTQDH  706



>ref|XP_004141737.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Cucumis 
sativus]
Length=621

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGL S IP+ DQA++ + +SGY APEV MSGQYT+KSDVYSFGV MLELLTGR PFDSSR
Sbjct  464  SGLESFIPNADQAMDGSGSSGYTAPEVTMSGQYTLKSDVYSFGVVMLELLTGRKPFDSSR  523

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDAL+KMVDP L+GLYPVKS+SRFADVIALCVQ EPEFRPPMS
Sbjct  524  PRSEQSLVRWATPQLHDIDALTKMVDPELKGLYPVKSISRFADVIALCVQTEPEFRPPMS  583

Query  360  EVVEALVRLVQRANMSRRTFGADSRT  283
            EVVEALVRLVQRANMS+RT+G D+ T
Sbjct  584  EVVEALVRLVQRANMSKRTYGNDNAT  609



>ref|XP_010654359.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Vitis vinifera]
Length=714

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 137/157 (87%), Gaps = 2/157 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLAS IP+ DQ LN N+ SGY APEVAMSGQYT+KSDVYSFGV MLELL+GR PFDSSR 
Sbjct  556  GLASFIPNADQVLNHNAGSGYSAPEVAMSGQYTLKSDVYSFGVVMLELLSGRKPFDSSRS  615

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMSE
Sbjct  616  RSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  675

Query  357  VVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQEY  253
            VV+ALVRLVQRANMS+RT   +  +  R  + D+Q++
Sbjct  676  VVQALVRLVQRANMSKRTISNEQGASPRGDNPDTQDH  712



>ref|XP_008462231.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X1 [Cucumis melo]
Length=716

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGL S IP+ DQAL+ + +SGY APEV MSGQYT+KSDVYSFGV MLELLTGR PFDSSR
Sbjct  559  SGLESFIPNTDQALDGSGSSGYTAPEVTMSGQYTLKSDVYSFGVVMLELLTGRKPFDSSR  618

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDAL+KMVDP L+GLYPVKSLSRFADVIALCVQ EPEFRPPMS
Sbjct  619  PRSEQSLVRWATPQLHDIDALTKMVDPELKGLYPVKSLSRFADVIALCVQTEPEFRPPMS  678

Query  360  EVVEALVRLVQRANMSRRTFGADSRT  283
            EVVEALVRLVQRANMS+RT+G+D+ T
Sbjct  679  EVVEALVRLVQRANMSKRTYGSDNAT  704



>ref|XP_006583189.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Glycine 
max]
Length=713

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS IP+ +Q LN N+ SGY APEV +SG YT+KSDVYSFGV MLELL+GR PFDSSR
Sbjct  555  SGLASYIPNANQVLNNNAGSGYEAPEVGLSGHYTLKSDVYSFGVVMLELLSGRKPFDSSR  614

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQ+LVRWATPQLHDIDAL+KMVDP L GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  615  PRSEQALVRWATPQLHDIDALAKMVDPTLEGLYPVKSLSRFADVIALCVQPEPEFRPPMS  674

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  250
            EVV+ALVRLVQR NMS+RTFG D    +   D Q+ +
Sbjct  675  EVVQALVRLVQRTNMSKRTFGTDQGGSNRGGDDQDTQ  711



>gb|KEH18524.1| strubbelig-receptor family 6 protein [Medicago truncatula]
Length=685

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS IP+ +Q LN NS SGY APEV ++GQYT+KSDVYSFGV MLELL+GR PFDSSR
Sbjct  527  SGLASYIPNTNQVLNNNSGSGYDAPEVGLTGQYTLKSDVYSFGVVMLELLSGRKPFDSSR  586

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL+KMVDPAL G+YPVKSLSRFADVIALCVQ EPEFRPPMS
Sbjct  587  SRFEQSLVRWATPQLHDIDALAKMVDPALEGMYPVKSLSRFADVIALCVQSEPEFRPPMS  646

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQE  256
            EVV+ALVRLVQR NMS+RTFGAD    +   D Q+
Sbjct  647  EVVQALVRLVQRTNMSKRTFGADQGGSNRGGDDQD  681



>ref|XP_011072711.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Sesamum indicum]
Length=712

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 139/155 (90%), Gaps = 7/155 (5%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLA+L+ + DQA      SGY APEVAMSGQYTIKSD+YSFGV MLELLTGR PFDSSRP
Sbjct  563  GLANLVREPDQA------SGYSAPEVAMSGQYTIKSDLYSFGVVMLELLTGRKPFDSSRP  616

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDALSKMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMSE
Sbjct  617  RSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  676

Query  357  VVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            VV+ALVRLVQRANMS+RTFG ++ +R+ SAD ++Y
Sbjct  677  VVQALVRLVQRANMSKRTFGNEA-SRAESADGEDY  710



>ref|XP_007139053.1| hypothetical protein PHAVU_009G260900g [Phaseolus vulgaris]
 gb|ESW11047.1| hypothetical protein PHAVU_009G260900g [Phaseolus vulgaris]
Length=720

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS IP+ DQ L+ N  SGY APEVA+SGQYT++SDVYSFGV MLELL+GR PFDSSR
Sbjct  561  SGLASYIPNADQILSHNVGSGYDAPEVALSGQYTLQSDVYSFGVVMLELLSGRKPFDSSR  620

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDALSKMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  621  PRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  680

Query  360  EVVEALVRLVQRANMSRRTFGA  295
            EVV+ALVRLVQRANMS+RTF +
Sbjct  681  EVVQALVRLVQRANMSKRTFSS  702



>ref|XP_008783422.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Phoenix 
dactylifera]
Length=724

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 138/159 (87%), Gaps = 4/159 (3%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            GLA+LIPD E QA +QN +SGYGAPEVAMSGQYT+KSDVYSFGV MLELLTGR PFDSSR
Sbjct  565  GLANLIPDAEFQASDQNMSSGYGAPEVAMSGQYTLKSDVYSFGVVMLELLTGRMPFDSSR  624

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFADVIALCVQPEPEFRPPMS
Sbjct  625  SRTEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEPEFRPPMS  684

Query  360  EVVEALVRLVQRANMSRRTFGADSRT---RSGSADSQEY  253
            EVV+ALVRLVQRANMS+R  G D +    RS   D+Q+Y
Sbjct  685  EVVQALVRLVQRANMSKRMLGGDMQETARRSDDPDTQDY  723



>ref|XP_008380807.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Malus domestica]
Length=740

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 137/157 (87%), Gaps = 2/157 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            +GLAS IP+ DQAL+ N+ SGY APEVAMSGQYT+KSDVY FGV MLELL+GR  FD+ +
Sbjct  581  AGLASSIPNADQALDHNAGSGYSAPEVAMSGQYTLKSDVYGFGVVMLELLSGRKAFDNLK  640

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDALSKMVDP L+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  641  PRSEQSLVRWATPQLHDIDALSKMVDPELKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  700

Query  360  EVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  256
            EVV+ALVRLVQRANMSRRT G D  S    G+AD+Q+
Sbjct  701  EVVQALVRLVQRANMSRRTVGNDQGSSHGGGNADAQD  737



>ref|XP_008783430.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X2 [Phoenix 
dactylifera]
Length=700

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 138/159 (87%), Gaps = 4/159 (3%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            GLA+LIPD E QA +QN +SGYGAPEVAMSGQYT+KSDVYSFGV MLELLTGR PFDSSR
Sbjct  541  GLANLIPDAEFQASDQNMSSGYGAPEVAMSGQYTLKSDVYSFGVVMLELLTGRMPFDSSR  600

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFADVIALCVQPEPEFRPPMS
Sbjct  601  SRTEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEPEFRPPMS  660

Query  360  EVVEALVRLVQRANMSRRTFGADSRT---RSGSADSQEY  253
            EVV+ALVRLVQRANMS+R  G D +    RS   D+Q+Y
Sbjct  661  EVVQALVRLVQRANMSKRMLGGDMQETARRSDDPDTQDY  699



>ref|XP_003627481.1| Protein STRUBBELIG-RECEPTOR FAMILY [Medicago truncatula]
 gb|AET01957.1| strubbelig-receptor family 6 protein [Medicago truncatula]
Length=716

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS IP+ +Q LN NS SGY APEV ++GQYT+KSDVYSFGV MLELL+GR PFDSSR
Sbjct  558  SGLASYIPNTNQVLNNNSGSGYDAPEVGLTGQYTLKSDVYSFGVVMLELLSGRKPFDSSR  617

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL+KMVDPAL G+YPVKSLSRFADVIALCVQ EPEFRPPMS
Sbjct  618  SRFEQSLVRWATPQLHDIDALAKMVDPALEGMYPVKSLSRFADVIALCVQSEPEFRPPMS  677

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQE  256
            EVV+ALVRLVQR NMS+RTFGAD    +   D Q+
Sbjct  678  EVVQALVRLVQRTNMSKRTFGADQGGSNRGGDDQD  712



>gb|ADM07445.1| leucine-rich repeat receptor-like protein kinase [Glycine soja]
Length=714

 Score =   255 bits (652),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 135/158 (85%), Gaps = 1/158 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS IP+ +Q LN N+ SGY APEV +SG YT+KSDVYSFGV MLELL+GR PFDSSR
Sbjct  555  SGLASYIPNANQVLNNNAGSGYEAPEVGLSGHYTLKSDVYSFGVVMLELLSGRKPFDSSR  614

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQ+LVRWA PQLHDIDAL+KMVDPAL GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  615  PRSEQALVRWAAPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMS  674

Query  360  EVVEALVRLVQRANMSRRTFGAD-SRTRSGSADSQEYE  250
            EVV+ALVRLVQR NMS+RTFG D   +  G  D+Q+ +
Sbjct  675  EVVQALVRLVQRTNMSKRTFGTDQGGSNRGGDDNQDTQ  712



>gb|AFW90526.1| strubbelig-receptor family 6-like protein [Phaseolus vulgaris]
Length=662

 Score =   254 bits (648),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS IP+ DQ L+ N  SGY APEVA+SGQYT++SDVYSFGV MLELL+GR PFDSSR
Sbjct  503  SGLASYIPNADQILSHNVGSGYDAPEVALSGQYTLQSDVYSFGVVMLELLSGRKPFDSSR  562

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDALSKMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  563  PRFEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  622

Query  360  EVVEALVRLVQRANMSRRTFGA  295
            EVV+ALVRLVQRANMS+RTF +
Sbjct  623  EVVQALVRLVQRANMSKRTFSS  644



>gb|KGN45433.1| hypothetical protein Csa_7G447950 [Cucumis sativus]
Length=715

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGL S IP+ DQA++ + +SGY APEV MSGQYT+KSDVYSFGV MLELLTGR PFDSSR
Sbjct  558  SGLESFIPNADQAMDGSGSSGYTAPEVTMSGQYTLKSDVYSFGVVMLELLTGRKPFDSSR  617

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDAL+KMVDP L+GLYPVKS+SRFADVIALCVQ EPEFRPPMS
Sbjct  618  PRSEQSLVRWATPQLHDIDALTKMVDPELKGLYPVKSISRFADVIALCVQTEPEFRPPMS  677

Query  360  EVVEALVRLVQRANMSRRTFGADSRT  283
            EVVEALVRLVQRANMS+RT+G D+ T
Sbjct  678  EVVEALVRLVQRANMSKRTYGNDNAT  703



>ref|XP_004159012.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Cucumis 
sativus]
Length=715

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGL S IP+ DQA++ + +SGY APEV MSGQYT+KSDVYSFGV MLELLTGR PFDSSR
Sbjct  558  SGLESFIPNADQAMDGSGSSGYTAPEVTMSGQYTLKSDVYSFGVVMLELLTGRKPFDSSR  617

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDAL+KMVDP L+GLYPVKS+SRFADVIALCVQ EPEFRPPMS
Sbjct  618  PRSEQSLVRWATPQLHDIDALTKMVDPELKGLYPVKSISRFADVIALCVQTEPEFRPPMS  677

Query  360  EVVEALVRLVQRANMSRRTFGADSRT  283
            EVVEALVRLVQRANMS+RT+G D+ T
Sbjct  678  EVVEALVRLVQRANMSKRTYGNDNAT  703



>ref|XP_004494892.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cicer arietinum]
Length=722

 Score =   254 bits (648),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLAS +P+ +Q LN N  SGY APEVA+SGQYT KSDVYSFGV MLELL+GR PFDSSR 
Sbjct  565  GLASYVPNAEQILNHNVGSGYDAPEVALSGQYTFKSDVYSFGVVMLELLSGRKPFDSSRL  624

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQ EPEFRPPMSE
Sbjct  625  RAEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQSEPEFRPPMSE  684

Query  357  VVEALVRLVQRANMSRRTFGAD  292
            VV+A+VRLVQRANMSRRTFG+D
Sbjct  685  VVQAMVRLVQRANMSRRTFGSD  706



>ref|XP_007024796.1| Strubbelig-receptor family 6 [Theobroma cacao]
 gb|EOY27418.1| Strubbelig-receptor family 6 [Theobroma cacao]
Length=721

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 131/144 (91%), Gaps = 1/144 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNS-ASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            SGLA+ IPD DQ LN++   SGY APEVAMSG Y++KSDVYSFGV MLELLTGR PFDS+
Sbjct  560  SGLATFIPDADQVLNRDDVGSGYSAPEVAMSGLYSLKSDVYSFGVVMLELLTGRKPFDST  619

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDALSKMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPM
Sbjct  620  RPRLEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPM  679

Query  363  SEVVEALVRLVQRANMSRRTFGAD  292
            SEVV+ALVRLVQRANMS+RT G D
Sbjct  680  SEVVQALVRLVQRANMSKRTIGTD  703



>ref|XP_002304260.2| hypothetical protein POPTR_0003s07130g [Populus trichocarpa]
 gb|EEE79239.2| hypothetical protein POPTR_0003s07130g [Populus trichocarpa]
Length=716

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 136/158 (86%), Gaps = 2/158 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            +GLAS + + DQ LN N+ SGY APEVAMSG YT+KSDVYSFG  MLELLTGR PFDSSR
Sbjct  557  AGLASSLHNADQVLNYNAGSGYSAPEVAMSGHYTLKSDVYSFGAVMLELLTGRKPFDSSR  616

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDID+LSKMVDP L+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  617  PRSEQSLVRWATPQLHDIDSLSKMVDPELKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  676

Query  360  EVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQEY  253
            EVV+ALVRLVQRANMS+RT G +     R+ + D+Q+Y
Sbjct  677  EVVQALVRLVQRANMSKRTIGNEQGETPRADNPDTQDY  714



>ref|XP_011031832.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Populus 
euphratica]
Length=716

 Score =   252 bits (644),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 136/158 (86%), Gaps = 2/158 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            +GLAS + + DQ LN N+ SGY APEVAMSG YT+KSDVYSFGV MLELLTGR PFDSSR
Sbjct  557  AGLASSLHNADQVLNYNAGSGYSAPEVAMSGHYTLKSDVYSFGVVMLELLTGRKPFDSSR  616

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDID+LSKMVDP L+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  617  PRSEQSLVRWATPQLHDIDSLSKMVDPELKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  676

Query  360  EVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQEY  253
            EVV+AL RLVQRANMS+RT G +     ++ + D+Q+Y
Sbjct  677  EVVQALFRLVQRANMSKRTIGNEQGETPKADNPDTQDY  714



>gb|KHG18134.1| protein strubbelig-receptor family 6 [Gossypium arboreum]
Length=721

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 130/144 (90%), Gaps = 1/144 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNS-ASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            SGLA+ IP+ D+ LN++   SGY APEV MSGQY++KSDVY FGV MLELLTGR PFDS+
Sbjct  560  SGLATFIPNADEVLNRDDVGSGYSAPEVTMSGQYSLKSDVYGFGVVMLELLTGRKPFDST  619

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDALSKMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPM
Sbjct  620  RPRLEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPM  679

Query  363  SEVVEALVRLVQRANMSRRTFGAD  292
            SEVVEALVRLVQRANMS+RT G D
Sbjct  680  SEVVEALVRLVQRANMSKRTTGTD  703



>ref|XP_010273793.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Nelumbo nucifera]
Length=725

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 134/159 (84%), Gaps = 3/159 (2%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLAS I + DQALN N+ SGY APEVAMSGQYT+KSDVYSFGV MLELLTGR PFDSSR 
Sbjct  568  GLASFI-NADQALNHNAGSGYDAPEVAMSGQYTLKSDVYSFGVVMLELLTGRKPFDSSRQ  626

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDAL KMVDPAL+GLYP KSLSRFAD+IALCVQPEPEFRPPMSE
Sbjct  627  RSEQSLVRWATPQLHDIDALDKMVDPALKGLYPAKSLSRFADIIALCVQPEPEFRPPMSE  686

Query  357  VVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQEYEL  247
            VV+ALVRLVQRANMS+RT G +     R+   D Q+Y  
Sbjct  687  VVQALVRLVQRANMSKRTTGDEQGGSRRADEPDVQDYTF  725



>gb|ADB93024.1| leucine-rich repeat receptor-like protein kinase [Dendrobium 
nobile]
Length=255

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 131/160 (82%), Gaps = 4/160 (3%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
             GLA LIP+ E Q  + N +SGY APEV+MSGQYT+KSDVYSFGV MLELLTGR PFDS+
Sbjct  91   CGLACLIPNAEYQGAHHNLSSGYSAPEVSMSGQYTLKSDVYSFGVVMLELLTGRKPFDSA  150

