BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF024I10

Length=747
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006357255.1|  PREDICTED: conserved oligomeric Golgi comple...    353   2e-112   Solanum tuberosum [potatoes]
ref|XP_009786961.1|  PREDICTED: conserved oligomeric Golgi comple...    351   2e-111   Nicotiana sylvestris
ref|XP_004238762.1|  PREDICTED: conserved oligomeric Golgi comple...    350   5e-111   Solanum lycopersicum
gb|KDP22425.1|  hypothetical protein JCGZ_26256                         347   6e-110   Jatropha curcas
ref|XP_009625424.1|  PREDICTED: conserved oligomeric Golgi comple...    346   2e-109   Nicotiana tomentosiformis
gb|AIU51136.1|  embryo yellow protein                                   345   3e-109   Prunus persica
ref|XP_008234406.1|  PREDICTED: conserved oligomeric Golgi comple...    345   4e-109   Prunus mume [ume]
ref|XP_007218916.1|  hypothetical protein PRUPE_ppa001391mg             345   4e-109   Prunus persica
ref|XP_011033997.1|  PREDICTED: conserved oligomeric Golgi comple...    345   6e-109   Populus euphratica
gb|AIU51140.1|  embryo yellow protein                                   344   7e-109   Ricinus communis
ref|XP_002510953.1|  conserved hypothetical protein                     344   7e-109   Ricinus communis
ref|XP_010089680.1|  hypothetical protein L484_001268                   343   2e-108   Morus notabilis
ref|XP_002304412.2|  conserved oligomeric Golgi complex component...    343   3e-108   
gb|AIU51131.1|  embryo yellow protein                                   342   3e-108   Manihot esculenta [manioc]
ref|XP_011076371.1|  PREDICTED: conserved oligomeric Golgi comple...    342   4e-108   Sesamum indicum [beniseed]
ref|XP_009372929.1|  PREDICTED: conserved oligomeric Golgi comple...    337   4e-108   
ref|XP_002267657.1|  PREDICTED: conserved oligomeric Golgi comple...    341   1e-107   Vitis vinifera
emb|CDP05334.1|  unnamed protein product                                340   3e-107   Coffea canephora [robusta coffee]
gb|KHG21476.1|  Conserved oligomeric Golgi complex subunit 7            328   5e-107   Gossypium arboreum [tree cotton]
ref|XP_004307803.1|  PREDICTED: conserved oligomeric Golgi comple...    339   1e-106   Fragaria vesca subsp. vesca
ref|XP_007131467.1|  hypothetical protein PHAVU_011G016000g             338   2e-106   Phaseolus vulgaris [French bean]
gb|AIU51138.1|  embryo yellow protein                                   338   2e-106   Phaseolus vulgaris [French bean]
ref|XP_009340575.1|  PREDICTED: conserved oligomeric Golgi comple...    337   4e-106   Pyrus x bretschneideri [bai li]
ref|XP_007038383.1|  Oligomeric Golgi complex component-related /...    337   5e-106   
gb|AIU51110.1|  embryo yellow protein                                   337   5e-106   Theobroma cacao [chocolate]
ref|XP_008376080.1|  PREDICTED: conserved oligomeric Golgi comple...    337   5e-106   
ref|XP_003534367.1|  PREDICTED: conserved oligomeric Golgi comple...    337   5e-106   Glycine max [soybeans]
gb|AIU51119.1|  embryo yellow protein                                   337   6e-106   Glycine max [soybeans]
gb|AIU51115.1|  embryo yellow protein                                   337   6e-106   Carica papaya [mamon]
gb|KHN11738.1|  Conserved oligomeric Golgi complex subunit 7            337   6e-106   Glycine soja [wild soybean]
ref|XP_009374477.1|  PREDICTED: conserved oligomeric Golgi comple...    335   2e-105   Pyrus x bretschneideri [bai li]
gb|EYU24953.1|  hypothetical protein MIMGU_mgv1a001327mg                335   4e-105   Erythranthe guttata [common monkey flower]
gb|KHN46499.1|  Conserved oligomeric Golgi complex subunit 7            335   4e-105   Glycine soja [wild soybean]
gb|AIU51125.1|  embryo yellow protein                                   334   6e-105   Chimonanthus praecox [wintersweet]
gb|AIU51152.1|  embryo yellow protein                                   334   8e-105   Platanus x hispanica [London plane tree]
ref|XP_006490119.1|  PREDICTED: conserved oligomeric Golgi comple...    332   3e-104   Citrus sinensis [apfelsine]
gb|KDO65493.1|  hypothetical protein CISIN_1g003266mg                   332   3e-104   Citrus sinensis [apfelsine]
gb|AIU51106.1|  embryo yellow protein                                   331   6e-104   Magnolia denudata [haku-mokuren]
gb|AIU51123.1|  embryo yellow protein                                   323   1e-103   Chloranthus japonicus
gb|AIU51151.1|  embryo yellow protein                                   330   2e-103   Cinnamomum camphora
gb|AIU51111.1|  embryo yellow protein                                   330   2e-103   Acorus calamus [flagroot]
ref|XP_006421663.1|  hypothetical protein CICLE_v10004313mg             330   3e-103   Citrus clementina [clementine]
gb|AIU51126.1|  embryo yellow protein                                   319   5e-103   Pandanus utilis
gb|AIU51147.1|  embryo yellow protein                                   328   1e-102   Schrenkiella parvula
gb|AIU51114.1|  embryo yellow protein                                   328   1e-102   Gossypium raimondii
emb|CDY00472.1|  BnaA10g08010D                                          310   1e-102   
gb|AIU51103.1|  embryo yellow protein                                   327   2e-102   Arabidopsis lyrata [lyrate rockcress]
gb|KEH17632.1|  oligomeric component-related/COG complex component      327   3e-102   Medicago truncatula
gb|AIU51121.1|  embryo yellow protein                                   327   3e-102   Buxus sinica
gb|AIU51104.1|  embryo yellow protein                                   327   4e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010062289.1|  PREDICTED: conserved oligomeric Golgi comple...    324   4e-102   Eucalyptus grandis [rose gum]
gb|AIU51116.1|  embryo yellow protein                                   326   9e-102   Capsella rubella
ref|XP_004506344.1|  PREDICTED: conserved oligomeric Golgi comple...    326   1e-101   Cicer arietinum [garbanzo]
gb|AIU51108.1|  embryo yellow protein                                   325   2e-101   Pinellia ternata
ref|XP_010692941.1|  PREDICTED: conserved oligomeric Golgi comple...    325   2e-101   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010062284.1|  PREDICTED: conserved oligomeric Golgi comple...    324   3e-101   Eucalyptus grandis [rose gum]
gb|AIU51112.1|  embryo yellow protein                                   324   5e-101   Sarcandra glabra
ref|XP_002865861.1|  hypothetical protein ARALYDRAFT_495214             324   5e-101   
ref|XP_006401980.1|  hypothetical protein EUTSA_v10012691mg             323   6e-101   Eutrema salsugineum [saltwater cress]
ref|NP_199956.1|  COG7-like protein EYE                                 323   1e-100   Arabidopsis thaliana [mouse-ear cress]
gb|AIU51128.1|  embryo yellow protein                                   323   1e-100   Aristolochia tagala
dbj|BAF00649.1|  hypothetical protein                                   323   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008439087.1|  PREDICTED: conserved oligomeric Golgi comple...    323   1e-100   Cucumis melo [Oriental melon]
ref|XP_004148143.1|  PREDICTED: conserved oligomeric Golgi comple...    322   2e-100   Cucumis sativus [cucumbers]
ref|XP_004165037.1|  PREDICTED: conserved oligomeric Golgi comple...    322   2e-100   
ref|XP_006280007.1|  hypothetical protein CARUB_v10025880mg             322   2e-100   Capsella rubella
ref|XP_010443240.1|  PREDICTED: conserved oligomeric Golgi comple...    322   4e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010482477.1|  PREDICTED: conserved oligomeric Golgi comple...    322   4e-100   Camelina sativa [gold-of-pleasure]
dbj|BAG15881.1|  conserved oligomeric Golgi complex component 7-r...    320   9e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010934963.1|  PREDICTED: conserved oligomeric Golgi comple...    320   1e-99    Elaeis guineensis
gb|AIU51105.1|  embryo yellow protein                                   310   1e-99    Lilium brownii [Hong Kong lily]
ref|XP_006838140.1|  hypothetical protein AMTR_s00106p00086320          319   2e-99    Amborella trichopoda
ref|NP_001132532.1|  uncharacterized protein LOC100193995               305   3e-99    
gb|AIU51143.1|  embryo yellow protein                                   318   4e-99    Yucca filamentosa [Adam's-needle]
ref|XP_008796946.1|  PREDICTED: conserved oligomeric Golgi comple...    318   4e-99    Phoenix dactylifera
ref|XP_003618191.1|  Conserved oligomeric Golgi complex subunit         318   5e-99    Medicago truncatula
gb|AIU51129.1|  embryo yellow protein                                   318   5e-99    Medicago truncatula
gb|KFK26748.1|  hypothetical protein AALP_AA8G288200                    318   6e-99    Arabis alpina [alpine rockcress]
ref|XP_010442640.1|  PREDICTED: conserved oligomeric Golgi comple...    314   9e-99    Camelina sativa [gold-of-pleasure]
gb|AIU51154.1|  embryo yellow protein                                   318   9e-99    Houttuynia cordata [chameleon-plant]
ref|XP_006657236.1|  PREDICTED: conserved oligomeric Golgi comple...    317   2e-98    Oryza brachyantha
gb|AIU51127.1|  embryo yellow protein                                   317   2e-98    Asparagus officinalis
ref|XP_009127310.1|  PREDICTED: conserved oligomeric Golgi comple...    317   3e-98    Brassica rapa
ref|XP_010264264.1|  PREDICTED: conserved oligomeric Golgi comple...    317   3e-98    Nelumbo nucifera [Indian lotus]
ref|XP_010536539.1|  PREDICTED: conserved oligomeric Golgi comple...    316   4e-98    Tarenaya hassleriana [spider flower]
ref|XP_003563389.1|  PREDICTED: conserved oligomeric Golgi comple...    315   9e-98    
gb|EMS57916.1|  hypothetical protein TRIUR3_24838                       312   9e-98    Triticum urartu
gb|EMT03910.1|  hypothetical protein F775_26031                         312   1e-97    
gb|AIU51102.1|  embryo yellow protein                                   314   2e-97    Aquilegia coerulea [Rocky Mountain columbine]
gb|AIU51109.1|  embryo yellow protein                                   313   2e-97    Brachypodium distachyon [annual false brome]
gb|EEE66191.1|  hypothetical protein OsJ_22310                          313   4e-97    Oryza sativa Japonica Group [Japonica rice]
gb|AIU51130.1|  embryo yellow protein                                   313   4e-97    Canna indica [canna]
gb|EEC81147.1|  hypothetical protein OsI_24056                          313   5e-97    Oryza sativa Indica Group [Indian rice]
gb|AIU51142.1|  embryo yellow protein                                   313   5e-97    Dioscorea oppositifolia
gb|AIU51157.1|  embryo yellow protein                                   312   1e-96    Trachycarpus fortunei
ref|XP_009399332.1|  PREDICTED: conserved oligomeric Golgi comple...    311   1e-96    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD45448.1|  oligomeric golgi complex 7-like                        312   2e-96    Oryza sativa Japonica Group [Japonica rice]
gb|AIU51107.1|  embryo yellow protein                                   311   3e-96    Musa acuminata [banana]
emb|CDX99921.1|  BnaC09g27840D                                          306   4e-96    
ref|XP_009107451.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    311   4e-96    
ref|XP_002438832.1|  hypothetical protein SORBIDRAFT_10g026850          310   4e-96    Sorghum bicolor [broomcorn]
gb|AIU51137.1|  embryo yellow protein                                   310   1e-95    Panicum virgatum
gb|AIU51153.1|  embryo yellow protein                                   309   2e-95    Ginkgo biloba [ginkgo]