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQ LVRWATPQLHDIDAL KMVDP L+GLYP KSLSRFADVIALCVQPEPEFRPPM
Sbjct  151  RPRSEQYLVRWATPQLHDIDALDKMVDPQLQGLYPAKSLSRFADVIALCVQPEPEFRPPM  210

Query  363  SEVVEALVRLVQRANMSRRTFGA---DSRTRSGSADSQEY  253
            SEVV+ALVRLVQRA M+++       D+  R+   D+Q+Y
Sbjct  211  SEVVQALVRLVQRAKMNKKVLAGDVQDANRRADDRDAQDY  250



>gb|KHG12210.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Gossypium arboreum]
Length=689

 Score =   249 bits (637),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 135/158 (85%), Gaps = 3/158 (2%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNS-ASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            SGLA+ IP+ DQ LN++   SGY APEV MS QY++KSDVYSFGV MLELLTGR PFDS+
Sbjct  528  SGLATFIPNADQLLNRDDVGSGYCAPEVTMSSQYSLKSDVYSFGVVMLELLTGRKPFDST  587

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDALSKMVDPAL+GLYP+KSLSRFADVIALCVQ EPEFRPPM
Sbjct  588  RPRLEQSLVRWATPQLHDIDALSKMVDPALKGLYPIKSLSRFADVIALCVQSEPEFRPPM  647

Query  363  SEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  256
            SEVV+ALVRLVQRANMS+RT G D  +  R+ + D Q 
Sbjct  648  SEVVQALVRLVQRANMSKRTIGTDQGASPRTNNTDEQH  685



>gb|KJB70030.1| hypothetical protein B456_011G054100 [Gossypium raimondii]
Length=709

 Score =   250 bits (638),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 135/155 (87%), Gaps = 3/155 (2%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNS-ASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            SGLA+ IP+ D+ LN++   SGY APEV MSGQY++KSDVY FGV MLELLTGR PFDS+
Sbjct  548  SGLATFIPNADEVLNRDDVGSGYSAPEVTMSGQYSLKSDVYGFGVVMLELLTGRKPFDST  607

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDALSKMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPM
Sbjct  608  RHRLEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPM  667

Query  363  SEVVEALVRLVQRANMSRRTFGAD--SRTRSGSAD  265
            SEVVEALVRLVQRANMS+RT G D  +  R+G+ D
Sbjct  668  SEVVEALVRLVQRANMSKRTTGTDQGASPRTGNPD  702



>gb|KJB57112.1| hypothetical protein B456_009G148500 [Gossypium raimondii]
 gb|KJB57113.1| hypothetical protein B456_009G148500 [Gossypium raimondii]
Length=728

 Score =   249 bits (637),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 135/158 (85%), Gaps = 3/158 (2%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNS-ASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            SGLA+ IP+ DQ LN++   SGY APEV MS QY++KSDVYSFGV MLELLTGR PFDS+
Sbjct  567  SGLATFIPNADQLLNRDDMGSGYCAPEVTMSSQYSLKSDVYSFGVVMLELLTGRKPFDST  626

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDALSKMVDPAL+GLYP+KSLSRFADVIALCVQ EPEFRPPM
Sbjct  627  RPRLEQSLVRWATPQLHDIDALSKMVDPALKGLYPIKSLSRFADVIALCVQSEPEFRPPM  686

Query  363  SEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  256
            SEVV+ALVRLVQRANMS+RT G D  +  R+ + D Q 
Sbjct  687  SEVVQALVRLVQRANMSKRTIGTDQGASPRTNNTDEQH  724



>gb|KHG12209.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Gossypium arboreum]
Length=728

 Score =   249 bits (636),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 135/158 (85%), Gaps = 3/158 (2%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNS-ASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            SGLA+ IP+ DQ LN++   SGY APEV MS QY++KSDVYSFGV MLELLTGR PFDS+
Sbjct  567  SGLATFIPNADQLLNRDDVGSGYCAPEVTMSSQYSLKSDVYSFGVVMLELLTGRKPFDST  626

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDALSKMVDPAL+GLYP+KSLSRFADVIALCVQ EPEFRPPM
Sbjct  627  RPRLEQSLVRWATPQLHDIDALSKMVDPALKGLYPIKSLSRFADVIALCVQSEPEFRPPM  686

Query  363  SEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  256
            SEVV+ALVRLVQRANMS+RT G D  +  R+ + D Q 
Sbjct  687  SEVVQALVRLVQRANMSKRTIGTDQGASPRTNNTDEQH  724



>ref|XP_010939842.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Elaeis guineensis]
Length=664

 Score =   246 bits (629),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 129/145 (89%), Gaps = 1/145 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            GLA+LIPD E QAL+QN  SGY +PEV MSGQYT+KSDVYSFGV MLELLTGR PFD SR
Sbjct  518  GLANLIPDAEFQALDQNMGSGYTSPEVTMSGQYTLKSDVYSFGVVMLELLTGRKPFDDSR  577

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLV+WATPQLHDIDAL +MVDPAL+GLYP KSLSRFADVIALCVQPEPEFRPPMS
Sbjct  578  LRAEQSLVQWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEPEFRPPMS  637

Query  360  EVVEALVRLVQRANMSRRTFGADSR  286
            EVV+ALVRLVQRANMS+R  G D++
Sbjct  638  EVVQALVRLVQRANMSKRMLGGDTQ  662



>ref|XP_008800485.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Phoenix 
dactylifera]
Length=725

 Score =   247 bits (631),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 132/152 (87%), Gaps = 1/152 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            GLA+LIPD E QAL+ N  SGY APEVAMSGQYT+KSDVYSFGV MLELLTG  PFDSSR
Sbjct  565  GLANLIPDAEFQALDLNMGSGYSAPEVAMSGQYTLKSDVYSFGVVMLELLTGWKPFDSSR  624

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFADVIALCVQPEPEFRPPMS
Sbjct  625  LRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEPEFRPPMS  684

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSAD  265
            EVV+ALVRLVQRANMS+R  G D++  +  AD
Sbjct  685  EVVQALVRLVQRANMSKRMLGRDTQETARRAD  716



>ref|XP_010939841.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Elaeis guineensis]
Length=699

 Score =   246 bits (628),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 129/145 (89%), Gaps = 1/145 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            GLA+LIPD E QAL+QN  SGY +PEV MSGQYT+KSDVYSFGV MLELLTGR PFD SR
Sbjct  553  GLANLIPDAEFQALDQNMGSGYTSPEVTMSGQYTLKSDVYSFGVVMLELLTGRKPFDDSR  612

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLV+WATPQLHDIDAL +MVDPAL+GLYP KSLSRFADVIALCVQPEPEFRPPMS
Sbjct  613  LRAEQSLVQWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEPEFRPPMS  672

Query  360  EVVEALVRLVQRANMSRRTFGADSR  286
            EVV+ALVRLVQRANMS+R  G D++
Sbjct  673  EVVQALVRLVQRANMSKRMLGGDTQ  697



>emb|CAN80221.1| hypothetical protein VITISV_027894 [Vitis vinifera]
Length=672

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 137/178 (77%), Gaps = 23/178 (13%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLAS IP+ DQ LN N+ SGY APEVAMSGQYT+KSDVYSFGV MLELL+GR PFDSSR 
Sbjct  493  GLASFIPNADQVLNHNAGSGYSAPEVAMSGQYTLKSDVYSFGVVMLELLSGRKPFDSSRS  552

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQ-----------  391
            R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQ           
Sbjct  553  RSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQVRCLVKVKSAD  612

Query  390  ----------PEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQEY  253
                      PEPEFRPPMSEVV+ALVRLVQRANMS+RT   +  +  R  + D+Q++
Sbjct  613  GFIILFQLLMPEPEFRPPMSEVVQALVRLVQRANMSKRTISNEQGASPRGDNPDTQDH  670



>ref|XP_010542346.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Tarenaya hassleriana]
Length=716

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 138/157 (88%), Gaps = 1/157 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQN-SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            SGLAS +P  D+ LNQN   SGY APEV+MSGQY+++SDVYSFGV MLELLTGR PFDS+
Sbjct  559  SGLASFLPTADEVLNQNDEGSGYSAPEVSMSGQYSMQSDVYSFGVVMLELLTGRKPFDSA  618

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDALSKMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPM
Sbjct  619  RPRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPM  678

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            SEVV+ALV LVQRANMS+RT G D   RSGS ++ +Y
Sbjct  679  SEVVQALVVLVQRANMSKRTIGVDQSQRSGSNEANDY  715



>ref|XP_009777356.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X3 [Nicotiana sylvestris]
Length=611

 Score =   243 bits (619),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLA+L+ D DQ LN N+ SGYGAPE A+SG+ T KSDVYSFGV MLEL +GR PFDSSR
Sbjct  467  SGLANLVADVDQGLNHNTESGYGAPEAAISGKCTAKSDVYSFGVVMLELFSGRKPFDSSR  526

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDAL ++VDPAL GLY VKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  527  PRSEQSLVRWATPQLHDIDALEQIVDPALDGLYSVKSLSRFADVIALCVQPEPEFRPPMS  586

Query  360  EVVEALVRLVQRANMSRRTFGAD  292
            EVV+ALVRLVQRAN+S+R  G D
Sbjct  587  EVVQALVRLVQRANLSKRLHGID  609



>ref|XP_009386772.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Musa acuminata 
subsp. malaccensis]
Length=731

 Score =   244 bits (623),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 130/148 (88%), Gaps = 1/148 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            GL SL+PD E QA +QN ASGY  PEV+MSGQYT+KSDVY+FG+ MLELLTGR PFDSSR
Sbjct  563  GLESLVPDAEFQASDQNMASGYDPPEVSMSGQYTLKSDVYNFGIVMLELLTGRKPFDSSR  622

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PRPEQSLV+WATPQLHDIDAL +MVDP L+GLYP KSLSRFADVIALCVQPEPEFRPPMS
Sbjct  623  PRPEQSLVQWATPQLHDIDALDRMVDPVLKGLYPAKSLSRFADVIALCVQPEPEFRPPMS  682

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRS  277
            EVV+ALVRLVQRANMS+R  G + +  S
Sbjct  683  EVVQALVRLVQRANMSKRMVGGEMQETS  710



>gb|KEH24658.1| strubbelig-receptor family protein [Medicago truncatula]
Length=723

 Score =   243 bits (621),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 119/144 (83%), Positives = 128/144 (89%), Gaps = 2/144 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLAS IP+ +Q LN N  SGY APEVA+SGQYT KSD+YSFGV MLELL+GR PFDSSR 
Sbjct  564  GLASYIPNAEQILNHNVGSGYDAPEVALSGQYTFKSDIYSFGVVMLELLSGRRPFDSSRA  623

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDAL+KMVDP L+GLYPVKSLSRFADVIALCVQPEPEFRP MSE
Sbjct  624  RQEQSLVRWATPQLHDIDALAKMVDPTLKGLYPVKSLSRFADVIALCVQPEPEFRPQMSE  683

Query  357  VVEALVRLVQRANMSRR--TFGAD  292
            VV+ALVRLVQRANMSRR  TFG+D
Sbjct  684  VVQALVRLVQRANMSRRTFTFGSD  707



>ref|XP_009777355.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Nicotiana sylvestris]
Length=693

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLA+L+ D DQ LN N+ SGYGAPE A+SG+ T KSDVYSFGV MLEL +GR PFDSSR
Sbjct  549  SGLANLVADVDQGLNHNTESGYGAPEAAISGKCTAKSDVYSFGVVMLELFSGRKPFDSSR  608

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDAL ++VDPAL GLY VKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  609  PRSEQSLVRWATPQLHDIDALEQIVDPALDGLYSVKSLSRFADVIALCVQPEPEFRPPMS  668

Query  360  EVVEALVRLVQRANMSRRTFGAD  292
            EVV+ALVRLVQRAN+S+R  G D
Sbjct  669  EVVQALVRLVQRANLSKRLHGID  691



>ref|XP_009777352.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009777353.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009777354.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
Length=697

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLA+L+ D DQ LN N+ SGYGAPE A+SG+ T KSDVYSFGV MLEL +GR PFDSSR
Sbjct  553  SGLANLVADVDQGLNHNTESGYGAPEAAISGKCTAKSDVYSFGVVMLELFSGRKPFDSSR  612

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDAL ++VDPAL GLY VKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  613  PRSEQSLVRWATPQLHDIDALEQIVDPALDGLYSVKSLSRFADVIALCVQPEPEFRPPMS  672

Query  360  EVVEALVRLVQRANMSRRTFGAD  292
            EVV+ALVRLVQRAN+S+R  G D
Sbjct  673  EVVQALVRLVQRANLSKRLHGID  695



>ref|XP_004983096.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Setaria 
italica]
Length=719

 Score =   241 bits (616),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 132/157 (84%), Gaps = 3/157 (2%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            +GL+S +PD E QA +Q   SGYGAPEV M+GQYT+KSDVYSFGV MLELLTGR PFDSS
Sbjct  564  AGLSSFVPDAEFQASDQ--GSGYGAPEVDMTGQYTLKSDVYSFGVVMLELLTGRKPFDSS  621

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFADV+ALCVQPEPEFRPPM
Sbjct  622  RPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVVALCVQPEPEFRPPM  681

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            SEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  682  SEVVQALVRLVQRANMTRRMLDGEEASRRPDDQDQEF  718



>ref|XP_010685195.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Beta vulgaris 
subsp. vulgaris]
Length=707

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 133/154 (86%), Gaps = 5/154 (3%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLASL P+ +QA+N N+     APEVA SGQYT+KSDVYSFGV MLELL+GR PFDSS P
Sbjct  556  GLASLHPNGNQAINHNAC----APEVADSGQYTLKSDVYSFGVVMLELLSGRKPFDSSFP  611

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDAL+KMVDPAL GLYPVKSLSRFADVIALCVQPEPEFRPPMSE
Sbjct  612  RAEQSLVRWATPQLHDIDALTKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  671

Query  357  VVEALVRLVQRANMSRRTFGADSRTRSGSADSQE  256
            VV+ALVRLVQRANMS+RT G  +R +S S D+ +
Sbjct  672  VVQALVRLVQRANMSKRTVGNAAR-QSESMDAND  704



>ref|XP_009383597.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Musa acuminata 
subsp. malaccensis]
Length=720

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 131/157 (83%), Gaps = 2/157 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            G  SL+PD E QA  QN ASGY  PEVAMSGQYT+KSDVY+FGV MLELLTGR PFDSSR
Sbjct  562  GFESLVPDAEFQASEQNMASGYSPPEVAMSGQYTLKSDVYNFGVVMLELLTGRKPFDSSR  621

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDAL +M+DP L+GLYP KSLSRFADVIALCVQPEPEFRPPMS
Sbjct  622  PRSEQSLVRWATPQLHDIDALDRMIDPDLKGLYPAKSLSRFADVIALCVQPEPEFRPPMS  681

Query  360  EVVEALVRLVQRANM-SRRTFGADSRTRSGSADSQEY  253
            EVV+ALVRLVQRANM S+RT G +      + +S +Y
Sbjct  682  EVVQALVRLVQRANMSSKRTVGGEGPETRRADESDDY  718



>ref|XP_006836581.1| hypothetical protein AMTR_s00131p00083660 [Amborella trichopoda]
 gb|ERM99434.1| hypothetical protein AMTR_s00131p00083660 [Amborella trichopoda]
Length=721

 Score =   239 bits (610),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 132/160 (83%), Gaps = 3/160 (2%)
 Frame = -1

Query  717  GLASLIPDED-QALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            GL   + + D +A NQN  SGY APEVAMSG YT+KSDVYSFGVAMLELLTGR PFDSS+
Sbjct  562  GLGDFVANPDSEASNQNQGSGYSAPEVAMSGVYTMKSDVYSFGVAMLELLTGRKPFDSSK  621

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDALSKMVDP L+ LYPVKSLSRFADV+ALCVQPEPEFRPPMS
Sbjct  622  ARSEQSLVRWATPQLHDIDALSKMVDPGLKELYPVKSLSRFADVVALCVQPEPEFRPPMS  681

Query  360  EVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQEYEL  247
            EVV+ALVRLVQRA+MS+RT   DS    ++   D+ EY L
Sbjct  682  EVVQALVRLVQRASMSKRTNSEDSGASRKAEEHDNHEYSL  721



>ref|NP_001167741.1| uncharacterized protein LOC100381429 precursor [Zea mays]
 gb|ACN25932.1| unknown [Zea mays]
Length=720

 Score =   239 bits (609),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 130/157 (83%), Gaps = 3/157 (2%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            +G +S +PD E QA +Q   SGY APEV MSGQYT+KSDVYSFGV MLELLTGR PFDSS
Sbjct  565  AGHSSFVPDAEFQASDQ--GSGYSAPEVEMSGQYTLKSDVYSFGVVMLELLTGRKPFDSS  622

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFADVIALCVQPEPEFRPPM
Sbjct  623  RPRSEQSLVRWATPQLHDIDALDQMVDPALKGLYPAKSLSRFADVIALCVQPEPEFRPPM  682

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            SEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  683  SEVVQALVRLVQRANMTRRMLDGEEASRRPDDQEQEF  719



>gb|EPS61932.1| ovule receptor-like kinase 28, partial [Genlisea aurea]
Length=704

 Score =   238 bits (607),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 131/156 (84%), Gaps = 8/156 (5%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            GLA LI +  DQ       SGY APEVAMSGQYT+KSDVYSFGV MLEL++GR PFDSS+
Sbjct  555  GLARLISEPADQG------SGYVAPEVAMSGQYTVKSDVYSFGVVMLELISGRKPFDSSK  608

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDALSKMVDP+L+GLYP KSLS+FAD+IALCVQ EPEFRP MS
Sbjct  609  PRSEQSLVRWATPQLHDIDALSKMVDPSLKGLYPAKSLSQFADIIALCVQAEPEFRPSMS  668

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRS-GSADSQE  256
            EVVEA+VRLVQRANMSRRTFG +   RS GS+D  E
Sbjct  669  EVVEAIVRLVQRANMSRRTFGNEGSNRSAGSSDGNE  704



>gb|ACG49227.1| leucine-rich repeat transmembrane protein kinase 1 [Zea mays]
Length=676

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 129/157 (82%), Gaps = 3/157 (2%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            +G +S +PD E QA +Q   SGY APEV MSGQYT+KSDVYSFGV MLELLTGR PFDS 
Sbjct  521  AGHSSFVPDAEFQASDQ--GSGYSAPEVEMSGQYTLKSDVYSFGVVMLELLTGRKPFDSX  578

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFADVIALCVQPEPEFRPPM
Sbjct  579  RPRSEQSLVRWATPQLHDIDALDQMVDPALKGLYPAKSLSRFADVIALCVQPEPEFRPPM  638

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            SEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  639  SEVVQALVRLVQRANMTRRMLDGEEASRRPDDQEQEF  675



>gb|AAC27894.1| leucine-rich repeat transmembrane protein kinase 1 [Zea mays]
Length=684

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 128/153 (84%), Gaps = 3/153 (2%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            +GLAS IPD E QA  Q  ++GY APEV M+GQYT KSDVYSFGV MLELLTGR PFDSS
Sbjct  530  AGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYTFKSDVYSFGVVMLELLTGRRPFDSS  587

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFADV+ALCVQPEPEFRPPM
Sbjct  588  RPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPM  647

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSAD  265
            SEVV+ALVRLVQRANM++R    D+  R    D
Sbjct  648  SEVVQALVRLVQRANMTKRMLDGDTSRRPDDLD  680



>ref|XP_008651696.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X2 [Zea 
mays]
Length=712

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 129/153 (84%), Gaps = 3/153 (2%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            +GLAS IPD E QA  Q  ++GY APEV M+GQYT+KSDVYSFGV MLELLTGR PFDSS
Sbjct  558  AGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGRRPFDSS  615

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFADV+ALCVQPEPEFRPPM
Sbjct  616  RPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPM  675

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSAD  265
            SEVV+ALVRLVQRANM++R    D+  R    D
Sbjct  676  SEVVQALVRLVQRANMTKRMLDGDTSRRPDDLD  708



>ref|XP_008651693.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Zea 
mays]
 tpg|DAA43732.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=736

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 129/153 (84%), Gaps = 3/153 (2%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            +GLAS IPD E QA  Q  ++GY APEV M+GQYT+KSDVYSFGV MLELLTGR PFDSS
Sbjct  582  AGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGRRPFDSS  639

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFADV+ALCVQPEPEFRPPM
Sbjct  640  RPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPM  699

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSAD  265
            SEVV+ALVRLVQRANM++R    D+  R    D
Sbjct  700  SEVVQALVRLVQRANMTKRMLDGDTSRRPDDLD  732



>ref|XP_006357429.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Solanum 
tuberosum]
Length=716

 Score =   237 bits (604),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLA+L+ D DQ LN N  SGYGAPE A+SG+ T KSDVYSFGV MLEL TGR PFDSSR
Sbjct  572  SGLANLMADADQGLNHNIESGYGAPEAAISGKCTTKSDVYSFGVVMLELCTGRKPFDSSR  631

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL GLY VKSLSRFADVIALCVQ EPEFRPPMS
Sbjct  632  SRSEQSLVRWATPQLHDIDALEKMVDPALSGLYSVKSLSRFADVIALCVQLEPEFRPPMS  691

Query  360  EVVEALVRLVQRANMSRRTFGAD  292
            EVV+ALVRLVQRANMS+R    D
Sbjct  692  EVVQALVRLVQRANMSKRLHNND  714



>ref|XP_004985465.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Setaria italica]
Length=722

 Score =   237 bits (604),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 129/153 (84%), Gaps = 3/153 (2%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            +GLAS IPD E QA  Q  ++GY APEV M+GQYT+KSDVYSFGV MLELLTGR PFDSS
Sbjct  568  AGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGRRPFDSS  625

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFADV+ALCVQPEPEFRPPM
Sbjct  626  RPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPM  685

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSAD  265
            SEVV+ALVRLVQRANM++R    D+  R    D
Sbjct  686  SEVVQALVRLVQRANMTKRMLDGDTSRRPDDQD  718



>ref|XP_006661732.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Oryza brachyantha]
Length=717

 Score =   236 bits (603),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 130/157 (83%), Gaps = 3/157 (2%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            +GLAS +PD E QA +Q   SGY APEV M+GQYT+KSDVYSFGV MLELLTGR PFDSS
Sbjct  562  AGLASFVPDSEFQASDQ--GSGYSAPEVDMTGQYTLKSDVYSFGVVMLELLTGRKPFDSS  619

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFADV+ALCVQPEPEFRPPM
Sbjct  620  RQRTEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVVALCVQPEPEFRPPM  679

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            SEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  680  SEVVQALVRLVQRANMTRRMIDGEEGSRRPDDQDQEF  716



>ref|XP_004985464.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Setaria italica]
Length=752

 Score =   237 bits (604),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 129/153 (84%), Gaps = 3/153 (2%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            +GLAS IPD E QA  Q  ++GY APEV M+GQYT+KSDVYSFGV MLELLTGR PFDSS
Sbjct  598  AGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGRRPFDSS  655

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFADV+ALCVQPEPEFRPPM
Sbjct  656  RPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPM  715

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSAD  265
            SEVV+ALVRLVQRANM++R    D+  R    D
Sbjct  716  SEVVQALVRLVQRANMTKRMLDGDTSRRPDDQD  748



>ref|XP_006392757.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
 gb|ESQ30043.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
Length=717

 Score =   236 bits (602),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  ++ LNQ +  GY APEV+MSGQY++KSDVYSFGV MLELLTGR PFDS+R
Sbjct  561  SGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTR  619

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  620  SRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  679

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADS  262
            EVV+ALV LVQRANMS+RT G D   RSGSAD+
Sbjct  680  EVVQALVVLVQRANMSKRTVGVDPSQRSGSADT  712



>ref|XP_006392758.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
 gb|ESQ30044.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
Length=719

 Score =   236 bits (601),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  ++ LNQ +  GY APEV+MSGQY++KSDVYSFGV MLELLTGR PFDS+R
Sbjct  563  SGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTR  621

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  622  SRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  681

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADS  262
            EVV+ALV LVQRANMS+RT G D   RSGSAD+
Sbjct  682  EVVQALVVLVQRANMSKRTVGVDPSQRSGSADT  714



>ref|XP_009591325.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
tomentosiformis]
Length=701

 Score =   235 bits (600),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 123/143 (86%), Gaps = 2/143 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLA+LI D DQ LN  + SGYGAPE A+SG+ + KSDVYSFGV MLEL +GR PFD SR
Sbjct  559  SGLANLIADTDQGLN--TESGYGAPEAAISGKCSTKSDVYSFGVVMLELFSGRKPFDCSR  616

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDAL KMVDPAL GLY VKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  617  PRSEQSLVRWATPQLHDIDALEKMVDPALVGLYSVKSLSRFADVIALCVQPEPEFRPPMS  676

Query  360  EVVEALVRLVQRANMSRRTFGAD  292
            EVV+ALVRLVQRAN+S+R  G D
Sbjct  677  EVVQALVRLVQRANLSKRLHGID  699



>ref|XP_002468389.1| hypothetical protein SORBIDRAFT_01g045010 [Sorghum bicolor]
 gb|EER95387.1| hypothetical protein SORBIDRAFT_01g045010 [Sorghum bicolor]
Length=730

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 128/153 (84%), Gaps = 3/153 (2%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            +GLAS IPD E QA  Q  ++GY APEV M+GQY +KSDVYSFGV MLELLTGR PFDSS
Sbjct  576  AGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYNLKSDVYSFGVVMLELLTGRRPFDSS  633

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFADV+ALCVQPEPEFRPPM
Sbjct  634  RPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPM  693

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSAD  265
            SEVV+ALVRLVQRANM++R    D+  R    D
Sbjct  694  SEVVQALVRLVQRANMTKRMLDGDTSRRPDDQD  726



>ref|XP_008659003.1| PREDICTED: leucine-rich repeat transmembrane protein kinase 2 
isoform X1 [Zea mays]
Length=684

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 130/157 (83%), Gaps = 4/157 (3%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            +GLAS IPD E QA  Q  ++GY APEV M+GQYT+KSDVYSFGV MLELLTGR PFDSS
Sbjct  529  TGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGRRPFDSS  586

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWA PQLHDIDAL +MVDPAL+GLYP KSLSRFADV+ALCVQPEPEFRPPM
Sbjct  587  RPRSEQSLVRWAAPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPM  646

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            SEVV+ALVRLVQRANM++R       +R G  D  +Y
Sbjct  647  SEVVQALVRLVQRANMTKRMLDGGDTSR-GPDDQDQY  682



>gb|ABB20817.1| putative leucine-rich repeat transmembrane protein kinase [Isatis 
tinctoria]
 gb|ABF50792.1| leucine-rich repeat transmembrane protein kinase [Isatis tinctoria]
Length=719

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  ++ LNQ +  GY APEV+MSGQY++KSDVYSFGV MLELLTGR PFDS+R
Sbjct  563  SGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTR  621

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  622  SRSEQSLVRWATPQLHDIDALGKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMS  681

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADS  262
            EVV+ALV LVQRANMS+RT G D   RSGSAD+
Sbjct  682  EVVQALVVLVQRANMSKRTVGVDPSQRSGSADT  714



>ref|XP_006304699.1| hypothetical protein CARUB_v10011957mg [Capsella rubella]
 gb|EOA37597.1| hypothetical protein CARUB_v10011957mg [Capsella rubella]
Length=719

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  ++ LNQ +  GY APEV+MSGQY++KSDVYSFGV MLELLTGR PFDS+R
Sbjct  563  SGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTR  621

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  622  SRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  681

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADS  262
            EVV+ALV LVQRANMS+RT G D   R+GSAD+
Sbjct  682  EVVQALVVLVQRANMSKRTVGVDPSQRTGSADA  714



>ref|NP_175777.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
 sp|Q9C8M9.1|SRF6_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 6; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF6; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51974.1|AC024260_12 leucine-rich repeat transmembrane protein kinase 1, putative; 
10414-6710 [Arabidopsis thaliana]
 gb|AAQ89622.1| At1g53730 [Arabidopsis thaliana]
 gb|AAR99874.1| strubbelig receptor family 6 [Arabidopsis thaliana]
 dbj|BAE99117.1| LRR receptor-like protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59255.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE32990.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
Length=719

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  ++ LNQ +  GY APEV+MSGQY++KSD+YSFGV MLELLTGR PFDS+R
Sbjct  563  SGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDIYSFGVVMLELLTGRKPFDSTR  621

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  622  SRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  681

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADS  262
            EVV+ALV LVQRANMS+RT G D   R+GSAD+
Sbjct  682  EVVQALVVLVQRANMSKRTVGVDPSQRAGSADT  714



>gb|AFW89442.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=725

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 130/157 (83%), Gaps = 4/157 (3%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            +GLAS IPD E QA  Q  ++GY APEV M+GQYT+KSDVYSFGV MLELLTGR PFDSS
Sbjct  570  TGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGRRPFDSS  627

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWA PQLHDIDAL +MVDPAL+GLYP KSLSRFADV+ALCVQPEPEFRPPM
Sbjct  628  RPRSEQSLVRWAAPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPM  687

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            SEVV+ALVRLVQRANM++R       +R G  D  +Y
Sbjct  688  SEVVQALVRLVQRANMTKRMLDGGDTSR-GPDDQDQY  723



>gb|KFK35699.1| hypothetical protein AALP_AA4G025700 [Arabis alpina]
Length=721

 Score =   234 bits (598),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  ++ LNQ +  GY APEV+MSGQY++KSD+YSFGV MLELLTGR PFDS+R
Sbjct  565  SGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDIYSFGVVMLELLTGRKPFDSTR  623

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDALSKMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  624  SRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  683

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADS  262
            EVV+ALV LVQRANMS+RT G D   R+GSA++
Sbjct  684  EVVQALVVLVQRANMSKRTVGVDPSQRAGSAET  716



>ref|XP_006649512.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Oryza brachyantha]
Length=717

 Score =   234 bits (597),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 127/152 (84%), Gaps = 1/152 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            +GLAS I D +    Q SA G  APEV M+GQYT+KSDVYSFGV MLELLTGR PFDS++
Sbjct  563  AGLASFISDAEFQAAQQSA-GCTAPEVDMTGQYTLKSDVYSFGVVMLELLTGRRPFDSTK  621

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PRPEQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFADV+ALCVQPEPEFRPPMS
Sbjct  622  PRPEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMS  681

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSAD  265
            EVV+ALVRLVQRANM++R    DS  R+   D
Sbjct  682  EVVQALVRLVQRANMTKRMLDGDSSRRADDQD  713



>ref|NP_001064502.1| Os10g0389800 [Oryza sativa Japonica Group]
 gb|AAO72637.1| putative leucine-rich repeat transmembrane protein kinase [Oryza 
sativa Japonica Group]
 gb|ABB47491.1| leucine-rich repeat transmembrane protein kinase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26416.1| Os10g0389800 [Oryza sativa Japonica Group]
 gb|EEE50892.1| hypothetical protein OsJ_31383 [Oryza sativa Japonica Group]
Length=719

 Score =   234 bits (597),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 130/157 (83%), Gaps = 3/157 (2%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            +GLAS +PD E QA +Q   SGY APEV M+GQYT+KSDVYSFGV MLELLTGR PFDS+
Sbjct  564  AGLASSVPDSEFQASDQ--GSGYSAPEVDMTGQYTLKSDVYSFGVVMLELLTGRKPFDSA  621

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFADVIALCVQPEPEFRPPM
Sbjct  622  RLRTEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEPEFRPPM  681

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            SEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  682  SEVVQALVRLVQRANMTRRMIDGEEGSRRPDDQDQEF  718



>gb|EEC66871.1| hypothetical protein OsI_33412 [Oryza sativa Indica Group]
Length=719

 Score =   234 bits (597),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 130/157 (83%), Gaps = 3/157 (2%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            +GLAS +PD E QA +Q   SGY APEV M+GQYT+KSDVYSFGV MLELLTGR PFDS+
Sbjct  564  AGLASNVPDSEFQASDQ--GSGYSAPEVDMTGQYTLKSDVYSFGVVMLELLTGRKPFDSA  621

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFADVIALCVQPEPEFRPPM
Sbjct  622  RLRTEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEPEFRPPM  681

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            SEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  682  SEVVQALVRLVQRANMTRRMIDGEEGSRRPDDQDQEF  718



>gb|AAK52120.1|AC079936_16 Putative leucine-rich repeat transmembrane protein kinase 1 [Oryza 
sativa Japonica Group]
Length=736

 Score =   234 bits (596),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 130/157 (83%), Gaps = 3/157 (2%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            +GLAS +PD E QA +Q   SGY APEV M+GQYT+KSDVYSFGV MLELLTGR PFDS+
Sbjct  581  AGLASSVPDSEFQASDQ--GSGYSAPEVDMTGQYTLKSDVYSFGVVMLELLTGRKPFDSA  638

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFADVIALCVQPEPEFRPPM
Sbjct  639  RLRTEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEPEFRPPM  698

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            SEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  699  SEVVQALVRLVQRANMTRRMIDGEEGSRRPDDQDQEF  735



>ref|XP_010479951.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Camelina 
sativa]
Length=721

 Score =   234 bits (596),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  D+ +NQ +  GY APEV+MSGQYT+KSDVYSFGV MLELLTGR PFDS+R
Sbjct  565  SGLASFLPTADELINQ-TDEGYSAPEVSMSGQYTLKSDVYSFGVVMLELLTGRKPFDSTR  623

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  624  SRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  683

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADS  262
            EVV+ALV LVQRANMS+RT G D   RSG+ D+
Sbjct  684  EVVQALVVLVQRANMSKRTVGVDPPQRSGNPDT  716



>ref|XP_010096526.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Morus notabilis]
 gb|EXB64646.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Morus notabilis]
Length=689

 Score =   233 bits (594),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 128/154 (83%), Gaps = 1/154 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLA+ IP   + L+ +   G+ APE+ M+GQY++KSDVYSFGV MLELLTGR PFDS RP
Sbjct  534  GLANFIPRAKEYLSSHVEVGFNAPEILMAGQYSVKSDVYSFGVIMLELLTGRKPFDSLRP  593

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLV+WA+PQLHDIDALSKMVDPAL GLYPVKSLSRFADVIALC+Q EPEFRPPMSE
Sbjct  594  RSEQSLVQWASPQLHDIDALSKMVDPALEGLYPVKSLSRFADVIALCIQAEPEFRPPMSE  653

Query  357  VVEALVRLVQRANMSRRTFGADSRTRSGSADSQE  256
            VV+ALV LVQRANMS+RT G D  T S   DSQ+
Sbjct  654  VVQALVLLVQRANMSKRTIGVDQGT-SRRGDSQD  686