dbj|BAJ95800.1|  predicted protein                                      309   2e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94393.1|  predicted protein                                      309   2e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIU51146.1|  embryo yellow protein                                   308   3e-95    Sorghum bicolor [broomcorn]
gb|AIU51149.1|  embryo yellow protein                                   307   1e-94    Lactuca sativa [cultivated lettuce]
ref|XP_004966309.1|  PREDICTED: conserved oligomeric Golgi comple...    306   2e-94    Setaria italica
ref|XP_008658135.1|  PREDICTED: uncharacterized protein LOC100193...    306   2e-94    
gb|AIU51155.1|  embryo yellow protein                                   304   1e-93    Zea mays [maize]
gb|AIU51144.1|  embryo yellow protein                                   304   1e-93    Setaria italica
gb|AIU51124.1|  embryo yellow protein                                   302   8e-93    Ceratophyllum demersum [hornwort]
gb|AIU51156.1|  embryo yellow protein                                   298   2e-91    Alisma plantago-aquatica
gb|AIU51150.1|  embryo yellow protein                                   298   2e-91    Ceratophyllum platyacanthum subsp. oryzetorum
ref|XP_003618197.1|  Conserved oligomeric Golgi complex subunit         291   3e-89    
gb|AIU51158.1|  embryo yellow protein                                   291   5e-89    Cabomba caroliniana
gb|EPS73811.1|  hypothetical protein M569_00940                         278   8e-84    Genlisea aurea
ref|XP_002992562.1|  hypothetical protein SELMODRAFT_135591             226   8e-65    
ref|XP_002972505.1|  hypothetical protein SELMODRAFT_148467             226   1e-64    
emb|CDY56655.1|  BnaA02g11250D                                          224   3e-64    Brassica napus [oilseed rape]
emb|CDY00475.1|  BnaA10g07980D                                          223   1e-63    
emb|CDX91578.1|  BnaC02g15820D                                          223   2e-63    
ref|XP_001770876.1|  predicted protein                                  207   7e-58    
gb|AIU51139.1|  embryo yellow protein                                   177   2e-52    Artemisia annua [sweet Annie]
ref|XP_008376425.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    175   6e-47    
ref|NP_001058323.2|  Os06g0669600                                       155   2e-43    
ref|XP_006491716.1|  PREDICTED: uncharacterized protein LOC102619662    165   1e-42    
ref|XP_001418731.1|  predicted protein                                  131   7e-31    Ostreococcus lucimarinus CCE9901
gb|AIU51120.1|  embryo yellow protein                                   130   1e-30    Illicium henryi
ref|XP_003080398.1|  conserved oligomeric Golgi complex component...    120   5e-28    
emb|CEF98773.1|  Conserved oligomeric Golgi complex subunit 7           120   4e-27    Ostreococcus tauri
ref|XP_007513783.1|  predicted protein                                  114   9e-25    Bathycoccus prasinos
ref|XP_002503576.1|  predicted protein                                  112   2e-24    Micromonas commoda
ref|XP_003055554.1|  predicted protein                                  112   3e-24    Micromonas pusilla CCMP1545
emb|CBI21190.3|  unnamed protein product                                103   1e-23    Vitis vinifera
ref|XP_002731007.1|  PREDICTED: conserved oligomeric Golgi comple...  99.4    3e-21    Saccoglossus kowalevskii
ref|XP_005847546.1|  hypothetical protein CHLNCDRAFT_133750             102   7e-21    Chlorella variabilis
ref|XP_005643872.1|  hypothetical protein COCSUDRAFT_67854            94.4    3e-18    Coccomyxa subellipsoidea C-169
ref|XP_001701937.1|  component of oligomeric golgi complex 7          94.4    3e-18    Chlamydomonas reinhardtii
ref|XP_797564.3|  PREDICTED: conserved oligomeric Golgi complex s...  87.4    9e-17    
gb|EKC24157.1|  Conserved oligomeric Golgi complex subunit 7          89.7    1e-16    Crassostrea gigas
ref|XP_011431811.1|  PREDICTED: conserved oligomeric Golgi comple...  89.7    1e-16    Crassostrea gigas
ref|XP_005105726.1|  PREDICTED: conserved oligomeric Golgi comple...  88.2    3e-16    Aplysia californica
ref|XP_786237.3|  PREDICTED: conserved oligomeric Golgi complex s...  88.2    4e-16    Strongylocentrotus purpuratus [purple urchin]
gb|EFA86654.1|  oligomeric Golgi complex component                    87.4    7e-16    Heterostelium album PN500
ref|XP_011402672.1|  PREDICTED: conserved oligomeric Golgi comple...  86.7    8e-16    
ref|XP_009062761.1|  hypothetical protein LOTGIDRAFT_194952           82.4    2e-14    Lottia gigantea
ref|XP_001844946.1|  conserved hypothetical protein                   82.4    3e-14    Culex quinquefasciatus
gb|ELT88100.1|  hypothetical protein CAPTEDRAFT_161050                80.5    1e-13    Capitella teleta
ref|XP_004206189.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    1e-13    
ref|XP_002407978.1|  conserved oligomeric golgi complex subunit, ...  80.1    2e-13    Ixodes scapularis [blacklegged tick]
emb|CDS12214.1|  hypothetical protein LRAMOSA04409                    77.8    9e-13    Lichtheimia ramosa
ref|XP_006682175.1|  hypothetical protein BATDEDRAFT_27828            77.0    1e-12    Batrachochytrium dendrobatidis JAM81
ref|XP_005825555.1|  oligomeric Golgi complex subunit 7               76.6    2e-12    Guillardia theta CCMP2712
ref|XP_004535745.1|  PREDICTED: conserved oligomeric Golgi comple...  76.3    2e-12    
ref|XP_003703617.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    4e-12    
ref|XP_011299085.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    7e-12    Fopius arisanus
ref|XP_002109935.1|  hypothetical protein TRIADDRAFT_53345            74.7    8e-12    Trichoplax adhaerens
ref|XP_011299078.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    8e-12    Fopius arisanus
ref|XP_011299070.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    8e-12    Fopius arisanus
ref|XP_006872058.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    8e-12    Chrysochloris asiatica
dbj|GAM17697.1|  hypothetical protein SAMD00019534_008720             74.3    9e-12    Acytostelium subglobosum LB1
ref|XP_004080382.1|  PREDICTED: conserved oligomeric Golgi comple...  74.3    1e-11    Oryzias latipes [Japanese rice fish]
ref|XP_006637161.1|  PREDICTED: conserved oligomeric Golgi comple...  74.3    1e-11    Lepisosteus oculatus
ref|XP_007571518.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    2e-11    Poecilia formosa
ref|XP_006892752.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    2e-11    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_005810284.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    2e-11    Xiphophorus maculatus
ref|XP_003490215.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    2e-11    
ref|XP_004706118.1|  PREDICTED: conserved oligomeric Golgi comple...  73.2    2e-11    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_003397366.1|  PREDICTED: conserved oligomeric Golgi comple...  73.2    2e-11    Bombus terrestris [large earth bumblebee]
ref|XP_007951381.1|  PREDICTED: conserved oligomeric Golgi comple...  72.4    4e-11    Orycteropus afer afer
ref|XP_006003103.1|  PREDICTED: conserved oligomeric Golgi comple...  72.4    5e-11    Latimeria chalumnae
gb|EPY74529.1|  conserved oligomeric Golgi complex subunit 7-like...  72.4    5e-11    Camelus ferus
ref|XP_006193181.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    5e-11    Camelus ferus
ref|XP_010985221.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    5e-11    Camelus dromedarius [camel]
ref|XP_010959320.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    6e-11    Camelus bactrianus [camel]
gb|KDR16116.1|  Conserved oligomeric Golgi complex subunit 7          71.6    7e-11    Zootermopsis nevadensis
ref|XP_004373515.1|  PREDICTED: conserved oligomeric Golgi comple...  71.6    7e-11    Trichechus manatus latirostris
ref|XP_003418948.1|  PREDICTED: conserved oligomeric Golgi comple...  71.6    7e-11    Loxodonta africana [African bush elephant]
ref|XP_011340196.1|  PREDICTED: conserved oligomeric Golgi comple...  71.6    8e-11    
ref|XP_007058642.1|  PREDICTED: conserved oligomeric Golgi comple...  71.6    9e-11    Chelonia mydas [green seaturtle]
gb|EFZ22757.1|  hypothetical protein SINV_01051                       71.6    9e-11    
ref|XP_008434639.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    9e-11    Poecilia reticulata
ref|XP_006125865.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  71.2    9e-11    
ref|XP_011340195.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    9e-11    
ref|XP_011159533.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    9e-11    Solenopsis invicta [imported red fire ant]
ref|XP_005288959.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    1e-10    Chrysemys picta bellii
ref|XP_002953697.1|  component of oligomeric golgi complex 7          71.2    1e-10    Volvox carteri f. nagariensis
ref|XP_004604166.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    1e-10    Sorex araneus [Eurasian shrew]
ref|XP_003961343.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    2e-10    Takifugu rubripes [tiger puffer]
gb|ENN72949.1|  hypothetical protein YQE_10420                        68.6    2e-10    Dendroctonus ponderosae
ref|XP_007571524.1|  PREDICTED: conserved oligomeric Golgi comple...  70.5    2e-10    Poecilia formosa
ref|XP_007571519.1|  PREDICTED: conserved oligomeric Golgi comple...  70.5    2e-10    Poecilia formosa
ref|XP_001652664.1|  AAEL007307-PA                                    70.5    2e-10    
ref|XP_009194445.1|  PREDICTED: conserved oligomeric Golgi comple...  70.1    2e-10    
gb|ABC86343.1|  IP14069p                                              68.6    2e-10    Drosophila melanogaster
ref|XP_004360949.1|  oligomeric Golgi complex component               70.1    2e-10    Cavenderia fasciculata
ref|XP_006201263.1|  PREDICTED: conserved oligomeric Golgi comple...  70.1    2e-10    Vicugna pacos
ref|XP_008150973.1|  PREDICTED: conserved oligomeric Golgi comple...  70.1    3e-10    Eptesicus fuscus
ref|XP_003341699.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  69.7    3e-10    Monodelphis domestica
ref|XP_006623839.1|  PREDICTED: conserved oligomeric Golgi comple...  69.7    3e-10    Apis dorsata [rock honeybee]
ref|XP_006623838.1|  PREDICTED: conserved oligomeric Golgi comple...  69.7    3e-10    Apis dorsata [rock honeybee]
ref|XP_004398866.1|  PREDICTED: conserved oligomeric Golgi comple...  69.7    3e-10    Odobenus rosmarus divergens
ref|XP_003691700.1|  PREDICTED: conserved oligomeric Golgi comple...  69.7    4e-10    
ref|XP_008695386.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  69.7    4e-10    Ursus maritimus [white bear]
ref|XP_004442758.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    4e-10    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_394713.2|  PREDICTED: conserved oligomeric Golgi complex s...  69.3    4e-10    
ref|XP_002927171.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    5e-10    Ailuropoda melanoleuca
ref|XP_004268622.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    5e-10    Orcinus orca [Orca]
ref|XP_011068677.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    5e-10    Acromyrmex echinatior
gb|EGI69206.1|  Conserved oligomeric Golgi complex subunit 7          68.9    6e-10    Acromyrmex echinatior
ref|XP_010903275.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    6e-10    Esox lucius