>ref|NP_001049184.1| Os03g0183800 [Oryza sativa Japonica Group]
 gb|AAK92627.1|AC079633_7 Putative leucine-rich repeat transmembrane protein kinase 1 [Oryza 
sativa Japonica Group]
 gb|ABF94338.1| leucine-rich repeat transmembrane protein kinase 1, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF11098.1| Os03g0183800 [Oryza sativa Japonica Group]
 gb|EAY88809.1| hypothetical protein OsI_10282 [Oryza sativa Indica Group]
 gb|EAZ25839.1| hypothetical protein OsJ_09681 [Oryza sativa Japonica Group]
 dbj|BAG94684.1| unnamed protein product [Oryza sativa Japonica Group]
Length=718

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 128/156 (82%), Gaps = 1/156 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            +GLAS I D +    Q SA G  APEV M+GQYT+KSDVYSFGV MLELLTGR PFDS+R
Sbjct  563  AGLASFISDAEFQAAQQSA-GCTAPEVDMTGQYTLKSDVYSFGVVMLELLTGRRPFDSTR  621

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFADV+ALCVQPEPEFRPPMS
Sbjct  622  PRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMS  681

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            EVV+ALVRLVQRANM++R    D+ +R      Q++
Sbjct  682  EVVQALVRLVQRANMTKRMLDGDTSSRRTDDQEQDF  717



>emb|CDY02495.1| BnaA08g01020D [Brassica napus]
Length=716

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            +GLAS +P  ++ LNQ +  GY APEV+MSGQY++KSDVYSFGV MLELLTGR PFDS+R
Sbjct  560  TGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTR  618

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  619  SRSEQSLVRWATPQLHDIDALGKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMS  678

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADS  262
            EVV++LV LVQRANMS+RT G D   RSGSA++
Sbjct  679  EVVQSLVVLVQRANMSKRTVGVDPSQRSGSAET  711



>ref|XP_009106960.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Brassica rapa]
Length=716

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            +GLAS +P  ++ LNQ +  GY APEV+MSGQY++KSDVYSFGV MLELLTGR PFDS+R
Sbjct  560  TGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTR  618

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  619  SRSEQSLVRWATPQLHDIDALGKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMS  678

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADS  262
            EVV++LV LVQRANMS+RT G D   RSGSA++
Sbjct  679  EVVQSLVVLVQRANMSKRTVGVDPSQRSGSAET  711



>ref|XP_011079189.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Sesamum 
indicum]
Length=688

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 124/135 (92%), Gaps = 5/135 (4%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLASL+    ++L+Q  ASGY APEV+MSGQYTIKSDVYSFGV MLELL+GRTPFDSSRP
Sbjct  559  GLASLV---HESLDQ--ASGYNAPEVSMSGQYTIKSDVYSFGVVMLELLSGRTPFDSSRP  613

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSL RWATPQLHDIDAL+KMVDPAL GLYPVKSLSRFADVIALCVQPEPEFRPPMSE
Sbjct  614  RTEQSLARWATPQLHDIDALAKMVDPALDGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  673

Query  357  VVEALVRLVQRANMS  313
            VVE+LVRLV++ANMS
Sbjct  674  VVESLVRLVEQANMS  688



>emb|CDY25686.1| BnaC03g69890D [Brassica napus]
Length=716

 Score =   232 bits (592),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 135/157 (86%), Gaps = 2/157 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            +GLAS +P  ++ LNQ +  GY APEV+MSGQY++KSDVYSFGV MLELLTGR PFDS+R
Sbjct  560  TGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTR  618

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  619  SRSEQSLVRWATPQLHDIDALGKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMS  678

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSAD-SQEY  253
            EVV++LV LVQRANMS+RT G D   RSGSA+ S +Y
Sbjct  679  EVVQSLVVLVQRANMSKRTVGVDPSQRSGSAEPSNDY  715



>ref|XP_010501035.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Camelina sativa]
Length=721

 Score =   232 bits (592),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  D+ +NQ +  GY APEV+MSGQY++KSDVYSFGV MLELLTGR PFDS+R
Sbjct  565  SGLASFLPTADELINQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTR  623

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  624  SRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  683

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADS  262
            EVV+ALV LVQRANMS+RT G D   RSG+ D+
Sbjct  684  EVVQALVVLVQRANMSKRTVGVDPPQRSGNPDT  716



>ref|NP_001104882.1| leucine-rich repeat transmembrane protein kinase 2 precursor 
[Zea mays]
 gb|AAC27895.1| leucine-rich repeat transmembrane protein kinase 2 [Zea mays]
Length=725

 Score =   231 bits (590),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 129/157 (82%), Gaps = 4/157 (3%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            +GLAS IP  E QA  Q  ++GY APEV M+GQYT+KSDVYSFGV MLELLTGR PFDSS
Sbjct  570  TGLASFIPGAEFQAAEQ--SAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGRRPFDSS  627

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWA PQLHDIDAL +MVDPAL+GLYP KSLSRFADV+ALCVQPEPEFRPPM
Sbjct  628  RPRSEQSLVRWAAPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPM  687

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            SEVV+ALVRLVQRANM++R       +R G  D  +Y
Sbjct  688  SEVVQALVRLVQRANMTKRMLDGGDTSR-GPDDQDQY  723



>ref|XP_010534992.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 isoform X2 [Tarenaya 
hassleriana]
Length=641

 Score =   230 bits (587),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQ-NSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            SGL   +P  D+ LNQ +  +GY APEV+MSGQY+ KSDVYSFGV MLELLTGR PFDS+
Sbjct  484  SGLTCFLPMADELLNQSDEGTGYSAPEVSMSGQYSTKSDVYSFGVVMLELLTGRKPFDST  543

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDI+AL KMVDP+L+ LYPVKSLSRFADVIALCVQPEPEFRPPM
Sbjct  544  RPRSEQSLVRWATPQLHDINALGKMVDPSLKRLYPVKSLSRFADVIALCVQPEPEFRPPM  603

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            SEVV+ALV LVQRANMS+RT G D   RS SA+  +Y
Sbjct  604  SEVVQALVVLVQRANMSKRTIGVDQSQRSSSAEVNDY  640



>ref|XP_010937238.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X2 [Elaeis 
guineensis]
Length=676

 Score =   231 bits (588),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 134/159 (84%), Gaps = 4/159 (3%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            GLA+L PD E QA +QN  SGY APEVAMSGQYT+KSDVY FGV MLELLTGR PF+SSR
Sbjct  517  GLANLTPDAEFQASDQNMGSGYSAPEVAMSGQYTLKSDVYGFGVVMLELLTGRKPFESSR  576

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFADVIALCVQPEPEFRPPMS
Sbjct  577  SRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEPEFRPPMS  636

Query  360  EVVEALVRLVQRANMSRRTFGADSRT---RSGSADSQEY  253
            EVV+ALVRLVQRANMS+R    D++    RS   D+Q+Y
Sbjct  637  EVVQALVRLVQRANMSKRVLSGDTQETARRSDDPDTQDY  675



>ref|XP_003558655.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Brachypodium 
distachyon]
Length=720

 Score =   231 bits (589),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 131/159 (82%), Gaps = 6/159 (4%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            +GLAS IPD E QA  Q  ++G  APEV M+GQYT+KSDVYSFGV MLELLTGR PFDSS
Sbjct  566  AGLASFIPDAEFQAAEQ--SAGCTAPEVDMTGQYTLKSDVYSFGVVMLELLTGRKPFDSS  623

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            + R EQSLVRWA+PQLHDIDAL +MVDPAL+GLYP KSLSRFADV+ALCVQPEPEFRPPM
Sbjct  624  KSRSEQSLVRWASPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPM  683

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYEL  247
            SEVV+ALVRLVQRANM++R    D+   SG  D Q+ + 
Sbjct  684  SEVVQALVRLVQRANMTKRMLDGDT---SGRGDDQDQDF  719



>ref|XP_002467303.1| hypothetical protein SORBIDRAFT_01g024160 [Sorghum bicolor]
 gb|EER94301.1| hypothetical protein SORBIDRAFT_01g024160 [Sorghum bicolor]
Length=698

 Score =   231 bits (588),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 126/154 (82%), Gaps = 3/154 (2%)
 Frame = -1

Query  711  ASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRPR  535
            +  +PD E QA +Q   SGY APEV MS QY++KSDVYSFGV MLELLTGR PFDSSRPR
Sbjct  546  SCFVPDVEFQASDQ--GSGYSAPEVGMSSQYSLKSDVYSFGVVMLELLTGRKPFDSSRPR  603

Query  534  PEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSEV  355
             EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFADV+ALCVQPEPEFRPPMSEV
Sbjct  604  SEQSLVRWATPQLHDIDALDQMVDPALKGLYPAKSLSRFADVVALCVQPEPEFRPPMSEV  663

Query  354  VEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            V+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  664  VQALVRLVQRANMTRRMIDGEEASRRPDDQEQEF  697



>ref|NP_001077716.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
 gb|AEE32991.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
Length=720

 Score =   231 bits (589),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 135/154 (88%), Gaps = 2/154 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS-  544
            SGLAS +P  ++ LNQ +  GY APEV+MSGQY++KSD+YSFGV MLELLTGR PFDSS 
Sbjct  563  SGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDIYSFGVVMLELLTGRKPFDSST  621

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPM
Sbjct  622  RSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPM  681

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  262
            SEVV+ALV LVQRANMS+RT G D   R+GSAD+
Sbjct  682  SEVVQALVVLVQRANMSKRTVGVDPSQRAGSADT  715



>ref|XP_010937237.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Elaeis 
guineensis]
Length=724

 Score =   231 bits (589),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 134/159 (84%), Gaps = 4/159 (3%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            GLA+L PD E QA +QN  SGY APEVAMSGQYT+KSDVY FGV MLELLTGR PF+SSR
Sbjct  565  GLANLTPDAEFQASDQNMGSGYSAPEVAMSGQYTLKSDVYGFGVVMLELLTGRKPFESSR  624

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFADVIALCVQPEPEFRPPMS
Sbjct  625  SRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEPEFRPPMS  684

Query  360  EVVEALVRLVQRANMSRRTFGADSRT---RSGSADSQEY  253
            EVV+ALVRLVQRANMS+R    D++    RS   D+Q+Y
Sbjct  685  EVVQALVRLVQRANMSKRVLSGDTQETARRSDDPDTQDY  723



>ref|XP_010462281.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Camelina 
sativa]
Length=721

 Score =   231 bits (588),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  D+ +NQ +  GY APEV+MSGQY++KSDVYSFGV MLELLTGR PFDS++
Sbjct  565  SGLASFLPAADELINQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTK  623

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  624  SRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  683

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADS  262
            EVV+ALV LVQRANMS+RT G D   RSG+ D+
Sbjct  684  EVVQALVVLVQRANMSKRTVGVDPPQRSGNPDT  716



>ref|XP_002891770.1| hypothetical protein ARALYDRAFT_474507 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68029.1| hypothetical protein ARALYDRAFT_474507 [Arabidopsis lyrata subsp. 
lyrata]
Length=721

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 135/154 (88%), Gaps = 2/154 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS-  544
            SGLAS +P  ++ LNQ +  GY APEV+MSGQY++KSDVYSFGV MLELLTGR PFDSS 
Sbjct  564  SGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSSK  622

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPM
Sbjct  623  RSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPM  682

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  262
            SEVV+ALV LVQRANMS+RT G D   R+G+AD+
Sbjct  683  SEVVQALVVLVQRANMSKRTVGVDPSQRAGNADT  716



>ref|XP_010487232.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Camelina 
sativa]
Length=554

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 132/156 (85%), Gaps = 5/156 (3%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  ++ LNQN   GY APE +MSGQY++KSDVYSFGV MLELLTGR PFDS+R
Sbjct  403  SGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTR  461

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  462  SRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  521

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            EVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  522  EVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  553



>emb|CDY39110.1| BnaA01g29460D [Brassica napus]
Length=724

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 134/156 (86%), Gaps = 5/156 (3%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            +GLAS +P  ++ LNQN   GYGAPEV+MSGQY++KSDVYSFGV MLELLTGR PFDS+R
Sbjct  573  AGLASFLPTANELLNQND-EGYGAPEVSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTR  631

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  632  SRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  691

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            EVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  692  EVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  723



>gb|EMS47769.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Triticum urartu]
Length=619

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 129/156 (83%), Gaps = 2/156 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            +GLAS IPD +    + SA G  APEV M+GQYT+KSDVYSFGV MLELLTGR PFDSS+
Sbjct  465  AGLASFIPDAEFQTAEQSA-GCTAPEVDMTGQYTMKSDVYSFGVVMLELLTGRKPFDSSK  523

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWA+PQLHDIDAL +MVDPAL+GLYP KSLSRFADV+ALCVQ EPEFRPPMS
Sbjct  524  PRSEQSLVRWASPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQAEPEFRPPMS  583

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            EVV+ALVRLVQRANM+++    D+ +R G    Q++
Sbjct  584  EVVQALVRLVQRANMTKKMLDGDA-SRRGDDQDQDF  618



>ref|XP_009116969.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Brassica 
rapa]
Length=723

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 134/156 (86%), Gaps = 5/156 (3%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            +GLAS +P  ++ LNQN   GYGAPEV+MSGQY++KSDVYSFGV MLELLTGR PFDS+R
Sbjct  572  AGLASFLPTANELLNQND-EGYGAPEVSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTR  630

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  631  SRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  690

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            EVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  691  EVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  722



>emb|CDX97567.1| BnaA05g25120D [Brassica napus]
Length=723

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 134/156 (86%), Gaps = 5/156 (3%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  ++ LNQN   GY APEV+MSGQY+++SDVYSFGV MLELLTGR PFDS+R
Sbjct  572  SGLASFLPTANELLNQND-EGYSAPEVSMSGQYSLQSDVYSFGVVMLELLTGRKPFDSTR  630

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDALSKMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  631  SRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  690

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            EVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  691  EVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  722



>ref|XP_010534991.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Tarenaya 
hassleriana]
Length=718

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQ-NSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            SGL   +P  D+ LNQ +  +GY APEV+MSGQY+ KSDVYSFGV MLELLTGR PFDS+
Sbjct  561  SGLTCFLPMADELLNQSDEGTGYSAPEVSMSGQYSTKSDVYSFGVVMLELLTGRKPFDST  620

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDI+AL KMVDP+L+ LYPVKSLSRFADVIALCVQPEPEFRPPM
Sbjct  621  RPRSEQSLVRWATPQLHDINALGKMVDPSLKRLYPVKSLSRFADVIALCVQPEPEFRPPM  680

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            SEVV+ALV LVQRANMS+RT G D   RS SA+  +Y
Sbjct  681  SEVVQALVVLVQRANMSKRTIGVDQSQRSSSAEVNDY  717



>ref|XP_002885038.1| hypothetical protein ARALYDRAFT_478852 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61297.1| hypothetical protein ARALYDRAFT_478852 [Arabidopsis lyrata subsp. 
lyrata]
Length=716

 Score =   229 bits (583),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 132/156 (85%), Gaps = 5/156 (3%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  ++ LNQN   GY APE +MSGQY++KSDVYSFGV MLELLTGR PFDSSR
Sbjct  565  SGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSSR  623

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  624  SRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  683

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            EVV+ALV LVQRANMS+RT GA     SGS+   +Y
Sbjct  684  EVVQALVVLVQRANMSKRTVGAG----SGSSGVNDY  715



>ref|XP_009146380.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Brassica rapa]
Length=723

 Score =   229 bits (583),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 134/156 (86%), Gaps = 5/156 (3%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  ++ LNQN   GY APEV+MSGQY+++SDVYSFG+ MLELLTGR PFDS+R
Sbjct  572  SGLASFLPTANELLNQND-EGYSAPEVSMSGQYSLQSDVYSFGIVMLELLTGRKPFDSTR  630

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDALSKMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  631  SRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  690

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            EVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  691  EVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  722



>gb|KFK38799.1| hypothetical protein AALP_AA3G161700 [Arabis alpina]
Length=714

 Score =   228 bits (582),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 133/156 (85%), Gaps = 5/156 (3%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  ++ LNQN   GY APEV+MSGQY++KSDVYSFGV MLELLTGR PFDS+R
Sbjct  563  SGLASFLPTANELLNQND-EGYNAPEVSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSAR  621

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDALSKMVDP L+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  622  SRSEQSLVRWATPQLHDIDALSKMVDPTLKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  681

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            EVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  682  EVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  713



>ref|XP_004958321.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X1 [Setaria italica]
 ref|XP_004958322.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X2 [Setaria italica]
Length=714

 Score =   228 bits (581),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 128/157 (82%), Gaps = 4/157 (3%)
 Frame = -1

Query  720  SGLASLIPDED-QALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            SG A L P+ + Q  ++NS  GY APEV MSGQY++KSDVYSFGV MLELLTGR PFD +
Sbjct  561  SGFADLTPNHEFQESDENS--GYRAPEVTMSGQYSLKSDVYSFGVVMLELLTGRKPFDRT  618

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPRPEQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQPEPEFRPPM
Sbjct  619  RPRPEQSLVRWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQPEPEFRPPM  678

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            SEVV++LVRLVQRANM+ RT  + SR    S    E+
Sbjct  679  SEVVQSLVRLVQRANMT-RTHESHSRRHGESGGDYEF  714



>ref|XP_006407090.1| hypothetical protein EUTSA_v10020162mg [Eutrema salsugineum]
 gb|ESQ48543.1| hypothetical protein EUTSA_v10020162mg [Eutrema salsugineum]
Length=714

 Score =   228 bits (581),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 131/152 (86%), Gaps = 4/152 (3%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  ++ LNQN   GY APEV+MSGQY++KSDVYSFGV MLELLTGR PFDS+R
Sbjct  565  SGLASFLPTANELLNQND-EGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTR  623

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  624  SRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  683

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSAD  265
            EVV+ALV LVQRANMS+RT G  S   SG+ D
Sbjct  684  EVVQALVVLVQRANMSKRTVGVGS---SGTND  712



>ref|XP_006657962.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Oryza brachyantha]
Length=721

 Score =   228 bits (580),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 129/159 (81%), Gaps = 5/159 (3%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            SG   LIP+ E QA + NS  GY APEV MSGQY++KSDVYSFGV MLELLTGR PFD S
Sbjct  565  SGFGGLIPNQESQASDDNS--GYKAPEVTMSGQYSLKSDVYSFGVVMLELLTGRKPFDRS  622

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPE-FRPP  367
            RPRPEQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQPEPE F PP
Sbjct  623  RPRPEQSLVRWATPQLHDIDALDRMVDPALQGLYPSKSLSRFADAIALCVQPEPELFGPP  682

Query  366  MSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  250
            MSEVV+ LVRLVQRANM+ RT GAD  +     +S ++E
Sbjct  683  MSEVVQLLVRLVQRANMT-RTCGADGHSWRRDGESGDHE  720



>ref|XP_006845116.1| hypothetical protein AMTR_s00005p00184950 [Amborella trichopoda]
 gb|ERN06791.1| hypothetical protein AMTR_s00005p00184950 [Amborella trichopoda]
Length=381

 Score =   220 bits (560),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 120/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE AMSG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  221  GLAALTPNTERQVSTQMLGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  280

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL+G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  281  RQRSEQSLVRWATPQLHDIDALAKMVDPALKGIYPAKSLSRFADIIALCVQPEPEFRPPM  340

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRL+QRA+M++R
Sbjct  341  SEVVQALVRLMQRASMNKR  359



>ref|XP_006300068.1| hypothetical protein CARUB_v10016296mg [Capsella rubella]
 gb|EOA32966.1| hypothetical protein CARUB_v10016296mg [Capsella rubella]
Length=717

 Score =   227 bits (579),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 132/156 (85%), Gaps = 5/156 (3%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  ++ LNQN   GY APE +MSGQY++KSDVYSFGV MLELLTGR PFDS+R
Sbjct  566  SGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTR  624

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  625  SRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  684

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            EVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  685  EVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  716



>ref|XP_010501850.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Camelina sativa]
Length=721

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 132/156 (85%), Gaps = 5/156 (3%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  ++ LNQN   GY APE +MSGQY++KSDVYSFGV MLELLTGR PFDS+R
Sbjct  570  SGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTR  628

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  629  SRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  688

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            EVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  689  EVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  720



>gb|ACN34179.1| unknown [Zea mays]
 tpg|DAA43733.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=128

 Score =   211 bits (536),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -1

Query  636  MSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPA  457
            M+GQYT+KSDVYSFGV MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDAL +MVDPA
Sbjct  1    MTGQYTLKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPA  60

Query  456  LRGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRS  277
            L+GLYP KSLSRFADV+ALCVQPEPEFRPPMSEVV+ALVRLVQRANM++R    D+  R 
Sbjct  61   LKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQALVRLVQRANMTKRMLDGDTSRRP  120

Query  276  GSAD  265
               D
Sbjct  121  DDLD  124



>gb|EMT02096.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Aegilops tauschii]
Length=690

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 129/156 (83%), Gaps = 2/156 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            +GLAS IPD +    + SA G  APEV M+GQYT+KSDVYSFGV MLELLTGR PF+SS+
Sbjct  536  AGLASFIPDAEFQTAEQSA-GCTAPEVDMTGQYTMKSDVYSFGVVMLELLTGRKPFESSK  594

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWA+PQLHDIDAL +MVDPAL+GLYP KSLSRFADV+ALCVQ EPEFRPPMS
Sbjct  595  PRSEQSLVRWASPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQAEPEFRPPMS  654

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            EVV+ALVRLVQRANM+++    D+ +R G    Q++
Sbjct  655  EVVQALVRLVQRANMTKKMLDGDA-SRRGDDQDQDF  689



>ref|XP_010465325.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Camelina 
sativa]
Length=721

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 132/156 (85%), Gaps = 5/156 (3%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  ++ LNQN   GY APE +MSGQY++KSDVYSFGV MLELLTGR PFDS+R
Sbjct  570  SGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTR  628

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  629  SRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  688

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            EVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  689  EVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  720



>ref|XP_001780717.1| predicted protein [Physcomitrella patens]
 gb|EDQ54501.1| predicted protein, partial [Physcomitrella patens]
Length=316

 Score =   217 bits (552),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  660  GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDA  481
            GY APE AM G YT+KSD+YSFGV MLELLTGR PFDS+RPR EQSLVRWATPQLHDIDA
Sbjct  179  GYSAPEYAMFGTYTVKSDIYSFGVVMLELLTGRKPFDSTRPRSEQSLVRWATPQLHDIDA  238

Query  480  LSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTF  301
            L++MVDPAL+G+YP KSLSRFADV+ALCVQPEPEFRPPMSEVV++LVRL+QRA+MS+R  
Sbjct  239  LARMVDPALKGMYPAKSLSRFADVVALCVQPEPEFRPPMSEVVQSLVRLIQRASMSKRGL  298

Query  300  GADSRT  283
               ++T
Sbjct  299  ELATQT  304



>gb|ACN58180.1| leucine-rich repeat protein [Dasypyrum villosum]
Length=260

 Score =   214 bits (546),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 2/144 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE +MSG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  98   GLAALTPNTERQVSTEVVGSFGYSAPEFSMSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  157

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  158  RERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  217

Query  363  SEVVEALVRLVQRANMSRRTFGAD  292
            SEVV+ LVRL+QRA++ RR  G +
Sbjct  218  SEVVQQLVRLMQRASIVRRQSGEE  241



>gb|ABQ53156.1| leucine-rich repeat protein [Triticum aestivum]
Length=263

 Score =   214 bits (546),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 2/144 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE +MSG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  101  GLAALTPNTERQVSTEVVGSFGYSAPEFSMSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  160

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  161  RERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  220

Query  363  SEVVEALVRLVQRANMSRRTFGAD  292
            SEVV+ LVRL+QRA++ RR  G +
Sbjct  221  SEVVQQLVRLMQRASIVRRQSGEE  244



>ref|XP_009388758.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=705

 Score =   225 bits (573),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 125/155 (81%), Gaps = 3/155 (2%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            GL  L+P+ E QA   N   GY APEVAMSGQYT+KSDVYSFGV MLEL+TGR PFDSSR
Sbjct  549  GLEGLVPNAEFQASELNM--GYSAPEVAMSGQYTMKSDVYSFGVVMLELMTGRKPFDSSR  606

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLV+WATPQLHDIDAL +MVDPAL+GLYP KSLSRFADVIALCVQ EPEFRPPMS
Sbjct  607  PRSEQSLVQWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQSEPEFRPPMS  666

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQE  256
            EVV+ALVRLV+R  M+ R  G D +  S  A  Q+
Sbjct  667  EVVQALVRLVKRVKMNNRMAGGDGQETSRRAGDQD  701



>ref|XP_009388759.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=703

 Score =   225 bits (573),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 125/155 (81%), Gaps = 3/155 (2%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            GL  L+P+ E QA   N   GY APEVAMSGQYT+KSDVYSFGV MLEL+TGR PFDSSR
Sbjct  547  GLEGLVPNAEFQASELNM--GYSAPEVAMSGQYTMKSDVYSFGVVMLELMTGRKPFDSSR  604

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLV+WATPQLHDIDAL +MVDPAL+GLYP KSLSRFADVIALCVQ EPEFRPPMS
Sbjct  605  PRSEQSLVQWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQSEPEFRPPMS  664

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQE  256
            EVV+ALVRLV+R  M+ R  G D +  S  A  Q+
Sbjct  665  EVVQALVRLVKRVKMNNRMAGGDGQETSRRAGDQD  699



>ref|XP_002461023.1| hypothetical protein SORBIDRAFT_02g039370 [Sorghum bicolor]
 gb|EER97544.1| hypothetical protein SORBIDRAFT_02g039370 [Sorghum bicolor]
Length=718

 Score =   225 bits (574),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 130/159 (82%), Gaps = 6/159 (4%)
 Frame = -1

Query  720  SGLASLIPDED-QALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            SG A L+ +++ Q  ++NS  GY APEV +SGQY++KSDVYSFGV MLELLTGR PFD S
Sbjct  565  SGFAGLLSNQEFQESDENS--GYRAPEVILSGQYSLKSDVYSFGVVMLELLTGRKPFDRS  622

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPRPEQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQPEPEFRPPM
Sbjct  623  RPRPEQSLVRWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQPEPEFRPPM  682

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYEL  247
            SEVV++LVRLVQRANM+R     +S++R       +YE 
Sbjct  683  SEVVQSLVRLVQRANMTRM---HESQSRRHGESGGDYEF  718



>emb|CDX98445.1| BnaC05g39300D [Brassica napus]
Length=722

 Score =   225 bits (573),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 132/155 (85%), Gaps = 5/155 (3%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLAS +P  ++ L QN   GY APEV+MSGQY+++SDVYSFGV MLELLTGR PFDS+R 
Sbjct  572  GLASFLPTANELLTQND-EGYSAPEVSMSGQYSLQSDVYSFGVVMLELLTGRKPFDSTRS  630

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDALSKMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMSE
Sbjct  631  RSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  690

Query  357  VVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            VV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  691  VVQALVVLVQRANMSKRTVGVG----SGSSGANDY  721



>emb|CDY33226.1| BnaC01g36990D [Brassica napus]
Length=711

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 132/156 (85%), Gaps = 5/156 (3%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            +GLAS +P  ++ LNQN   GY APEV+MS QY++KSDVYSFGV MLELLTGR PFDS+R
Sbjct  560  AGLASFLPTANELLNQND-EGYNAPEVSMSDQYSLKSDVYSFGVVMLELLTGRKPFDSTR  618

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  619  SRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  678

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  253
            EVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  679  EVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  710



>ref|NP_001173462.1| Os03g0397700 [Oryza sativa Japonica Group]
 dbj|BAH92190.1| Os03g0397700, partial [Oryza sativa Japonica Group]
Length=216

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 121/147 (82%), Gaps = 3/147 (2%)
 Frame = -1

Query  717  GLASLIPDED-QALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            G A LIP+++ Q  ++NS  GY APEV MSGQY+ KSDVYSFGV MLELLTGR  FD S+
Sbjct  62   GFAELIPNQELQESDENS--GYRAPEVTMSGQYSQKSDVYSFGVVMLELLTGRKAFDRSQ  119

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            P P+QSLVRWA+PQLHDIDAL +MVDPAL GLYP KSLSRFAD IALCVQPEPEFRPPMS
Sbjct  120  PWPQQSLVRWASPQLHDIDALDQMVDPALEGLYPAKSLSRFADAIALCVQPEPEFRPPMS  179

Query  360  EVVEALVRLVQRANMSRRTFGADSRTR  280
            EVV++LVRLVQR++M     G +S +R
Sbjct  180  EVVQSLVRLVQRSSMGSVLSGGESISR  206



>ref|XP_001776313.1| predicted protein [Physcomitrella patens]
 gb|EDQ58812.1| predicted protein [Physcomitrella patens]
Length=383

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 120/140 (86%), Gaps = 3/140 (2%)
 Frame = -1

Query  717  GLASLIPD--EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDS  547
            GLA+L P   E Q   Q   S GY APE AMSG YT+KSDVYSFGV MLELLTGR P DS
Sbjct  226  GLAALAPSGSERQVSAQMLGSFGYSAPEYAMSGTYTVKSDVYSFGVVMLELLTGRKPLDS  285

Query  546  SRPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPP  367
            SRPR EQSLVRWATPQLHDIDAL++MVDP+L+G+YP KSLSRFAD++ALCVQPEPEFRPP
Sbjct  286  SRPRSEQSLVRWATPQLHDIDALARMVDPSLKGIYPAKSLSRFADIVALCVQPEPEFRPP  345

Query  366  MSEVVEALVRLVQRANMSRR  307
            MSEVV+ALVRL+QRA++S+R
Sbjct  346  MSEVVQALVRLMQRASLSKR  365



>ref|XP_008653345.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Zea mays]
 tpg|DAA63620.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=716

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 130/159 (82%), Gaps = 6/159 (4%)
 Frame = -1

Query  720  SGLASLIPDED-QALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            SG A L+ +++ Q  ++NS  GY APEV ++GQY++KSDVYSFGV MLELLTGR PFD +
Sbjct  563  SGFAGLLANQEFQESDENS--GYRAPEVILAGQYSLKSDVYSFGVVMLELLTGRKPFDRT  620

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPRPEQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQPEPEFRPPM
Sbjct  621  RPRPEQSLVRWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQPEPEFRPPM  680

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYEL  247
            SEVV++LVRLVQRANM+R     +S++R       +YE 
Sbjct  681  SEVVQSLVRLVQRANMTRM---HESQSRRHGESGGDYEF  716



>ref|XP_008653346.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Zea mays]
Length=687

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 130/159 (82%), Gaps = 6/159 (4%)
 Frame = -1

Query  720  SGLASLIPDED-QALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            SG A L+ +++ Q  ++NS  GY APEV ++GQY++KSDVYSFGV MLELLTGR PFD +
Sbjct  534  SGFAGLLANQEFQESDENS--GYRAPEVILAGQYSLKSDVYSFGVVMLELLTGRKPFDRT  591

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPRPEQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQPEPEFRPPM
Sbjct  592  RPRPEQSLVRWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQPEPEFRPPM  651

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYEL  247
            SEVV++LVRLVQRANM+R     +S++R       +YE 
Sbjct  652  SEVVQSLVRLVQRANMTRM---HESQSRRHGESGGDYEF  687



>gb|AAV64203.1| leucine-rich repeat transmembrane protein kinase 1-like protein 
[Zea mays]
 gb|AAV64241.1| leucine-rich repeat transmembrane protein kinase 1-like protein 
[Zea mays]
 tpg|DAA63621.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=693

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 130/159 (82%), Gaps = 6/159 (4%)
 Frame = -1

Query  720  SGLASLIPDED-QALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            SG A L+ +++ Q  ++NS  GY APEV ++GQY++KSDVYSFGV MLELLTGR PFD +
Sbjct  540  SGFAGLLANQEFQESDENS--GYRAPEVILAGQYSLKSDVYSFGVVMLELLTGRKPFDRT  597

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPRPEQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQPEPEFRPPM
Sbjct  598  RPRPEQSLVRWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQPEPEFRPPM  657

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYEL  247
            SEVV++LVRLVQRANM+R     +S++R       +YE 
Sbjct  658  SEVVQSLVRLVQRANMTRM---HESQSRRHGESGGDYEF  693



>emb|CAA18116.1| serine/threonine protein kinase like protein [Arabidopsis thaliana]
 emb|CAB79168.1| serine/threonine protein kinase like protein [Arabidopsis thaliana]
 gb|ABL66730.1| At4g22130 [Arabidopsis thaliana]
Length=338

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 120/146 (82%), Gaps = 2/146 (1%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDS  547
            SGLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVY+FGV MLELLTGR P DS
Sbjct  177  SGLAALTPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTGRKPLDS  236

Query  546  SRPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPP  367
            SR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD+IALC+QPEPEFRPP
Sbjct  237  SRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPP  296

Query  366  MSEVVEALVRLVQRANMSRRTFGADS  289
            MSEVV+ LVRLVQRA++ +R    D+
Sbjct  297  MSEVVQQLVRLVQRASVVKRRSSDDT  322



>ref|NP_974312.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
 gb|AEE75506.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
Length=689

 Score =   222 bits (566),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 124/139 (89%), Gaps = 1/139 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  ++ LNQN   GY APE +MSGQY++KSDVYSFGV MLELLTGR PFDS+R
Sbjct  538  SGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTR  596

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  597  SRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  656

Query  360  EVVEALVRLVQRANMSRRT  304
            EVV+ALV LVQRANMS+RT
Sbjct  657  EVVQALVVLVQRANMSKRT  675



>dbj|BAG99361.1| unnamed protein product [Oryza sativa Japonica Group]
Length=683

 Score =   222 bits (566),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 126/157 (80%), Gaps = 4/157 (3%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SG A LIP+ +  ++ +  SGY APEV MSGQY++KSDVYSFGV MLELLTGR PFD SR
Sbjct  527  SGFADLIPNRESQVS-DEDSGYRAPEVTMSGQYSVKSDVYSFGVVMLELLTGRKPFDRSR  585

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLV WATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQ EPEFRPPMS
Sbjct  586  PRSEQSLVGWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQSEPEFRPPMS  645

Query  360  EVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQE  256
            EVV+ LVRLVQRANM+R   GAD  +  R G +  QE
Sbjct  646  EVVQLLVRLVQRANMTRMC-GADGHSWRRDGESRDQE  681



>ref|NP_974311.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
 gb|AEE75504.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
Length=680

 Score =   222 bits (566),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 124/139 (89%), Gaps = 1/139 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  ++ LNQN   GY APE +MSGQY++KSDVYSFGV MLELLTGR PFDS+R
Sbjct  529  SGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTR  587

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  588  SRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  647

Query  360  EVVEALVRLVQRANMSRRT  304
            EVV+ALV LVQRANMS+RT
Sbjct  648  EVVQALVVLVQRANMSKRT  666



>dbj|BAC10113.1| putative leucine-rich repeat transmembrane protein kinase 2 [Oryza 
sativa Japonica Group]
 dbj|BAC16030.1| putative leucine-rich repeat transmembrane protein kinase 2 [Oryza 
sativa Japonica Group]
 dbj|BAC21507.1| putative leucine-rich repeat transmembrane protein kinase 2 [Oryza 
sativa Japonica Group]
Length=720