gb|ELK37852.1|  Conserved oligomeric Golgi complex subunit 7          68.9    6e-10    Myotis davidii
ref|XP_004900783.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    6e-10    
ref|XP_004855999.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    6e-10    Heterocephalus glaber [naked mole rat]
ref|XP_007516677.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    6e-10    
ref|XP_006753680.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    6e-10    
ref|NP_001029061.1|  conserved oligomeric Golgi complex subunit 7     68.6    7e-10    Rattus norvegicus [brown rat]
ref|XP_007615834.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    7e-10    
ref|XP_007105719.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    7e-10    Physeter catodon
ref|XP_007233023.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    7e-10    
ref|XP_007450043.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    8e-10    Lipotes vexillifer [baiji]
gb|EPQ17692.1|  Conserved oligomeric Golgi complex subunit 7          68.6    8e-10    Myotis brandtii
gb|ERL93874.1|  hypothetical protein D910_11160                       68.6    8e-10    Dendroctonus ponderosae
ref|XP_004453849.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    8e-10    Dasypus novemcinctus
ref|XP_010184345.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    8e-10    Mesitornis unicolor
gb|ERE78144.1|  conserved oligomeric Golgi complex subunit 7          68.6    8e-10    Cricetulus griseus [Chinese hamsters]
ref|XP_004691773.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    8e-10    Condylura cristata
ref|XP_005882395.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    8e-10    
ref|XP_004670260.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    9e-10    Jaculus jaculus
ref|XP_001510180.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    9e-10    
gb|EDL17254.1|  component of oligomeric golgi complex 7               68.2    9e-10    Mus musculus [mouse]
ref|XP_005351192.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    9e-10    Microtus ochrogaster [prairie voles]
ref|XP_003795773.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    9e-10    Otolemur garnettii
ref|XP_006912615.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09    
ref|XP_004778381.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09    Mustela putorius furo [black ferret]
sp|Q3UM29.1|COG7_MOUSE  RecName: Full=Conserved oligomeric Golgi ...  68.2    1e-09    Mus musculus [mouse]
ref|XP_006085923.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09    
ref|XP_005405157.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09    
ref|XP_005405155.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09    
ref|NP_001028490.2|  conserved oligomeric Golgi complex subunit 7     68.2    1e-09    Mus musculus [mouse]
ref|XP_006808092.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09    Neolamprologus brichardi [lyretail cichlid]
ref|XP_006085922.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09    
ref|XP_005405156.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09    
gb|ELK12106.1|  Conserved oligomeric Golgi complex subunit 7          67.8    1e-09    Pteropus alecto
ref|XP_005405154.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09    
gb|AAQ88995.1|  COG7                                                  67.8    1e-09    Homo sapiens [man]
ref|XP_003261698.2|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09    
ref|XP_005063464.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09    
ref|XP_003513853.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09    Cricetulus griseus [Chinese hamsters]
ref|XP_007986068.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09    Chlorocebus sabaeus
ref|XP_011264701.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09    
ref|XP_006980401.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09    Peromyscus maniculatus bairdii
ref|XP_011264700.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09    
ref|XP_006027196.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09    Alligator sinensis
ref|XP_536935.3|  PREDICTED: conserved oligomeric Golgi complex s...  67.8    1e-09    Canis lupus familiaris [dogs]
ref|XP_004622945.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09    Octodon degus
emb|CDQ66102.1|  unnamed protein product                              67.8    2e-09    Oncorhynchus mykiss
ref|XP_009428772.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    Pan troglodytes
ref|XP_005255738.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    
ref|XP_510875.2|  PREDICTED: conserved oligomeric Golgi complex s...  67.4    2e-09    Pan troglodytes
dbj|BAG52793.1|  unnamed protein product                              67.4    2e-09    Homo sapiens [man]
ref|XP_006730882.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    Leptonychotes weddellii
ref|XP_002293816.1|  predicted protein                                63.9    2e-09    Thalassiosira pseudonana CCMP1335
ref|XP_010339086.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    Saimiri boliviensis boliviensis
ref|NP_705831.1|  conserved oligomeric Golgi complex subunit 7        67.4    2e-09    Homo sapiens [man]
ref|XP_003930238.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    Saimiri boliviensis boliviensis
ref|XP_005935571.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    Haplochromis burtoni
ref|XP_004571418.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    Maylandia zebra
ref|XP_003813754.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    Pan paniscus [bonobo]
ref|XP_005748533.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    Pundamilia nyererei
ref|XP_004057400.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    
ref|XP_010356516.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09    Rhinopithecus roxellana
ref|XP_009007562.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09    Callithrix jacchus [common marmoset]
ref|XP_005591519.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09    Macaca fascicularis [crab eating macaque]
ref|XP_008474511.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    2e-09    Diaphorina citri
ref|XP_006148372.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09    Tupaia chinensis
ref|XP_008299300.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09    Stegastes partitus
emb|CBY21571.1|  unnamed protein product                              67.0    2e-09    Oikopleura dioica
ref|XP_008202373.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    3e-09    
ref|XP_008559723.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    3e-09    
ref|XP_008202375.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    3e-09    
gb|ELR49362.1|  Conserved oligomeric Golgi complex subunit 7          67.0    3e-09    
ref|XP_011186252.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    3e-09    
ref|XP_008202374.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    3e-09    
ref|XP_008202376.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    3e-09    
ref|XP_003998815.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    3e-09    
ref|XP_007084222.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    3e-09    
ref|XP_003478248.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    
ref|XP_003438511.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    
ref|NP_001124794.1|  conserved oligomeric Golgi complex subunit 7     66.6    3e-09    
ref|XP_008504971.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    
ref|XP_010835502.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    
ref|XP_006071244.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    
emb|CDQ68336.1|  unnamed protein product                              66.2    3e-09    
ref|XP_005975366.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    
ref|XP_005905382.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    
ref|NP_001076841.1|  conserved oligomeric Golgi complex subunit 7     66.6    3e-09    
ref|XP_009089982.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    
ref|XP_005598907.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    
ref|XP_001916280.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    
ref|XP_010791235.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    
ref|XP_005697660.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    
ref|XP_004020887.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    4e-09    
ref|XP_005323804.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    4e-09    
ref|XP_002105431.1|  GD17535                                          66.2    4e-09    
ref|XP_002037280.1|  GM12202                                          66.2    4e-09    
ref|XP_005523167.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    4e-09    
ref|XP_008842039.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    4e-09    
ref|XP_011154014.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    4e-09    
ref|XP_008058130.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    4e-09    
ref|XP_007198346.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  66.2    4e-09    
ref|XP_005141261.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    5e-09    
ref|XP_008566482.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    5e-09    
ref|NP_001264493.1|  conserved oligomeric Golgi complex subunit 7     65.9    5e-09    
ref|XP_008631786.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    5e-09    
ref|XP_010390549.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    5e-09    
ref|NP_651750.1|  Cog7                                                65.9    5e-09    
gb|KFO58912.1|  Conserved oligomeric Golgi complex subunit 7          65.9    5e-09    
ref|XP_010731364.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    6e-09    
ref|XP_010731365.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    6e-09    
ref|XP_002431030.1|  conserved hypothetical protein                   65.9    6e-09    
ref|XP_005718297.1|  unnamed protein product                          65.5    6e-09    
ref|XP_005054658.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    7e-09    
ref|XP_005505761.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    7e-09    
ref|XP_011502446.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    8e-09    
ref|XP_002098511.1|  GE10410                                          65.5    8e-09    
ref|XP_005426090.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    8e-09    
ref|XP_009957143.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    9e-09    
gb|KFQ15936.1|  Conserved oligomeric Golgi complex subunit 7          65.1    9e-09    
ref|XP_010621761.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    1e-08    
ref|XP_010010968.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    1e-08    
ref|XP_004586873.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    1e-08    
gb|KFQ47789.1|  Conserved oligomeric Golgi complex subunit 7          64.7    1e-08    
ref|XP_009665180.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    1e-08    
ref|XP_008933945.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    2e-08    
gb|KFQ25509.1|  Conserved oligomeric Golgi complex subunit 7          64.3    2e-08    
gb|KFQ77454.1|  Conserved oligomeric Golgi complex subunit 7          64.3    2e-08    
ref|XP_001981279.1|  GG11984                                          64.3    2e-08    
ref|XP_009665174.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
ref|XP_009318776.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
gb|KFV72508.1|  Conserved oligomeric Golgi complex subunit 7          64.3    2e-08    
ref|XP_011207193.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
ref|XP_009072086.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
gb|KFP79541.1|  Conserved oligomeric Golgi complex subunit 7          64.3    2e-08    
ref|XP_009974505.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
ref|XP_009284907.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
ref|XP_005018689.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
ref|XP_003230028.2|  PREDICTED: conserved oligomeric Golgi comple...  63.5    2e-08    
ref|NP_001015714.1|  component of oligomeric golgi complex 7          64.3    2e-08    
gb|KFM12505.1|  Conserved oligomeric Golgi complex subunit 7          63.9    2e-08    
gb|KFV44518.1|  Conserved oligomeric Golgi complex subunit 7          63.9    2e-08    
gb|KFW64649.1|  Conserved oligomeric Golgi complex subunit 7          63.9    2e-08    
ref|XP_006507762.2|  PREDICTED: conserved oligomeric Golgi comple...  63.9    2e-08    
ref|XP_009919151.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    2e-08    
ref|NP_001070861.1|  conserved oligomeric Golgi complex subunit 7     63.9    2e-08    
ref|XP_006507763.2|  PREDICTED: conserved oligomeric Golgi comple...  63.9    2e-08    
ref|XP_010568816.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    2e-08    
ref|XP_313727.3|  AGAP004439-PA                                       63.9    3e-08    
ref|XP_010717801.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    3e-08    
ref|XP_009919150.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    3e-08    
ref|XP_002711891.2|  PREDICTED: conserved oligomeric Golgi comple...  63.9    3e-08    
ref|XP_010171643.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    3e-08    
gb|KFZ48154.1|  Conserved oligomeric Golgi complex subunit 7          63.9    3e-08    
ref|XP_010568814.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    3e-08    
gb|KFQ05597.1|  Conserved oligomeric Golgi complex subunit 7          63.5    3e-08    
ref|XP_009893067.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    3e-08    
ref|XP_010144199.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    3e-08    
gb|ELW66292.1|  Conserved oligomeric Golgi complex subunit 7          63.5    3e-08    
ref|XP_008926490.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    3e-08    
gb|KFO84349.1|  Conserved oligomeric Golgi complex subunit 7          63.5    3e-08    
ref|XP_005229099.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    3e-08    
ref|XP_010295242.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    3e-08    
ref|XP_010299541.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    3e-08    
gb|KFP63966.1|  Conserved oligomeric Golgi complex subunit 7          63.5    3e-08    
gb|KFW84542.1|  Conserved oligomeric Golgi complex subunit 7          63.5    3e-08    
ref|XP_009482406.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    4e-08    
ref|XP_007903979.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    4e-08    
ref|XP_009930601.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    4e-08    
ref|XP_009696306.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    4e-08    
ref|XP_009503997.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    4e-08    
ref|XP_009585506.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    4e-08    
gb|KFW91579.1|  Conserved oligomeric Golgi complex subunit 7          63.5    4e-08    
ref|XP_003230252.2|  PREDICTED: conserved oligomeric Golgi comple...  63.5    4e-08    
ref|XP_009815736.1|  PREDICTED: conserved oligomeric Golgi comple...  63.2    4e-08    
gb|KFR08003.1|  Conserved oligomeric Golgi complex subunit 7          63.2    4e-08    
gb|KFQ70547.1|  Conserved oligomeric Golgi complex subunit 7          63.2    4e-08    
gb|KFQ52210.1|  Conserved oligomeric Golgi complex subunit 7          63.2    4e-08    
ref|XP_010125973.1|  PREDICTED: conserved oligomeric Golgi comple...  63.2    4e-08    
ref|XP_005443671.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    4e-08    
gb|KFV98617.1|  Conserved oligomeric Golgi complex subunit 7          63.2    4e-08    
ref|NP_001085832.1|  component of oligomeric golgi complex 7          63.2    5e-08    
gb|KFP45453.1|  Conserved oligomeric Golgi complex subunit 7          63.2    5e-08    
ref|XP_001357618.1|  GA15960                                          62.8    7e-08    
ref|XP_010198342.1|  PREDICTED: conserved oligomeric Golgi comple...  62.4    7e-08    
ref|XP_002001440.1|  GI21972                                          62.4    8e-08    
ref|XP_009983312.1|  PREDICTED: conserved oligomeric Golgi comple...  62.4    8e-08    
gb|KDO27581.1|  hypothetical protein SPRG_06849                       62.4    8e-08    
ref|XP_001993908.1|  GH22206                                          62.4    8e-08    
gb|KFV17186.1|  Conserved oligomeric Golgi complex subunit 7          62.4    8e-08    
gb|KFQ99971.1|  Conserved oligomeric Golgi complex subunit 7          62.0    1e-07    
ref|XP_009466130.1|  PREDICTED: conserved oligomeric Golgi comple...  62.0    1e-07    
ref|XP_008488587.1|  PREDICTED: conserved oligomeric Golgi comple...  62.0    1e-07    
gb|KFO95573.1|  Conserved oligomeric Golgi complex subunit 7          62.0    1e-07    
ref|XP_010073318.1|  PREDICTED: conserved oligomeric Golgi comple...  61.6    1e-07    
ref|XP_002802472.1|  PREDICTED: conserved oligomeric Golgi comple...  61.6    1e-07    
gb|KFP10525.1|  Conserved oligomeric Golgi complex subunit 7          61.6    1e-07    
ref|XP_009646382.1|  PREDICTED: conserved oligomeric Golgi comple...  61.6    2e-07    
ref|XP_001945391.2|  PREDICTED: conserved oligomeric Golgi comple...  61.2    2e-07    
ref|XP_009906223.1|  PREDICTED: conserved oligomeric Golgi comple...  61.2    2e-07    
gb|EHJ78638.1|  putative component of oligomeric golgi complex 7      61.2    2e-07    
ref|XP_010000872.1|  PREDICTED: conserved oligomeric Golgi comple...  61.2    2e-07    
gb|KFM79726.1|  Conserved oligomeric Golgi complex subunit 7          58.2    2e-07    
ref|XP_002058398.1|  GJ14333                                          61.2    2e-07    
gb|KFV74312.1|  Conserved oligomeric Golgi complex subunit 7          61.2    2e-07    
gb|KFU93333.1|  Conserved oligomeric Golgi complex subunit 7          61.2    2e-07    
ref|XP_007442324.1|  PREDICTED: conserved oligomeric Golgi comple...  61.2    2e-07    
ref|XP_009248828.1|  PREDICTED: conserved oligomeric Golgi comple...  58.5    2e-07    
gb|ETN63528.1|  hypothetical protein AND_004755                       61.2    2e-07    
ref|XP_011372750.1|  PREDICTED: conserved oligomeric Golgi comple...  60.8    3e-07    
ref|XP_008312851.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    3e-07    
gb|KFZ67320.1|  Conserved oligomeric Golgi complex subunit 7          60.5    4e-07    
ref|XP_974190.1|  PREDICTED: conserved oligomeric Golgi complex s...  60.5    4e-07    
ref|XP_009867466.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    4e-07    
ref|XP_009565762.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  60.1    4e-07    
gb|KFP88492.1|  Conserved oligomeric Golgi complex subunit 7          60.1    4e-07    
ref|XP_001955508.1|  GF16218                                          60.1    5e-07    
ref|XP_009839113.1|  hypothetical protein H257_13328                  60.1    6e-07    
ref|XP_004176695.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  59.7    6e-07    
ref|XP_006268482.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  59.7    7e-07    
ref|XP_009839112.1|  hypothetical protein, variant                    59.7    7e-07    
ref|XP_003761800.1|  PREDICTED: conserved oligomeric Golgi comple...  59.7    7e-07    
ref|XP_005188405.1|  PREDICTED: conserved oligomeric Golgi comple...  59.7    7e-07    
gb|KGL78321.1|  Conserved oligomeric Golgi complex subunit 7          59.3    1e-06    
ref|XP_010214546.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  58.9    1e-06    
ref|XP_005494576.1|  PREDICTED: conserved oligomeric Golgi comple...  58.2    2e-06    
ref|XP_002128341.1|  PREDICTED: conserved oligomeric Golgi comple...  57.8    3e-06    
gb|KIJ18193.1|  hypothetical protein PAXINDRAFT_32237                 57.8    3e-06    
ref|XP_008619063.1|  hypothetical protein SDRG_14692                  57.0    6e-06    
ref|XP_005656828.1|  PREDICTED: conserved oligomeric Golgi comple...  56.6    7e-06    
ref|XP_002073360.1|  GK14089                                          56.6    7e-06    
gb|EXX54575.1|  hypothetical protein RirG_233350                      56.2    9e-06    
dbj|BAE37211.1|  unnamed protein product                              55.5    2e-05    
ref|XP_004778380.1|  PREDICTED: conserved oligomeric Golgi comple...  55.5    2e-05    
gb|EAW55831.1|  component of oligomeric golgi complex 7, isoform ...  55.1    2e-05    
ref|XP_005709389.1|  hypothetical protein Gasu_02200                  55.1    2e-05    
ref|XP_005591518.1|  PREDICTED: conserved oligomeric Golgi comple...  55.1    3e-05    
gb|KFB52038.1|  AGAP004439-PA-like protein                            54.7    4e-05    
ref|XP_004900784.1|  PREDICTED: conserved oligomeric Golgi comple...  54.3    4e-05    
gb|KIK29353.1|  hypothetical protein PISMIDRAFT_27259                 54.3    4e-05    
gb|KFD70340.1|  hypothetical protein M514_06928                       54.3    5e-05    
ref|XP_003737280.1|  PREDICTED: conserved oligomeric Golgi comple...  53.9    6e-05    
gb|ELU44402.1|  COG7 domain-containing protein                        53.9    6e-05    
ref|XP_005054657.1|  PREDICTED: conserved oligomeric Golgi comple...  53.9    6e-05    
gb|EUC63278.1|  component 7 (COG7) protein                            53.5    8e-05    
gb|KEP49189.1|  component 7 (COG7) protein                            53.5    9e-05    
gb|KIJ60451.1|  hypothetical protein HYDPIDRAFT_47172                 53.1    1e-04    
dbj|GAA52089.1|  conserved oligomeric Golgi complex subunit 7         52.8    2e-04    
ref|XP_009167964.1|  hypothetical protein T265_13613                  52.0    2e-04    
ref|XP_010145231.1|  PREDICTED: conserved oligomeric Golgi comple...  52.0    3e-04    
gb|ETP53379.1|  hypothetical protein F442_01707                       51.6    3e-04    
ref|XP_008899170.1|  hypothetical protein PPTG_06874                  51.6    3e-04    
gb|ETO84308.1|  hypothetical protein F444_01769                       51.6    3e-04    
gb|ETM01828.1|  hypothetical protein L917_01620                       51.6    3e-04    
gb|ETP25398.1|  hypothetical protein F441_01729                       51.6    3e-04    
emb|CEL62710.1|  Conserved oligomeric Golgi complex subunit 7 OS=...  51.6    4e-04    
emb|CCO30664.1|  Conserved oligomeric Golgi complex subunit 7 Sho...  51.2    4e-04    
gb|ETK95383.1|  hypothetical protein L915_01681                       51.2    5e-04    
gb|ETL48771.1|  hypothetical protein L916_01656                       51.2    5e-04    
ref|XP_005782152.1|  component of oligomeric Golgi complex 7          50.4    6e-04    
gb|KIK93765.1|  hypothetical protein PAXRUDRAFT_120984                50.8    7e-04    
ref|XP_002177780.1|  predicted protein                                50.4    7e-04    
ref|XP_004351649.1|  hypothetical protein ACA1_397180                 50.4    9e-04    