 Score =   223 bits (567),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 125/157 (80%), Gaps = 4/157 (3%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SG A LIP+ +  +  +  SGY APEV MSGQY++KSDVYSFGV MLELLTGR PFD SR
Sbjct  564  SGFADLIPNRESQV-SDEDSGYRAPEVTMSGQYSVKSDVYSFGVVMLELLTGRKPFDRSR  622

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLV WATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQ EPEFRPPMS
Sbjct  623  PRSEQSLVGWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQSEPEFRPPMS  682

Query  360  EVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQE  256
            EVV+ LVRLVQRANM+R   GAD  +  R G +  QE
Sbjct  683  EVVQLLVRLVQRANMTRMC-GADGHSWRRDGESRDQE  718



>gb|EEC82450.1| hypothetical protein OsI_26884 [Oryza sativa Indica Group]
Length=720

 Score =   222 bits (566),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 125/157 (80%), Gaps = 4/157 (3%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SG A LIP+ +  +  +  SGY APEV MSGQY++KSDVYSFGV MLELLTGR PFD SR
Sbjct  564  SGFADLIPNRESQV-SDEDSGYRAPEVTMSGQYSVKSDVYSFGVVMLELLTGRKPFDRSR  622

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLV WATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQ EPEFRPPMS
Sbjct  623  PRSEQSLVGWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQSEPEFRPPMS  682

Query  360  EVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQE  256
            EVV+ LVRLVQRANM+R   GAD  +  R G +  QE
Sbjct  683  EVVQLLVRLVQRANMTRMC-GADGHSWRRDGESRDQE  718



>ref|XP_010235400.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X1 [Brachypodium distachyon]
Length=712

 Score =   222 bits (566),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 127/154 (82%), Gaps = 4/154 (3%)
 Frame = -1

Query  720  SGLASLIPDED-QALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            SG A LIP+++ Q   +NS  GY APE+ MSGQY++KSDVYSFGV MLELLTGR PFD S
Sbjct  558  SGYADLIPNQEFQESEENS--GYRAPELTMSGQYSLKSDVYSFGVVMLELLTGRKPFDRS  615

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQ EPEFRPPM
Sbjct  616  RPRSEQSLVRWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQAEPEFRPPM  675

Query  363  SEVVEALVRLVQRANMSRRTFGAD-SRTRSGSAD  265
            SEVV++LVRLVQRAN++R +   + SR  S S D
Sbjct  676  SEVVQSLVRLVQRANITRMSSSENYSRRHSESGD  709



>ref|NP_001060286.1| Os07g0618400 [Oryza sativa Japonica Group]
 dbj|BAF22200.1| Os07g0618400 [Oryza sativa Japonica Group]
Length=732

 Score =   222 bits (566),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 125/157 (80%), Gaps = 4/157 (3%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SG A LIP+ +  +  +  SGY APEV MSGQY++KSDVYSFGV MLELLTGR PFD SR
Sbjct  576  SGFADLIPNRESQV-SDEDSGYRAPEVTMSGQYSVKSDVYSFGVVMLELLTGRKPFDRSR  634

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLV WATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQ EPEFRPPMS
Sbjct  635  PRSEQSLVGWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQSEPEFRPPMS  694

Query  360  EVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQE  256
            EVV+ LVRLVQRANM+R   GAD  +  R G +  QE
Sbjct  695  EVVQLLVRLVQRANMTRMC-GADGHSWRRDGESRDQE  730



>ref|NP_188052.2| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
 sp|Q9LUL4.1|SRF7_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 7; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF7; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01040.1| serine/threonine protein kinase-like protein [Arabidopsis thaliana]
 gb|AAR99875.1| strubbelig receptor family 7 [Arabidopsis thaliana]
 gb|ACI49801.1| At3g14350 [Arabidopsis thaliana]
 gb|ACN59316.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE75505.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
Length=717

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 124/139 (89%), Gaps = 1/139 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  ++ LNQN   GY APE +MSGQY++KSDVYSFGV MLELLTGR PFDS+R
Sbjct  566  SGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTR  624

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  625  SRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  684

Query  360  EVVEALVRLVQRANMSRRT  304
            EVV+ALV LVQRANMS+RT
Sbjct  685  EVVQALVVLVQRANMSKRT  703



>gb|AFQ91933.1| leucine-rich repeat receptor-like kinase [Brassica rapa subsp. 
oleifera]
Length=707

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 125/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  ++ LNQN   GY APEV+MSGQY+++SDVYSFG+ MLELLTGR PFDS+R
Sbjct  568  SGLASFLPTANELLNQND-EGYSAPEVSMSGQYSLQSDVYSFGIVMLELLTGRKPFDSTR  626

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDALSKMVDPAL+GLYPVKSLSRFADVIALCVQPEPEFRPPMS
Sbjct  627  SRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMS  686

Query  360  EVVEALVRLVQRANMSRR  307
            EVV+ALV LVQRANMS+R
Sbjct  687  EVVQALVVLVQRANMSKR  704



>ref|XP_002965192.1| hypothetical protein SELMODRAFT_83158 [Selaginella moellendorffii]
 gb|EFJ34030.1| hypothetical protein SELMODRAFT_83158 [Selaginella moellendorffii]
Length=362

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            + L+S   D   A     + GY APE AMSG YT+KSDVYSFGV MLELLTGR P DSSR
Sbjct  205  AALSSTSSDRQVAAQMLGSFGYSAPEFAMSGVYTVKSDVYSFGVVMLELLTGRKPLDSSR  264

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDALSKMVDPAL+G+YP KSLSRFADVI+ CVQPEPEFRPPMS
Sbjct  265  ARSEQSLVRWATPQLHDIDALSKMVDPALKGIYPAKSLSRFADVISSCVQPEPEFRPPMS  324

Query  360  EVVEALVRLVQRANMSRRTFG  298
            EVV++LVRL+QRA++S+R+ G
Sbjct  325  EVVQSLVRLMQRASLSKRSSG  345



>emb|CDY36601.1| BnaC06g06540D [Brassica napus]
Length=698

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 128/153 (84%), Gaps = 5/153 (3%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLASL+P  +  L   +  GY APEV+MSGQY++KSDVY+FGV MLELLTGR PFDS+R
Sbjct  546  SGLASLLPTANVQLLNQTDEGYSAPEVSMSGQYSMKSDVYTFGVVMLELLTGRKPFDSTR  605

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL GLYPVKSLSRFADVIALCVQ EPEFRPPMS
Sbjct  606  SRSEQSLVRWATPQLHDIDALGKMVDPALEGLYPVKSLSRFADVIALCVQAEPEFRPPMS  665

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADS  262
            EVV++LV LVQRANMS+RT       RSGSAD+
Sbjct  666  EVVQSLVVLVQRANMSKRT-----SKRSGSADA  693



>ref|XP_006449793.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
 gb|ESR63033.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
Length=698

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 120/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     A GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  538  GLAALTPNTERQVSTQMVGAFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  597

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  598  RPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  657

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  658  SEVVQALVRLVQRASVVKR  676



>ref|XP_006449794.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
 gb|ESR63034.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
Length=720

 Score =   220 bits (561),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 120/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     A GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  560  GLAALTPNTERQVSTQMVGAFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  619

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  620  RPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  679

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  680  SEVVQALVRLVQRASVVKR  698



>ref|XP_006467381.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Citrus sinensis]
Length=696

 Score =   220 bits (560),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 120/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     A GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  536  GLAALTPNTERQVSTQMVGAFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  595

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  596  RPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  655

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  656  SEVVQALVRLVQRASVVKR  674



>emb|CDY24077.1| BnaA06g00750D [Brassica napus]
Length=719

 Score =   220 bits (561),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 127/153 (83%), Gaps = 5/153 (3%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  +  L   +  GY APEV+MSGQY++KSDVYSFGV MLELLTGR PFDS+R
Sbjct  567  SGLASFLPTANVQLLNQTDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTR  626

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL GLYPVKSLSRFADVIALCVQ EPEFRPPMS
Sbjct  627  SRAEQSLVRWATPQLHDIDALGKMVDPALEGLYPVKSLSRFADVIALCVQAEPEFRPPMS  686

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADS  262
            EVV++LV LVQRANMS+RT       RSGSAD+
Sbjct  687  EVVQSLVVLVQRANMSKRT-----SKRSGSADA  714



>gb|KDO78347.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=720

 Score =   220 bits (561),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 120/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     A GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  560  GLAALTPNTERQVSTQMVGAFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  619

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  620  RPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  679

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  680  SEVVQALVRLVQRASVVKR  698



>ref|XP_006467380.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Citrus sinensis]
Length=720

 Score =   220 bits (560),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 120/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     A GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  560  GLAALTPNTERQVSTQMVGAFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  619

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  620  RPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  679

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  680  SEVVQALVRLVQRASVVKR  698



>ref|XP_002979973.1| hypothetical protein SELMODRAFT_112070 [Selaginella moellendorffii]
 ref|XP_002991949.1| hypothetical protein SELMODRAFT_186440 [Selaginella moellendorffii]
 gb|EFJ07060.1| hypothetical protein SELMODRAFT_186440 [Selaginella moellendorffii]
 gb|EFJ18843.1| hypothetical protein SELMODRAFT_112070 [Selaginella moellendorffii]
Length=343

 Score =   211 bits (538),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 119/145 (82%), Gaps = 3/145 (2%)
 Frame = -1

Query  717  GLASLIP--DEDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDS  547
            GLA+L P   E Q  +Q   S GY APE AMSG YT+KSDVYSFGV MLELLTGR   DS
Sbjct  180  GLAALAPYGAERQVSSQMLVSFGYSAPEFAMSGVYTVKSDVYSFGVVMLELLTGRKSLDS  239

Query  546  SRPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPP  367
            SR R EQSLVRWA PQLHDIDALS+MVDPAL+G+YP KSLSRFAD+I+ CVQPEPEFRPP
Sbjct  240  SRSRAEQSLVRWAVPQLHDIDALSRMVDPALKGIYPAKSLSRFADIISSCVQPEPEFRPP  299

Query  366  MSEVVEALVRLVQRANMSRRTFGAD  292
            MSEVV+ALVRL+QRA++S+R   AD
Sbjct  300  MSEVVQALVRLMQRASLSKRRLTAD  324



>dbj|BAJ87185.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=597

 Score =   218 bits (555),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 118/138 (86%), Gaps = 3/138 (2%)
 Frame = -1

Query  720  SGLASLIPDED-QALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            SG   LIP+++ Q   +NS  GY APEVAMSGQY++KSDVYSFGV MLELLTGR PFD S
Sbjct  443  SGYGDLIPNQEFQESEENS--GYRAPEVAMSGQYSLKSDVYSFGVVMLELLTGRKPFDRS  500

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWA PQLHDIDAL +MVDPAL+GLY  KSLSRFAD IALCVQ EPEFRPPM
Sbjct  501  RPRSEQSLVRWAAPQLHDIDALDQMVDPALQGLYHSKSLSRFADAIALCVQAEPEFRPPM  560

Query  363  SEVVEALVRLVQRANMSR  310
            SEVV++LVRLVQRANM+R
Sbjct  561  SEVVQSLVRLVQRANMTR  578



>ref|XP_010538738.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Tarenaya 
hassleriana]
Length=701

 Score =   219 bits (559),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 119/141 (84%), Gaps = 3/141 (2%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY  PE A+SG YTIKSDVYSFGV MLELLTGR P DSS
Sbjct  541  GLAALTPNTERQVSTQMVGSFGYSPPEFALSGVYTIKSDVYSFGVVMLELLTGRKPLDSS  600

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPRPEQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD+IALC+QPEPEFRPPM
Sbjct  601  RPRPEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPPM  660

Query  363  SEVVEALVRLVQRAN-MSRRT  304
            SEVV+ LVRLVQRA+ M RRT
Sbjct  661  SEVVQQLVRLVQRASVMKRRT  681



>gb|KJB67279.1| hypothetical protein B456_010G183400 [Gossypium raimondii]
Length=651

 Score =   218 bits (556),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 119/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  491  GLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSS  550

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YPVKSLSRFAD+IALCVQPEPEFRPPM
Sbjct  551  RVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPVKSLSRFADIIALCVQPEPEFRPPM  610

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  611  SEVVQALVRLVQRASVVKR  629



>ref|XP_008355924.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Malus domestica]
Length=719

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 119/140 (85%), Gaps = 2/140 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  560  GLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSS  619

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  620  RSRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  679

Query  363  SEVVEALVRLVQRANMSRRT  304
            SEVV+ALVRLVQRA++ RR+
Sbjct  680  SEVVQALVRLVQRASVVRRS  699



>ref|XP_007026174.1| STRUBBELIG-receptor family 8 isoform 2 [Theobroma cacao]
 gb|EOY28796.1| STRUBBELIG-receptor family 8 isoform 2 [Theobroma cacao]
Length=624

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  464  GLAALTPNTERQVSTQMVGSFGYSAPEFALSGLYTVKSDVYSFGVVMLELLTGRKPLDSS  523

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  524  RTRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  583

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  584  SEVVQALVRLVQRASVVKR  602



>gb|KJB67276.1| hypothetical protein B456_010G183400 [Gossypium raimondii]
Length=710

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 119/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  550  GLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSS  609

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YPVKSLSRFAD+IALCVQPEPEFRPPM
Sbjct  610  RVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPVKSLSRFADIIALCVQPEPEFRPPM  669

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  670  SEVVQALVRLVQRASVVKR  688



>ref|XP_010928424.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Elaeis guineensis]
Length=619

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  457  GLAALTPNTERQVSTEVVGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  516

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  517  RERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  576

Query  363  SEVVEALVRLVQRANMSRRTFG  298
            SEVV+ LVRL+QRA++ RR+ G
Sbjct  577  SEVVQQLVRLMQRASIVRRSSG  598



>ref|XP_010686780.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Beta vulgaris 
subsp. vulgaris]
Length=712

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT KSDVYSFGV MLELLTGR P DSS
Sbjct  552  GLAALTPNTERQVSTQMVGSFGYSAPEFALSGIYTTKSDVYSFGVVMLELLTGRKPLDSS  611

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWA+PQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  612  RPRSEQSLVRWASPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  671

Query  363  SEVVEALVRLVQRANMSRRTFGADS  289
            SEVV+ALVRLVQRA +++R    DS
Sbjct  672  SEVVQALVRLVQRAGVAKRRSSDDS  696



>ref|XP_009357210.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Pyrus x 
bretschneideri]
Length=719

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 119/140 (85%), Gaps = 2/140 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  560  GLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSS  619

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  620  RSRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  679

Query  363  SEVVEALVRLVQRANMSRRT  304
            SEVV+ALVRLVQRA++ RR+
Sbjct  680  SEVVQALVRLVQRASVVRRS  699



>ref|XP_002518426.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
 gb|EEF43813.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
Length=640

 Score =   217 bits (552),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  480  GLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSS  539

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  540  RVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  599

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  600  SEVVQALVRLVQRASVVKR  618



>emb|CDP04441.1| unnamed protein product [Coffea canephora]
Length=721

 Score =   218 bits (554),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 120/140 (86%), Gaps = 3/140 (2%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN---SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDS  547
            GLA+L P+ ++ ++      + GY APE A+SG YTIKSDVYSFGV MLELLTGR P DS
Sbjct  561  GLAALTPNTERQVSSTQMVGSFGYSAPEFALSGIYTIKSDVYSFGVVMLELLTGRKPLDS  620

Query  546  SRPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPP  367
            SRPR EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPP
Sbjct  621  SRPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPP  680

Query  366  MSEVVEALVRLVQRANMSRR  307
            MSEVV+ALVRL+QRA++ +R
Sbjct  681  MSEVVQALVRLMQRASVVKR  700



>ref|XP_008799298.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Phoenix dactylifera]
 ref|XP_008799306.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Phoenix dactylifera]
Length=643

 Score =   216 bits (551),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  481  GLAALTPNTERQVSTEVVGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  540

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  541  RERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  600

Query  363  SEVVEALVRLVQRANMSRRTFG  298
            SEVV+ LVRL+QRA++ RR+ G
Sbjct  601  SEVVQQLVRLMQRASIVRRSSG  622



>ref|XP_009147586.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Brassica rapa]
Length=719

 Score =   218 bits (554),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 126/153 (82%), Gaps = 5/153 (3%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLAS +P  +  L   +  GY A EV+MSGQY++KSDVYSFGV MLELLTGR PFDS+R
Sbjct  567  SGLASFLPTANVQLLNQTDEGYSASEVSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTR  626

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDAL KMVDPAL GLYPVKSLSRFADVIALCVQ EPEFRPPMS
Sbjct  627  SRAEQSLVRWATPQLHDIDALGKMVDPALEGLYPVKSLSRFADVIALCVQAEPEFRPPMS  686

Query  360  EVVEALVRLVQRANMSRRTFGADSRTRSGSADS  262
            EVV++LV LVQRANMS+RT       RSGSAD+
Sbjct  687  EVVQSLVVLVQRANMSKRT-----SKRSGSADT  714



>ref|XP_010539270.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X3 [Tarenaya 
hassleriana]
Length=685

 Score =   217 bits (553),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  525  GLAALTPNTERQVSTQVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSS  584

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALC+QPEPEFRPPM
Sbjct  585  RPRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCIQPEPEFRPPM  644