>ref|XP_006357255.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Solanum tuberosum]
 gb|AIU51134.1| embryo yellow protein, partial [Solanum tuberosum]
Length=835

 Score =   353 bits (907),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F DAVNELVYDVLISK+RQHFNDLSRLPIWSS+EEHS RPLPTFSAYPQSYVT VGEYLL
Sbjct  651  FTDAVNELVYDVLISKIRQHFNDLSRLPIWSSIEEHSLRPLPTFSAYPQSYVTGVGEYLL  710

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPL E ISNSD NADEAQYFATEWMFKVAEGATALY++QLRGIQYITDRGAQQL
Sbjct  711  TLPQQLEPLVESISNSDPNADEAQYFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQL  770

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+P  LATF +C STP+ QLK+L+KSDSGNQLDLPTANLVCKMR
Sbjct  771  SVDIEYLSNVLSALSMPIPTCLATFQTCFSTPKDQLKDLIKSDSGNQLDLPTANLVCKMR  830

Query  206  RVSLE  192
            R+SLE
Sbjct  831  RISLE  835



>ref|XP_009786961.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nicotiana 
sylvestris]
Length=834

 Score =   351 bits (901),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F DAVNELVYDVLISKVRQ F DLSRLPIWSSVEEHSARPLPTFSAYPQSYVT VGEYLL
Sbjct  650  FTDAVNELVYDVLISKVRQQFIDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTGVGEYLL  709

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPL E ISNSD NADEAQYFATEWMFKVAEGATALY++QLRGIQYITDRGAQQL
Sbjct  710  TLPQQLEPLVENISNSDPNADEAQYFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQL  769

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+P VLATF +C STP++QLK+L+K+DSGNQLDLPTANLVCKMR
Sbjct  770  SVDIEYLSNVLSALSMPIPTVLATFQTCFSTPKNQLKDLIKTDSGNQLDLPTANLVCKMR  829

Query  206  RVSLE  192
            R+SLE
Sbjct  830  RISLE  834



>ref|XP_004238762.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Solanum 
lycopersicum]
 gb|AIU51145.1| embryo yellow protein, partial [Solanum lycopersicum]
Length=835

 Score =   350 bits (898),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+DAVNELVYDVLISK+RQ FNDLSRLPIWSSVEEHS RPLPTFS+YPQSYVT VGEYLL
Sbjct  651  FSDAVNELVYDVLISKIRQQFNDLSRLPIWSSVEEHSLRPLPTFSSYPQSYVTGVGEYLL  710

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPL E ISNSD NADEAQYFATEWMFKVAEGATALY++QLRGIQYITDRGAQQL
Sbjct  711  TLPQQLEPLVENISNSDPNADEAQYFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQL  770

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+P  LATF +C STP+ QLK+L+KSDSGNQLDLPTANLVCKMR
Sbjct  771  SVDIEYLSNVLSALSMPIPTCLATFQTCFSTPKDQLKDLIKSDSGNQLDLPTANLVCKMR  830

Query  206  RVSLE  192
            R+SLE
Sbjct  831  RISLE  835



>gb|KDP22425.1| hypothetical protein JCGZ_26256 [Jatropha curcas]
Length=832

 Score =   347 bits (890),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA PLPTFSAYPQSYVT+VGEYLL
Sbjct  648  FADTVNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAFPLPTFSAYPQSYVTSVGEYLL  707

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNSDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQY+TDRGAQQL
Sbjct  708  TLPQQLEPLAEGISNSDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYVTDRGAQQL  767

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PP+LATFH+C STPR QLK LVKSD+GNQLD+PTANLVCK+R
Sbjct  768  SVDIEYLSNVLSALSMPIPPILATFHTCFSTPRDQLKHLVKSDAGNQLDIPTANLVCKIR  827

Query  206  RVSLE  192
            RVSL+
Sbjct  828  RVSLD  832



>ref|XP_009625424.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nicotiana 
tomentosiformis]
Length=835

 Score =   346 bits (887),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F DAV+ELVYDVLISKVRQ F  LSRLPIWSSVEEHSARPLPTFSAYPQSYVT VGEYLL
Sbjct  651  FTDAVSELVYDVLISKVRQQFIGLSRLPIWSSVEEHSARPLPTFSAYPQSYVTGVGEYLL  710

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPL E ISNSD NADEAQYFATEWMFKVAEGATALY++QLRGIQYITDRGAQQL
Sbjct  711  TLPQQLEPLVENISNSDPNADEAQYFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQL  770

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+P VLATF +C STP++QLK+L+K+DSGNQLDLPTANLVCKMR
Sbjct  771  SVDIEYLSNVLSALSMPIPTVLATFQTCFSTPKNQLKDLIKTDSGNQLDLPTANLVCKMR  830

Query  206  RVSLE  192
            R+SLE
Sbjct  831  RISLE  835



>gb|AIU51136.1| embryo yellow protein, partial [Prunus persica]
Length=838

 Score =   345 bits (886),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLL
Sbjct  654  FADTVNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLL  713

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNSDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRG+QQL
Sbjct  714  TLPQQLEPLAEGISNSDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGSQQL  773

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVLATFH+CLSTPR QLK+L+KSDSGNQLDLPTANLVCKMR
Sbjct  774  SVDIEYLSNVLSALSMPIPPVLATFHTCLSTPRDQLKDLLKSDSGNQLDLPTANLVCKMR  833

Query  206  RVSLE  192
            R++LE
Sbjct  834  RLNLE  838



>ref|XP_008234406.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Prunus 
mume]
Length=839

 Score =   345 bits (885),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLL
Sbjct  655  FADTVNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLL  714

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNSDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRG+QQL
Sbjct  715  TLPQQLEPLAEGISNSDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGSQQL  774

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVLATFH+CLSTPR QLK+L+KSDSGNQLDLPTANLVCKMR
Sbjct  775  SVDIEYLSNVLSALSMPIPPVLATFHTCLSTPRDQLKDLLKSDSGNQLDLPTANLVCKMR  834

Query  206  RVSLE  192
            R++LE
Sbjct  835  RLNLE  839



>ref|XP_007218916.1| hypothetical protein PRUPE_ppa001391mg [Prunus persica]
 gb|EMJ20115.1| hypothetical protein PRUPE_ppa001391mg [Prunus persica]
Length=839

 Score =   345 bits (885),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLL
Sbjct  655  FADTVNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLL  714

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNSDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRG+QQL
Sbjct  715  TLPQQLEPLAEGISNSDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGSQQL  774

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVLATFH+CLSTPR QLK+L+KSDSGNQLDLPTANLVCKMR
Sbjct  775  SVDIEYLSNVLSALSMPIPPVLATFHTCLSTPRDQLKDLLKSDSGNQLDLPTANLVCKMR  834

Query  206  RVSLE  192
            R++LE
Sbjct  835  RLNLE  839



>ref|XP_011033997.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Populus euphratica]
 ref|XP_011010844.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Populus euphratica]
Length=831

 Score =   345 bits (884),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FADAVNELVYDVLISKVRQ  +D+SRLPIWS+V+EHS+  LPTFSAYPQSYVT+VGEYLL
Sbjct  647  FADAVNELVYDVLISKVRQRLSDVSRLPIWSAVDEHSSFRLPTFSAYPQSYVTSVGEYLL  706

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLA+GISN+DAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQL
Sbjct  707  TLPQQLEPLADGISNNDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQL  766

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PP+LATFH+CLSTPR QLK+LVKSDSGNQLDL TANLVCK+R
Sbjct  767  SVDIEYLSNVLSALSMPIPPILATFHTCLSTPRDQLKQLVKSDSGNQLDLSTANLVCKIR  826

Query  206  RVSLE  192
            RVSL+
Sbjct  827  RVSLD  831



>gb|AIU51140.1| embryo yellow protein, partial [Ricinus communis]
Length=831

 Score =   344 bits (883),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVR   ND+SRLPIWSSVEE SA PLP FSAYPQSYVT+VGEYLL
Sbjct  647  FADTVNELVYDVLISKVRLRLNDVSRLPIWSSVEEQSAFPLPIFSAYPQSYVTSVGEYLL  706

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNSDAN DEAQ+FATEWMFKVAEGA+ALY++QLRGIQYITDRGAQQL
Sbjct  707  TLPQQLEPLAEGISNSDANNDEAQFFATEWMFKVAEGASALYMEQLRGIQYITDRGAQQL  766

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PP+LATFH+CLSTPR QLK LVKSD+GNQLDLPTANLVCK+R
Sbjct  767  SVDIEYLSNVLSALSMPIPPILATFHTCLSTPRDQLKYLVKSDAGNQLDLPTANLVCKIR  826

Query  206  RVSLE  192
            RVSL+
Sbjct  827  RVSLD  831



>ref|XP_002510953.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51555.1| conserved hypothetical protein [Ricinus communis]
Length=832

 Score =   344 bits (883),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVR   ND+SRLPIWSSVEE SA PLP FSAYPQSYVT+VGEYLL
Sbjct  648  FADTVNELVYDVLISKVRLRLNDVSRLPIWSSVEEQSAFPLPIFSAYPQSYVTSVGEYLL  707

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNSDAN DEAQ+FATEWMFKVAEGA+ALY++QLRGIQYITDRGAQQL
Sbjct  708  TLPQQLEPLAEGISNSDANNDEAQFFATEWMFKVAEGASALYMEQLRGIQYITDRGAQQL  767

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PP+LATFH+CLSTPR QLK LVKSD+GNQLDLPTANLVCK+R
Sbjct  768  SVDIEYLSNVLSALSMPIPPILATFHTCLSTPRDQLKYLVKSDAGNQLDLPTANLVCKIR  827

Query  206  RVSLE  192
            RVSL+
Sbjct  828  RVSLD  832



>ref|XP_010089680.1| hypothetical protein L484_001268 [Morus notabilis]
 gb|EXC36303.1| hypothetical protein L484_001268 [Morus notabilis]
Length=833

 Score =   343 bits (881),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  +D+S LPIWS+VEE SA PLP+FSAYPQ+YVT+VGEYLL
Sbjct  649  FSDTVNELVYDVLISKVRQRLSDVSHLPIWSAVEEQSAFPLPSFSAYPQAYVTSVGEYLL  708

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISN+DAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQL
Sbjct  709  TLPQQLEPLAEGISNNDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQL  768