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ LVRLVQRA++ +R
Sbjct  645  SEVVQQLVRLVQRASVIKR  663



>ref|XP_010539262.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X2 [Tarenaya 
hassleriana]
Length=699

 Score =   217 bits (553),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  539  GLAALTPNTERQVSTQVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSS  598

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALC+QPEPEFRPPM
Sbjct  599  RPRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCIQPEPEFRPPM  658

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ LVRLVQRA++ +R
Sbjct  659  SEVVQQLVRLVQRASVIKR  677



>ref|NP_001119030.1| STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana]
 gb|AEE84561.1| STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana]
Length=562

 Score =   214 bits (546),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 120/146 (82%), Gaps = 2/146 (1%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDS  547
            SGLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVY+FGV MLELLTGR P DS
Sbjct  401  SGLAALTPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTGRKPLDS  460

Query  546  SRPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPP  367
            SR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD+IALC+QPEPEFRPP
Sbjct  461  SRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPP  520

Query  366  MSEVVEALVRLVQRANMSRRTFGADS  289
            MSEVV+ LVRLVQRA++ +R    D+
Sbjct  521  MSEVVQQLVRLVQRASVVKRRSSDDT  546



>ref|XP_010539255.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X1 [Tarenaya 
hassleriana]
Length=702

 Score =   217 bits (553),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  542  GLAALTPNTERQVSTQVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSS  601

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALC+QPEPEFRPPM
Sbjct  602  RPRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCIQPEPEFRPPM  661

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ LVRLVQRA++ +R
Sbjct  662  SEVVQQLVRLVQRASVIKR  680



>ref|XP_007026173.1| STRUBBELIG-receptor family 8 isoform 1 [Theobroma cacao]
 gb|EOY28795.1| STRUBBELIG-receptor family 8 isoform 1 [Theobroma cacao]
Length=719

 Score =   217 bits (553),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  559  GLAALTPNTERQVSTQMVGSFGYSAPEFALSGLYTVKSDVYSFGVVMLELLTGRKPLDSS  618

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  619  RTRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  678

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  679  SEVVQALVRLVQRASVVKR  697



>ref|XP_010928422.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010928423.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Elaeis guineensis]
Length=720

 Score =   217 bits (553),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  558  GLAALTPNTERQVSTEVVGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  617

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  618  RERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  677

Query  363  SEVVEALVRLVQRANMSRRTFG  298
            SEVV+ LVRL+QRA++ RR+ G
Sbjct  678  SEVVQQLVRLMQRASIVRRSSG  699



>ref|XP_008458999.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X2 [Cucumis 
melo]
Length=612

 Score =   215 bits (548),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  452  GLAALTPNTERQISTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  511

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  512  RVRSEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFADIIALCVQPEPEFRPPM  571

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  572  SEVVQALVRLVQRASVVKR  590



>ref|XP_008384096.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Malus domestica]
Length=719

 Score =   217 bits (552),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 120/140 (86%), Gaps = 2/140 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  560  GLAALTPNTERQVSPQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSS  619

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFADVIALCVQPEPEFRPPM
Sbjct  620  RSRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADVIALCVQPEPEFRPPM  679

Query  363  SEVVEALVRLVQRANMSRRT  304
            SEVV+ALVRLVQRA++ RR+
Sbjct  680  SEVVQALVRLVQRASVVRRS  699



>ref|XP_011460016.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Fragaria vesca 
subsp. vesca]
Length=730

 Score =   217 bits (552),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  570  GLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSS  629

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDP+L G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  630  RARSEQSLVRWATPQLHDIDALAKMVDPSLNGMYPAKSLSRFADIIALCVQPEPEFRPPM  689

Query  363  SEVVEALVRLVQRANMSRRTFGADS  289
            SEVV+ALVRLVQRA++++R    DS
Sbjct  690  SEVVQALVRLVQRASVAKRRSSDDS  714



>ref|XP_010244139.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Nelumbo 
nucifera]
Length=729

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE AMSG YT+KSDV+SFGV MLELLTGR P DSS
Sbjct  569  GLAALTPNTERQVSTQMVGSFGYSAPEFAMSGIYTVKSDVHSFGVVMLELLTGRKPLDSS  628

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  629  RVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  688

Query  363  SEVVEALVRLVQRANMSRRTFGADS  289
            SEVV+ALVRL+QRA++ +R    DS
Sbjct  689  SEVVQALVRLMQRASVVKRRLSDDS  713



>ref|XP_010943264.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Elaeis guineensis]
Length=690

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFG+ MLELLTGR P DSS
Sbjct  528  GLAALTPNTERQVSTEMVGSFGYSAPEFAMSGVYTVKSDVYSFGIVMLELLTGRKPLDSS  587

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFADVIALCVQPEPEFRPPM
Sbjct  588  RERSEQSLVRWATPQLHDIDALAKMVDPALNGIYPAKSLSRFADVIALCVQPEPEFRPPM  647

Query  363  SEVVEALVRLVQRANMSRRTFG  298
            SEVV+ LVRL+QRA++ RR+ G
Sbjct  648  SEVVQQLVRLMQRASIVRRSSG  669



>ref|XP_003562663.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X3 [Brachypodium distachyon]
Length=1217

 Score =   220 bits (560),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 127/153 (83%), Gaps = 4/153 (3%)
 Frame = -1

Query  720  SGLASLIPDED-QALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            SG A LIP+++ Q   +NS  GY APE+ MSGQY++KSDVYSFGV MLELLTGR PFD S
Sbjct  566  SGYADLIPNQEFQESEENS--GYRAPELTMSGQYSLKSDVYSFGVVMLELLTGRKPFDRS  623

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQ EPEFRPPM
Sbjct  624  RPRSEQSLVRWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQAEPEFRPPM  683

Query  363  SEVVEALVRLVQRANMSRRTFGAD-SRTRSGSA  268
            SEVV++LVRLVQRAN++R +   + SR  S SA
Sbjct  684  SEVVQSLVRLVQRANITRMSSSENYSRRHSESA  716



>ref|XP_007213628.1| hypothetical protein PRUPE_ppa002088mg [Prunus persica]
 gb|EMJ14827.1| hypothetical protein PRUPE_ppa002088mg [Prunus persica]
Length=718

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  558  GLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSS  617

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  618  RVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  677

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  678  SEVVQALVRLVQRASVVKR  696



>ref|XP_008224758.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Prunus mume]
Length=721

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  561  GLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSS  620

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  621  RVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  680

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  681  SEVVQALVRLVQRASVVKR  699



>ref|XP_010052885.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X3 [Eucalyptus 
grandis]
Length=627

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 118/142 (83%), Gaps = 7/142 (5%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSAS-----GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPF  553
            GLA+L P+ ++   Q SA      GY APE A+SG YT+KSDVYSFGV MLELLTGR P 
Sbjct  466  GLAALTPNTER--QQVSAQMVGQFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPL  523

Query  552  DSSRPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFR  373
            DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFR
Sbjct  524  DSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFR  583

Query  372  PPMSEVVEALVRLVQRANMSRR  307
            PPMSEVV+ LVRLVQRA +S+R
Sbjct  584  PPMSEVVQQLVRLVQRAGISKR  605



>ref|XP_009357487.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Pyrus x 
bretschneideri]
Length=719

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 118/140 (84%), Gaps = 2/140 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P D S
Sbjct  560  GLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDCS  619

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  620  RSRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  679

Query  363  SEVVEALVRLVQRANMSRRT  304
            SEVV+ALVRLVQRA++ RR+
Sbjct  680  SEVVQALVRLVQRASVVRRS  699



>dbj|BAK07184.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=713

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 2/144 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE +MSG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  551  GLAALTPNTERQVSTEVVGSFGYSAPEFSMSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  610

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  611  RERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  670

Query  363  SEVVEALVRLVQRANMSRRTFGAD  292
            SEVV+ LVRL+QRA++ RR  G +
Sbjct  671  SEVVQQLVRLMQRASIVRRQSGEE  694



>gb|KDP20703.1| hypothetical protein JCGZ_21174 [Jatropha curcas]
Length=721

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  561  GLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSS  620

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  621  RVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  680

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  681  SEVVQALVRLVQRASVVKR  699



>ref|XP_010943263.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Elaeis guineensis]
Length=742

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFG+ MLELLTGR P DSS
Sbjct  580  GLAALTPNTERQVSTEMVGSFGYSAPEFAMSGVYTVKSDVYSFGIVMLELLTGRKPLDSS  639

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFADVIALCVQPEPEFRPPM
Sbjct  640  RERSEQSLVRWATPQLHDIDALAKMVDPALNGIYPAKSLSRFADVIALCVQPEPEFRPPM  699

Query  363  SEVVEALVRLVQRANMSRRTFG  298
            SEVV+ LVRL+QRA++ RR+ G
Sbjct  700  SEVVQQLVRLMQRASIVRRSSG  721



>ref|XP_006284970.1| hypothetical protein CARUB_v10006274mg [Capsella rubella]
 gb|EOA17868.1| hypothetical protein CARUB_v10006274mg [Capsella rubella]
Length=705

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 120/146 (82%), Gaps = 2/146 (1%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDS  547
            SGLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVY+FGV MLELLTGR P DS
Sbjct  544  SGLAALTPNTERQVSTQVVGSFGYSAPEFALSGVYTVKSDVYTFGVVMLELLTGRKPLDS  603

Query  546  SRPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPP  367
            SR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD+IALC+QPEPEFRPP
Sbjct  604  SRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPP  663

Query  366  MSEVVEALVRLVQRANMSRRTFGADS  289
            MSEVV+ LVRLVQRA++ +R    DS
Sbjct  664  MSEVVQQLVRLVQRASVVKRRSSDDS  689



>ref|XP_004486188.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Cicer arietinum]
Length=680

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 117/139 (84%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  520  GLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSS  579

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDALSKMVDP L G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  580  RVRSEQSLVRWATPQLHDIDALSKMVDPCLNGMYPAKSLSRFADIIALCVQPEPEFRPPM  639

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  640  SEVVQALVRLVQRASVVKR  658



>ref|XP_010052884.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X2 [Eucalyptus 
grandis]
 gb|KCW77014.1| hypothetical protein EUGRSUZ_D01360 [Eucalyptus grandis]
Length=720

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 117/139 (84%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSAS--GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++       GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  560  GLAALTPNTERQVSAQMVGQFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSS  619

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  620  RVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  679

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ LVRLVQRA +S+R
Sbjct  680  SEVVQQLVRLVQRAGISKR  698



>ref|XP_004164349.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Cucumis 
sativus]
Length=647

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  487  GLAALTPNTERQISTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  546

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  547  RVRSEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFADIIALCVQPEPEFRPPM  606

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  607  SEVVQALVRLVQRASVVKR  625



>ref|XP_010099162.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Morus notabilis]
 gb|EXB77034.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Morus notabilis]
Length=728

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSAS--GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++       GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  568  GLAALTPNTERQVSTQMVGQFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSS  627

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  628  RVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  687

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  688  SEVVQALVRLVQRASVIKR  706



>ref|XP_006435523.1| hypothetical protein CICLE_v10010883mg, partial [Citrus clementina]
 gb|ESR48763.1| hypothetical protein CICLE_v10010883mg, partial [Citrus clementina]
Length=317

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 113/144 (78%), Gaps = 4/144 (3%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLAS      Q  +QN   GY APE      YT+KSDVYSFGV MLELLTGR P+DS +P
Sbjct  171  GLASF----HQRTSQNLGVGYNAPECTRPSAYTVKSDVYSFGVVMLELLTGRMPYDSEKP  226

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            + EQ LVRWA PQLHD DAL+KMVDPALRGLYP KSLSRFADVIALCVQPEPEFRPPMSE
Sbjct  227  KSEQCLVRWAAPQLHDFDALAKMVDPALRGLYPPKSLSRFADVIALCVQPEPEFRPPMSE  286

Query  357  VVEALVRLVQRANMSRRTFGADSR  286
            VVEALVRLVQR++M+ +   A SR
Sbjct  287  VVEALVRLVQRSSMNMKDDLAASR  310



>gb|EEC72655.1| hypothetical protein OsI_06182 [Oryza sativa Indica Group]
Length=718

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 2/144 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  556  GLAALTPNTERQVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  615

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  616  RERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  675

Query  363  SEVVEALVRLVQRANMSRRTFGAD  292
            SEVV+ LVRL+QRA++ RR  G +
Sbjct  676  SEVVQQLVRLMQRASIVRRQSGEE  699



>ref|XP_006648399.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Oryza brachyantha]
Length=720

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 2/144 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  557  GLAALTPNTERQVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  616

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  617  RERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  676

Query  363  SEVVEALVRLVQRANMSRRTFGAD  292
            SEVV+ LVRL+QRA++ RR  G +
Sbjct  677  SEVVQQLVRLMQRASIVRRQSGEE  700



>ref|XP_008799289.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Phoenix dactylifera]
Length=737

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  575  GLAALTPNTERQVSTEVVGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  634

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  635  RERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  694

Query  363  SEVVEALVRLVQRANMSRRTFG  298
            SEVV+ LVRL+QRA++ RR+ G
Sbjct  695  SEVVQQLVRLMQRASIVRRSSG  716



>ref|NP_001046150.1| Os02g0190500 [Oryza sativa Japonica Group]
 dbj|BAD16477.1| putative leucine-rich repeat transmembrane protein kinase [Oryza 
sativa Japonica Group]
 dbj|BAF08064.1| Os02g0190500 [Oryza sativa Japonica Group]
 gb|EEE56479.1| hypothetical protein OsJ_05699 [Oryza sativa Japonica Group]
Length=718

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 2/144 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  556  GLAALTPNTERQVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  615

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  616  RERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  675

Query  363  SEVVEALVRLVQRANMSRRTFGAD  292
            SEVV+ LVRL+QRA++ RR  G +
Sbjct  676  SEVVQQLVRLMQRASIVRRQSGEE  699



>ref|XP_007147687.1| hypothetical protein PHAVU_006G146100g [Phaseolus vulgaris]
 gb|ESW19681.1| hypothetical protein PHAVU_006G146100g [Phaseolus vulgaris]
Length=713

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 120/147 (82%), Gaps = 2/147 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  553  GLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSS  612

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  613  RIRSEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFADIIALCVQPEPEFRPPM  672

Query  363  SEVVEALVRLVQRANMSRRTFGADSRT  283
            SEVV+ALVRLVQRA++ +R    DS T
Sbjct  673  SEVVQALVRLVQRASVVKRRPSDDSGT  699



>ref|XP_008803525.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Phoenix 
dactylifera]
 ref|XP_008803526.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Phoenix 
dactylifera]
Length=739

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFG+ MLELLTGR P DSS
Sbjct  577  GLAALTPNTERQVSTEVVGSFGYSAPEFAMSGVYTVKSDVYSFGIVMLELLTGRKPLDSS  636

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPP+
Sbjct  637  RERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPI  696

Query  363  SEVVEALVRLVQRANMSRRTFG  298
            SEVV+ LVRL+QRA+M RR+ G
Sbjct  697  SEVVQQLVRLMQRASMVRRSSG  718



>dbj|BAD37979.1| putative leucine-rich repeat transmembrane protein kinase 1 [Oryza 
sativa Japonica Group]
 dbj|BAG99301.1| unnamed protein product [Oryza sativa Japonica Group]
Length=558

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 118/144 (82%), Gaps = 2/144 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLELLT R P DSS
Sbjct  397  GLAALTPNPEREVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTARKPLDSS  456

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLV WATPQLHDIDAL+KMVDPA+ G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  457  RERSEQSLVTWATPQLHDIDALAKMVDPAMDGMYPAKSLSRFADIIALCVQPEPEFRPPM  516

Query  363  SEVVEALVRLVQRANMSRRTFGAD  292
            SEVV+ LVRLVQRA+M RR  G D
Sbjct  517  SEVVQQLVRLVQRASMVRRQSGED  540



>ref|XP_010448928.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Camelina 
sativa]
Length=704

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 118/140 (84%), Gaps = 2/140 (1%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDS  547
            SGLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVY+FGV MLELLTGR P DS
Sbjct  543  SGLAALTPNTERQVSTQIVGSFGYSAPEFALSGVYTVKSDVYTFGVVMLELLTGRKPLDS  602

Query  546  SRPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPP  367
            SR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD+IALC+QPEPEFRPP
Sbjct  603  SRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPP  662

Query  366  MSEVVEALVRLVQRANMSRR  307
            MSEVV+ LVRLVQRA++ +R
Sbjct  663  MSEVVQQLVRLVQRASVVKR  682



>ref|XP_008458998.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X1 [Cucumis 
melo]
Length=711

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  551  GLAALTPNTERQISTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  610

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  611  RVRSEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFADIIALCVQPEPEFRPPM  670

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  671  SEVVQALVRLVQRASVVKR  689



>ref|XP_011086205.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Sesamum indicum]
Length=634

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 119/140 (85%), Gaps = 3/140 (2%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN---SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDS  547
            GLA+L P+ ++ ++      + GY APE A+SG YT+KSDVYSFGV MLELLTGR P DS
Sbjct  474  GLAALGPNTERQVSSTQMIGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDS  533

Query  546  SRPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPP  367
            SR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFADVIALCVQPEPEFRPP
Sbjct  534  SRARSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADVIALCVQPEPEFRPP  593

Query  366  MSEVVEALVRLVQRANMSRR  307
            MSEVV+ALVRL+QRA++ +R
Sbjct  594  MSEVVQALVRLMQRASIVKR  613



>ref|XP_011002570.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Populus euphratica]
Length=692

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  532  GLAALTPNTERQVSTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  591