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVLATFH+CLST R +LKELVKSDSGNQLDLPTANLVCKMR
Sbjct  769  SVDIEYLSNVLSALSMPIPPVLATFHTCLSTSRDELKELVKSDSGNQLDLPTANLVCKMR  828

Query  206  RVSLE  192
            RVSL+
Sbjct  829  RVSLD  833



>ref|XP_002304412.2| conserved oligomeric Golgi complex component-related family protein 
[Populus trichocarpa]
 gb|EEE79391.2| conserved oligomeric Golgi complex component-related family protein 
[Populus trichocarpa]
 gb|AIU51135.1| embryo yellow protein, partial [Populus trichocarpa]
Length=831

 Score =   343 bits (879),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FADAVNELVYDVLISKVRQ  +D+SRLPIWS+V+EHS+  LPTFSAYPQSYVT+VGEYLL
Sbjct  647  FADAVNELVYDVLISKVRQRLSDVSRLPIWSAVDEHSSFRLPTFSAYPQSYVTSVGEYLL  706

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLA+GISN+DAN +EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQL
Sbjct  707  TLPQQLEPLADGISNNDANNEEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQL  766

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PP+LATFH+CLSTPR QLK+LVKSDSGNQLDL TANLVCK+R
Sbjct  767  SVDIEYLSNVLSALSMPIPPILATFHTCLSTPRDQLKQLVKSDSGNQLDLSTANLVCKIR  826

Query  206  RVSLE  192
            RVSL+
Sbjct  827  RVSLD  831



>gb|AIU51131.1| embryo yellow protein, partial [Manihot esculenta]
Length=833

 Score =   342 bits (878),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D+SRLPIWSS+EE  A PLPTFSAYPQSYV++VGEYLL
Sbjct  649  FADTVNELVYDVLISKVRQRLSDVSRLPIWSSIEEQGAFPLPTFSAYPQSYVSSVGEYLL  708

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+SD N DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQL
Sbjct  709  TLPQQLEPLAEGISSSDVNNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQL  768

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            +VDIEYLSNVLSALSMP+PPVLATFH+CLSTPR QLK LVKSD+GNQLDLPTANLVCK+R
Sbjct  769  AVDIEYLSNVLSALSMPIPPVLATFHTCLSTPRDQLKHLVKSDAGNQLDLPTANLVCKIR  828

Query  206  RVSLE  192
            R+SL+
Sbjct  829  RISLD  833



>ref|XP_011076371.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Sesamum 
indicum]
Length=838

 Score =   342 bits (878),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FA+AVNELVYDVLI KVRQHF+DLSRLPIWSSVEE SA P+P+FSAYPQSYVTNVGEYLL
Sbjct  654  FAEAVNELVYDVLILKVRQHFSDLSRLPIWSSVEEPSAFPVPSFSAYPQSYVTNVGEYLL  713

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNSDANA+EAQ+FATEWMFKVAEGATALY++QLRGI  ITDRGAQQL
Sbjct  714  TLPQQLEPLAEGISNSDANAEEAQFFATEWMFKVAEGATALYIEQLRGIHKITDRGAQQL  773

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVL+TFH+C STP  QLK+LVKSDSGNQLDLPTANLVCKMR
Sbjct  774  SVDIEYLSNVLSALSMPIPPVLSTFHTCFSTPTDQLKDLVKSDSGNQLDLPTANLVCKMR  833

Query  206  RVSLE  192
             V L+
Sbjct  834  GVRLD  838



>ref|XP_009372929.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=651

 Score =   337 bits (865),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 172/182 (95%), Gaps = 1/182 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FADAVNELVYDVLISKVRQ F+D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLL
Sbjct  467  FADAVNELVYDVLISKVRQCFSDVSRLPIWSSVEEQSAYNLPTFSAYPQAYVTSIGEYLL  526

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPL EGISNSDAN DEAQ FATEWMFKVAEGATALY +QLRGIQYITDRGAQQL
Sbjct  527  TLPQQLEPLVEGISNSDANNDEAQIFATEWMFKVAEGATALYTEQLRGIQYITDRGAQQL  586

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVLATFH+CLSTPR QLK+LVKSD+GN LDLPTANLVCKMR
Sbjct  587  SVDIEYLSNVLSALSMPIPPVLATFHTCLSTPRDQLKDLVKSDAGN-LDLPTANLVCKMR  645

Query  206  RV  201
            R+
Sbjct  646  RL  647



>ref|XP_002267657.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Vitis 
vinifera]
 emb|CBI24597.3| unnamed protein product [Vitis vinifera]
 gb|AIU51148.1| embryo yellow protein, partial [Vitis vinifera]
Length=838

 Score =   341 bits (875),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D+SRLPIWS+VEE SA PLP+F+AYPQ+YVT+VGEYLL
Sbjct  654  FADTVNELVYDVLISKVRQRLSDVSRLPIWSAVEEPSAFPLPSFNAYPQAYVTSVGEYLL  713

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+SD NADEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQL
Sbjct  714  TLPQQLEPLAEGISSSDPNADEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQL  773

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVLSALSMP+PP+LATFHSCLSTPR QLK+ VKSD+GNQLDLPTANLVCK+R
Sbjct  774  SADIEYLSNVLSALSMPIPPILATFHSCLSTPRDQLKDFVKSDAGNQLDLPTANLVCKIR  833

Query  206  RVSLE  192
            RV LE
Sbjct  834  RVGLE  838



>emb|CDP05334.1| unnamed protein product [Coffea canephora]
Length=845

 Score =   340 bits (872),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 177/186 (95%), Gaps = 1/186 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FADAVNELVYDVLISKVRQ FNDLSRLP+WSSV+E SA PLP+FS+YPQSYVTNVGEYLL
Sbjct  660  FADAVNELVYDVLISKVRQQFNDLSRLPVWSSVDEPSAFPLPSFSSYPQSYVTNVGEYLL  719

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+SD NADEAQ+FATEWMFKVAEGA+ LY++QLRGIQY+TDRGAQQL
Sbjct  720  TLPQQLEPLAEGISSSDTNADEAQFFATEWMFKVAEGASTLYMEQLRGIQYVTDRGAQQL  779

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVK-SDSGNQLDLPTANLVCKM  210
            + DIEYLSNVLSALSMP+PPVLATF +CLSTPR QLK+LVK SDSGNQLDLPTANLVCKM
Sbjct  780  AADIEYLSNVLSALSMPIPPVLATFQTCLSTPREQLKDLVKSSDSGNQLDLPTANLVCKM  839

Query  209  RRVSLE  192
            RR+SL+
Sbjct  840  RRLSLD  845



>gb|KHG21476.1| Conserved oligomeric Golgi complex subunit 7 [Gossypium arboreum]
Length=420

 Score =   328 bits (840),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FA+AVNELVYDVLISKVRQ  +++SR+PIWS+ EE SA  LPTFSAYPQ YVT+VGEYLL
Sbjct  236  FAEAVNELVYDVLISKVRQRLSEVSRMPIWSAAEEQSAFRLPTFSAYPQPYVTSVGEYLL  295

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNSDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITD GAQQL
Sbjct  296  TLPQQLEPLAEGISNSDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDGGAQQL  355

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVLATF +CL TPR QLK+L+KSD+GNQLDLPTANLVCK+R
Sbjct  356  SVDIEYLSNVLSALSMPIPPVLATFQTCLGTPRDQLKDLLKSDNGNQLDLPTANLVCKIR  415

Query  206  RVSLE  192
            R++L+
Sbjct  416  RLNLD  420



>ref|XP_004307803.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Fragaria 
vesca subsp. vesca]
Length=832

 Score =   339 bits (869),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D+SRLPIWSSVEE S   LPTFSA PQSYVTNVGEYLL
Sbjct  648  FADTVNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSVYHLPTFSASPQSYVTNVGEYLL  707

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGI+NSDAN +EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQL
Sbjct  708  TLPQQLEPLAEGIANSDANNEEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQL  767

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVL+TFH+CLSTPR QL++L+KSDSGNQLDLPTANL+CKMR
Sbjct  768  SVDIEYLSNVLSALSMPIPPVLSTFHTCLSTPRDQLRDLIKSDSGNQLDLPTANLICKMR  827

Query  206  RVSLE  192
            RV ++
Sbjct  828  RVIID  832



>ref|XP_007131467.1| hypothetical protein PHAVU_011G016000g [Phaseolus vulgaris]
 gb|ESW03461.1| hypothetical protein PHAVU_011G016000g [Phaseolus vulgaris]
Length=834

 Score =   338 bits (867),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 176/185 (95%), Gaps = 1/185 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +++SRLPIWSSVEE    PLPTFSAYPQSYVT+VGEYLL
Sbjct  650  FADTVNELVYDVLISKVRQRLSEVSRLPIWSSVEEQGGYPLPTFSAYPQSYVTSVGEYLL  709

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNS+AN DEAQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQL
Sbjct  710  TLPQQLEPLAEGISNSEAN-DEAQFFATEWMFKVAEGATALYIDQLRGIQYISDRGAQQL  768