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  592  RVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  651

Query  363  SEVVEALVRLVQRANMSRRTFGADS  289
            SEVV+ALVRLVQRA++ +R    DS
Sbjct  652  SEVVQALVRLVQRASVVKRRPSDDS  676



>ref|XP_010439362.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Camelina sativa]
Length=703

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 120/146 (82%), Gaps = 2/146 (1%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDS  547
            SGLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVY+FGV MLELLTGR P DS
Sbjct  542  SGLAALTPNTERQVSTQIVGSFGYSAPEFALSGVYTVKSDVYTFGVVMLELLTGRKPLDS  601

Query  546  SRPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPP  367
            SR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD+IALC+QPEPEFRPP
Sbjct  602  SRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPP  661

Query  366  MSEVVEALVRLVQRANMSRRTFGADS  289
            MSEVV+ LVRLVQRA++ +R    D+
Sbjct  662  MSEVVQQLVRLVQRASVVKRRSSDDT  687



>ref|XP_004241858.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Solanum 
lycopersicum]
Length=692

 Score =   214 bits (546),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -1

Query  720  SGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            SGLA+L+ D DQ LN N  SGYGAPE A+SG+ T KSDVYSFGV MLEL TGR PFDS+R
Sbjct  548  SGLANLMADVDQGLNHNIESGYGAPEAAISGKCTTKSDVYSFGVVMLELCTGRKPFDSTR  607

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
            PR EQSLVRWATPQLHDIDAL KMVDP+L GLY VKSLSRFADVIALCVQ EPEFRPPMS
Sbjct  608  PRSEQSLVRWATPQLHDIDALEKMVDPSLSGLYSVKSLSRFADVIALCVQLEPEFRPPMS  667

Query  360  EVVEALVRLVQRANMSRRTFGAD  292
            EVV+ LVRLVQRANMS+R    D
Sbjct  668  EVVQVLVRLVQRANMSKRLHNND  690



>ref|XP_004951618.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Setaria 
italica]
Length=720

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 2/144 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  558  GLAALTPNTERQVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  617

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  618  RERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  677

Query  363  SEVVEALVRLVQRANMSRRTFGAD  292
            SEVV+ LVRL+QRA++ RR  G +
Sbjct  678  SEVVQQLVRLMQRASIVRRQSGEE  701



>ref|XP_011002569.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Populus euphratica]
Length=715

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  555  GLAALTPNTERQVSTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  614

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  615  RVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  674

Query  363  SEVVEALVRLVQRANMSRRTFGADS  289
            SEVV+ALVRLVQRA++ +R    DS
Sbjct  675  SEVVQALVRLVQRASVVKRRPSDDS  699



>ref|XP_006383864.1| hypothetical protein POPTR_0004s00710g [Populus trichocarpa]
 gb|ERP61661.1| hypothetical protein POPTR_0004s00710g [Populus trichocarpa]
Length=625

 Score =   213 bits (543),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 117/139 (84%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  465  GLAALTPNTERQVSTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  524

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  525  RVRSEQSLVRWATPQLHDIDALAKMVDPILNGMYPAKSLSRFADIIALCVQPEPEFRPPM  584

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  585  SEVVQALVRLVQRASVVKR  603



>ref|XP_002962278.1| hypothetical protein SELMODRAFT_76873, partial [Selaginella moellendorffii]
 gb|EFJ37538.1| hypothetical protein SELMODRAFT_76873, partial [Selaginella moellendorffii]
Length=673

 Score =   214 bits (545),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRP  538
            GLA+L  +   A     + GY APE AMSG YT+KSDVYSFGV MLELLTGR P DSSR 
Sbjct  517  GLAALRKNWQVAAQMLGSFGYSAPEFAMSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRA  576

Query  537  RPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMSE  358
            R EQSLVRWATPQLHDIDALSKMVDPAL+G+YP KSLSRFADVI+ CVQPEPEFRPPMSE
Sbjct  577  RSEQSLVRWATPQLHDIDALSKMVDPALKGIYPAKSLSRFADVISSCVQPEPEFRPPMSE  636

Query  357  VVEALVRLVQRANMSRRTFG  298
            VV++LVRL+QRA++S+R+ G
Sbjct  637  VVQSLVRLMQRASLSKRSSG  656



>gb|KFK28787.1| hypothetical protein AALP_AA7G048200 [Arabis alpina]
Length=694

 Score =   214 bits (546),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 120/146 (82%), Gaps = 2/146 (1%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDS  547
            SGLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVY+FGV MLELLTGR P DS
Sbjct  533  SGLAALTPNTERQVSTQVVGSFGYSAPEFALSGVYTVKSDVYTFGVVMLELLTGRKPLDS  592

Query  546  SRPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPP  367
            SR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD+IALC+QPEPEFRPP
Sbjct  593  SRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPP  652

Query  366  MSEVVEALVRLVQRANMSRRTFGADS  289
            MSEVV+ LVRLVQRA++ +R    D+
Sbjct  653  MSEVVQQLVRLVQRASVVKRRSSDDT  678



>ref|XP_003571057.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Brachypodium 
distachyon]
Length=715

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 120/144 (83%), Gaps = 2/144 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE +MSG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  553  GLAALTPNTERQVSTEVVGSFGYSAPEYSMSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  612

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  613  RERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  672

Query  363  SEVVEALVRLVQRANMSRRTFGAD  292
            SEVV+ LVRL+QRA++ RR  G +
Sbjct  673  SEVVQQLVRLMQRASIVRRQSGEE  696



>ref|XP_010252506.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Nelumbo 
nucifera]
Length=730

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  570  GLAALTPNTERQVSTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  629

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  630  RVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  689

Query  363  SEVVEALVRLVQRANMSRRTFGADS  289
            SEVV+ALVRL+QRA++ +R    DS
Sbjct  690  SEVVQALVRLMQRASVVKRRSSDDS  714



>ref|XP_004145432.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Cucumis 
sativus]
 gb|KGN66852.1| hypothetical protein Csa_1G701280 [Cucumis sativus]
Length=711

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  551  GLAALTPNTERQISTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  610

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  611  RVRSEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFADIIALCVQPEPEFRPPM  670

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  671  SEVVQALVRLVQRASVVKR  689



>ref|XP_010052883.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X1 [Eucalyptus 
grandis]
 gb|KCW77013.1| hypothetical protein EUGRSUZ_D01360 [Eucalyptus grandis]
Length=721

 Score =   215 bits (547),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 118/142 (83%), Gaps = 7/142 (5%)
 Frame = -1

Query  717  GLASLIPDEDQALNQNSAS-----GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPF  553
            GLA+L P+ ++   Q SA      GY APE A+SG YT+KSDVYSFGV MLELLTGR P 
Sbjct  560  GLAALTPNTER--QQVSAQMVGQFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPL  617

Query  552  DSSRPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFR  373
            DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFR
Sbjct  618  DSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFR  677

Query  372  PPMSEVVEALVRLVQRANMSRR  307
            PPMSEVV+ LVRLVQRA +S+R
Sbjct  678  PPMSEVVQQLVRLVQRAGISKR  699



>ref|XP_006348158.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Solanum 
tuberosum]
Length=724

 Score =   215 bits (547),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 119/140 (85%), Gaps = 3/140 (2%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN---SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDS  547
            GLA+L P+ ++ ++      + GY APE A+SG YT+KSDVYSFGV MLELLTGR P DS
Sbjct  564  GLAALTPNTERQVSSTQMIGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDS  623

Query  546  SRPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPP  367
            SR R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPP
Sbjct  624  SRVRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPP  683

Query  366  MSEVVEALVRLVQRANMSRR  307
            MSEVV+ALVRL+QRA++ +R
Sbjct  684  MSEVVQALVRLMQRASVVKR  703



>ref|XP_004232684.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Solanum lycopersicum]
Length=724

 Score =   215 bits (547),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 119/140 (85%), Gaps = 3/140 (2%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN---SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDS  547
            GLA+L P+ ++ ++      + GY APE A+SG YT+KSDVYSFGV MLELLTGR P DS
Sbjct  564  GLAALTPNTERQVSSTQMIGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDS  623

Query  546  SRPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPP  367
            SR R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPP
Sbjct  624  SRVRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPP  683

Query  366  MSEVVEALVRLVQRANMSRR  307
            MSEVV+ALVRL+QRA++ +R
Sbjct  684  MSEVVQALVRLMQRASVVKR  703



>ref|XP_010434074.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Camelina 
sativa]
Length=703

 Score =   214 bits (546),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 118/140 (84%), Gaps = 2/140 (1%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDS  547
            SGLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVY+FGV MLELLTGR P DS
Sbjct  542  SGLAALTPNTERQVSTQIVGSFGYSAPEFALSGVYTVKSDVYTFGVVMLELLTGRKPLDS  601

Query  546  SRPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPP  367
            SR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD+IALC+QPEPEFRPP
Sbjct  602  SRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPP  661

Query  366  MSEVVEALVRLVQRANMSRR  307
            MSEVV+ LVRLVQRA++ +R
Sbjct  662  MSEVVQQLVRLVQRASVVKR  681



>gb|EMT22844.1| hypothetical protein F775_52608 [Aegilops tauschii]
Length=606

 Score =   213 bits (542),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 120/143 (84%), Gaps = 4/143 (3%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            GLA+L P+ E QA   N+++   APE +MSG YT+KSDVYSFGV MLELLTGR P DSSR
Sbjct  448  GLAALTPNTERQASITNTSN---APEFSMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSR  504

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPMS
Sbjct  505  ERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMS  564

Query  360  EVVEALVRLVQRANMSRRTFGAD  292
            EVV+ LVRL+QRA++ RR  G +
Sbjct  565  EVVQQLVRLMQRASIVRRQSGEE  587



>ref|XP_002267170.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Vitis vinifera]
 emb|CBI32991.3| unnamed protein product [Vitis vinifera]
Length=729

 Score =   214 bits (546),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  569  GLAALTPNTERQVSTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  628

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDP+L G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  629  RVRSEQSLVRWATPQLHDIDALAKMVDPSLNGMYPAKSLSRFADIIALCVQPEPEFRPPM  688

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  689  SEVVQALVRLVQRASVVKR  707



>ref|NP_193944.2| STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana]
 sp|Q6R2J8.1|SRF8_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 8; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF8; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAR99876.1| strubbelig receptor family 8 [Arabidopsis thaliana]
 gb|ACN59345.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE84560.1| STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana]
Length=703

 Score =   214 bits (545),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 120/146 (82%), Gaps = 2/146 (1%)
 Frame = -1

Query  720  SGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDS  547
            SGLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVY+FGV MLELLTGR P DS
Sbjct  542  SGLAALTPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTGRKPLDS  601

Query  546  SRPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPP  367
            SR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD+IALC+QPEPEFRPP
Sbjct  602  SRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPP  661

Query  366  MSEVVEALVRLVQRANMSRRTFGADS  289
            MSEVV+ LVRLVQRA++ +R    D+
Sbjct  662  MSEVVQQLVRLVQRASVVKRRSSDDT  687



>ref|XP_008645353.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Zea mays]
 gb|AFW70555.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=717

 Score =   214 bits (546),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 2/144 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  555  GLAALTPNTERQVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  614

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL++MVDPAL G+YP KSLSRFADVIALCVQPEPEFRPPM
Sbjct  615  RERSEQSLVRWATPQLHDIDALARMVDPALNGMYPAKSLSRFADVIALCVQPEPEFRPPM  674

Query  363  SEVVEALVRLVQRANMSRRTFGAD  292
            SEVV+ LVRL+QRA++ RR  G +
Sbjct  675  SEVVQQLVRLMQRASIVRRQSGEE  698



>gb|EMS51823.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Triticum urartu]
Length=630

 Score =   213 bits (541),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 120/143 (84%), Gaps = 4/143 (3%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSR  541
            GLA+L P+ E QA   N+++   APE +MSG YT+KSDVYSFGV MLELLTGR P DSSR
Sbjct  472  GLAALTPNTERQASITNTSN---APEFSMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSR  528

Query  540  PRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPMS  361
             R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPMS
Sbjct  529  ERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMS  588

Query  360  EVVEALVRLVQRANMSRRTFGAD  292
            EVV+ LVRL+QRA++ RR  G +
Sbjct  589  EVVQQLVRLMQRASIVRRQSGEE  611



>ref|XP_009777766.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Nicotiana sylvestris]
Length=723

 Score =   214 bits (545),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 119/140 (85%), Gaps = 3/140 (2%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN---SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDS  547
            GLA+L P+ ++ ++      + GY APE A+SG YT+KSDVYSFGV MLELLTGR P DS
Sbjct  563  GLAALNPNTERPVSSTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDS  622

Query  546  SRPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPP  367
            SR R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPP
Sbjct  623  SRMRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPP  682

Query  366  MSEVVEALVRLVQRANMSRR  307
            MSEVV+ALVRL+QRA++ +R
Sbjct  683  MSEVVQALVRLMQRASVVKR  702



>gb|EMT07607.1| Protein STRUBBELIG-RECEPTOR FAMILY 7 [Aegilops tauschii]
Length=1220

 Score =   218 bits (554),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 124/148 (84%), Gaps = 4/148 (3%)
 Frame = -1

Query  720  SGLASLIPDED-QALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            SG   LIP+++ Q   +NS  GY APEVAMSGQY++KSDVYSFGV MLELLTGR PFD S
Sbjct  571  SGYGDLIPNQEFQESEENS--GYRAPEVAMSGQYSLKSDVYSFGVVMLELLTGRKPFDRS  628

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            RPR EQSLVRWA PQLHDIDAL +MVDPAL+GLY  KSLSRFAD IALCVQ EPEFRPPM
Sbjct  629  RPRSEQSLVRWAAPQLHDIDALDQMVDPALQGLYHSKSLSRFADAIALCVQAEPEFRPPM  688

Query  363  SEVVEALVRLVQRANMSRRTFGADSRTR  280
            SEVV++LVRLVQRANM+R +  ++S TR
Sbjct  689  SEVVQSLVRLVQRANMTRMS-SSESYTR  715



>ref|XP_001783845.1| predicted protein [Physcomitrella patens]
 gb|EDQ51335.1| predicted protein, partial [Physcomitrella patens]
Length=700

 Score =   214 bits (544),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 123/156 (79%), Gaps = 3/156 (2%)
 Frame = -1

Query  717  GLASLIP---DEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDS  547
            G+A+L P   D   +     + GY APE AMSG YT+KSDVYSFGV MLELLTGR P DS
Sbjct  537  GIAALTPLGSDRQVSTQMLGSFGYSAPEYAMSGIYTVKSDVYSFGVVMLELLTGRKPLDS  596

Query  546  SRPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPP  367
            +R R EQSLVRWATPQLHDIDAL+KMVDPAL+G+YP KSLSRFAD+IALCVQPEPEFRP 
Sbjct  597  TRLRAEQSLVRWATPQLHDIDALAKMVDPALKGIYPAKSLSRFADIIALCVQPEPEFRPV  656

Query  366  MSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQ  259
            MSEVV+ALVRL+QRA++++R  G D    + S D Q
Sbjct  657  MSEVVQALVRLMQRASLNKRRSGDDLGASNRSMDRQ  692



>ref|XP_011046989.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Populus 
euphratica]
Length=711

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 117/139 (84%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  551  GLAALTPNTERQVSTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  610

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  611  RVRSEQSLVRWATPQLHDIDALAKMVDPTLNGIYPAKSLSRFADIIALCVQPEPEFRPPM  670

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  671  SEVVQALVRLVQRASVVKR  689



>ref|XP_002451696.1| hypothetical protein SORBIDRAFT_04g006110 [Sorghum bicolor]
 gb|EES04672.1| hypothetical protein SORBIDRAFT_04g006110 [Sorghum bicolor]
Length=716

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 120/144 (83%), Gaps = 2/144 (1%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  554  GLAALTPNTERQVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  613

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL++MVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  614  RERSEQSLVRWATPQLHDIDALARMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  673

Query  363  SEVVEALVRLVQRANMSRRTFGAD  292
            SEVV+ LVRL+QRA++ RR  G +
Sbjct  674  SEVVQQLVRLMQRASIVRRQSGEE  697



>ref|XP_009613682.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Nicotiana tomentosiformis]
Length=725

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 119/140 (85%), Gaps = 3/140 (2%)
 Frame = -1

Query  717  GLASLIPDEDQALNQN---SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDS  547
            GLA+L P+ ++ ++      + GY APE A+SG YT+KSDVYSFGV MLELLTGR P DS
Sbjct  565  GLAALNPNTERPVSSTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDS  624

Query  546  SRPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPP  367
            SR R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPP
Sbjct  625  SRMRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPP  684

Query  366  MSEVVEALVRLVQRANMSRR  307
            MSEVV+ALVRL+QRA++ +R
Sbjct  685  MSEVVQALVRLMQRASVVKR  704



>ref|XP_006586762.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Glycine 
max]
 gb|KHN40858.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Glycine soja]
Length=711

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 117/139 (84%), Gaps = 2/139 (1%)
 Frame = -1

Query  717  GLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSS  544
            GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR P DSS
Sbjct  551  GLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSS  610

Query  543  RPRPEQSLVRWATPQLHDIDALSKMVDPALRGLYPVKSLSRFADVIALCVQPEPEFRPPM  364
            R R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD+IALCVQPEPEFRPPM
Sbjct  611  RVRSEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFADIIALCVQPEPEFRPPM  670

Query  363  SEVVEALVRLVQRANMSRR  307
            SEVV+ALVRLVQRA++ +R
Sbjct  671  SEVVQALVRLVQRASVVKR  689



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273595176425