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVLATF SCLS+PR+QLK+L+K+DSGNQLD+PTANLVCKMR
Sbjct  769  SVDIEYLSNVLSALSMPIPPVLATFQSCLSSPRNQLKDLLKTDSGNQLDMPTANLVCKMR  828

Query  206  RVSLE  192
            RV+L+
Sbjct  829  RVNLD  833



>gb|AIU51138.1| embryo yellow protein, partial [Phaseolus vulgaris]
Length=833

 Score =   338 bits (867),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 176/185 (95%), Gaps = 1/185 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +++SRLPIWSSVEE    PLPTFSAYPQSYVT+VGEYLL
Sbjct  650  FADTVNELVYDVLISKVRQRLSEVSRLPIWSSVEEQGGYPLPTFSAYPQSYVTSVGEYLL  709

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNS+AN DEAQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQL
Sbjct  710  TLPQQLEPLAEGISNSEAN-DEAQFFATEWMFKVAEGATALYIDQLRGIQYISDRGAQQL  768

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVLATF SCLS+PR+QLK+L+K+DSGNQLD+PTANLVCKMR
Sbjct  769  SVDIEYLSNVLSALSMPIPPVLATFQSCLSSPRNQLKDLLKTDSGNQLDMPTANLVCKMR  828

Query  206  RVSLE  192
            RV+L+
Sbjct  829  RVNLD  833



>ref|XP_009340575.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=837

 Score =   337 bits (865),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 175/185 (95%), Gaps = 1/185 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLL
Sbjct  654  FADTVNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLL  713

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNSDAN DEAQ FATEWMFKVAEGATALY++QLRGIQYITDRGAQQL
Sbjct  714  TLPQQLEPLAEGISNSDANNDEAQIFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQL  773

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVLATFH+CLSTPR QLK+LVKSD+GN LDLPTANLVCK+R
Sbjct  774  SVDIEYLSNVLSALSMPIPPVLATFHTCLSTPRDQLKDLVKSDAGN-LDLPTANLVCKIR  832

Query  206  RVSLE  192
            R+SL+
Sbjct  833  RLSLD  837



>ref|XP_007038383.1| Oligomeric Golgi complex component-related / COG complex component-related 
[Theobroma cacao]
 gb|EOY22884.1| Oligomeric Golgi complex component-related / COG complex component-related 
[Theobroma cacao]
Length=832

 Score =   337 bits (864),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FA+ VNELVYDVLISKVRQ  +D+SRLPIWS+VEE SA PLPTFSAYPQSYVT+VGEYLL
Sbjct  647  FAETVNELVYDVLISKVRQRLSDVSRLPIWSAVEEQSAFPLPTFSAYPQSYVTSVGEYLL  706

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNSDA+ +EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQL
Sbjct  707  TLPQQLEPLAEGISNSDASNEEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQL  766

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVLATF +C  TPR QLK+L+KSDSGNQLDLPTANLVCK+R
Sbjct  767  SVDIEYLSNVLSALSMPIPPVLATFQTCFGTPRDQLKDLLKSDSGNQLDLPTANLVCKIR  826

Query  206  RVSLE  192
            RV+L+
Sbjct  827  RVNLD  831



>gb|AIU51110.1| embryo yellow protein, partial [Theobroma cacao]
Length=831

 Score =   337 bits (864),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FA+ VNELVYDVLISKVRQ  +D+SRLPIWS+VEE SA PLPTFSAYPQSYVT+VGEYLL
Sbjct  647  FAETVNELVYDVLISKVRQRLSDVSRLPIWSAVEEQSAFPLPTFSAYPQSYVTSVGEYLL  706

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNSDA+ +EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQL
Sbjct  707  TLPQQLEPLAEGISNSDASNEEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQL  766

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVLATF +C  TPR QLK+L+KSDSGNQLDLPTANLVCK+R
Sbjct  767  SVDIEYLSNVLSALSMPIPPVLATFQTCFGTPRDQLKDLLKSDSGNQLDLPTANLVCKIR  826

Query  206  RVSLE  192
            RV+L+
Sbjct  827  RVNLD  831



>ref|XP_008376080.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Malus domestica]
Length=838

 Score =   337 bits (864),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 175/185 (95%), Gaps = 1/185 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLL
Sbjct  655  FADTVNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLL  714

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNSDAN DEAQ FATEWMFKVAEGATALY++QLRGIQYITDRGAQQL
Sbjct  715  TLPQQLEPLAEGISNSDANNDEAQIFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQL  774

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVLATFH+CLSTPR QLK+LVKSD+GN LDLPTANLVCK+R
Sbjct  775  SVDIEYLSNVLSALSMPIPPVLATFHTCLSTPRDQLKDLVKSDAGN-LDLPTANLVCKIR  833

Query  206  RVSLE  192
            R+SL+
Sbjct  834  RLSLD  838



>ref|XP_003534367.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X1 [Glycine max]
Length=834

 Score =   337 bits (864),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 175/185 (95%), Gaps = 1/185 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F D VNELVYDVLISKVRQ  +D+SRLPIWSSVEE  A PLPTFSAYPQSYVT+VGEYLL
Sbjct  650  FTDTVNELVYDVLISKVRQRLSDVSRLPIWSSVEEQGAFPLPTFSAYPQSYVTSVGEYLL  709

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISN++ N DEAQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQL
Sbjct  710  TLPQQLEPLAEGISNNEVN-DEAQFFATEWMFKVAEGATALYIEQLRGIQYISDRGAQQL  768

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVLATF SCLSTPR+QLK+L+K+DSGNQLDLPTANLVCKMR
Sbjct  769  SVDIEYLSNVLSALSMPIPPVLATFQSCLSTPRNQLKDLLKTDSGNQLDLPTANLVCKMR  828

Query  206  RVSLE  192
            RV+L+
Sbjct  829  RVNLD  833



>gb|AIU51119.1| embryo yellow protein, partial [Glycine max]
Length=833

 Score =   337 bits (863),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 175/185 (95%), Gaps = 1/185 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F D VNELVYDVLISKVRQ  +D+SRLPIWSSVEE  A PLPTFSAYPQSYVT+VGEYLL
Sbjct  650  FTDTVNELVYDVLISKVRQRLSDVSRLPIWSSVEEQGAFPLPTFSAYPQSYVTSVGEYLL  709

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISN++ N DEAQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQL
Sbjct  710  TLPQQLEPLAEGISNNEVN-DEAQFFATEWMFKVAEGATALYIEQLRGIQYISDRGAQQL  768

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVLATF SCLSTPR+QLK+L+K+DSGNQLDLPTANLVCKMR
Sbjct  769  SVDIEYLSNVLSALSMPIPPVLATFQSCLSTPRNQLKDLLKTDSGNQLDLPTANLVCKMR  828

Query  206  RVSLE  192
            RV+L+
Sbjct  829  RVNLD  833



>gb|AIU51115.1| embryo yellow protein, partial [Carica papaya]
Length=839

 Score =   337 bits (864),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D++ LPIWS+VEE SA PLPTFSAYPQSYVT+VGEYLL
Sbjct  655  FADTVNELVYDVLISKVRQRLSDVAHLPIWSAVEEQSAFPLPTFSAYPQSYVTSVGEYLL  714

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNSD N+DEAQ+FATEWMFKVAEGATALY++QLRGIQYITD GAQQL
Sbjct  715  TLPQQLEPLAEGISNSDINSDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDHGAQQL  774

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMPVPPVLATF +CLST R QLK+L+K+DSGNQLDLPTANLVCK+R
Sbjct  775  SVDIEYLSNVLSALSMPVPPVLATFQTCLSTQRDQLKDLIKADSGNQLDLPTANLVCKIR  834

Query  206  RVSLE  192
            RVSL+
Sbjct  835  RVSLD  839



>gb|KHN11738.1| Conserved oligomeric Golgi complex subunit 7 [Glycine soja]
Length=834

 Score =   337 bits (863),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 175/185 (95%), Gaps = 1/185 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F D VNELVYDVLISKVRQ  +D+SRLPIWSSVEE  A PLPTFSAYPQSYVT+VGEYLL
Sbjct  650  FTDTVNELVYDVLISKVRQRLSDVSRLPIWSSVEEQGAFPLPTFSAYPQSYVTSVGEYLL  709

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISN++ N DEAQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQL
Sbjct  710  TLPQQLEPLAEGISNNEVN-DEAQFFATEWMFKVAEGATALYIEQLRGIQYISDRGAQQL  768

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVLATF SCLSTPR+QLK+L+K+DSGNQLDLPTANLVCKMR
Sbjct  769  SVDIEYLSNVLSALSMPIPPVLATFQSCLSTPRNQLKDLLKTDSGNQLDLPTANLVCKMR  828

Query  206  RVSLE  192
            RV+L+
Sbjct  829  RVNLD  833



>ref|XP_009374477.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=837

 Score =   335 bits (860),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 174/185 (94%), Gaps = 1/185 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLL
Sbjct  654  FADTVNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLL  713

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNSD N DEAQ FATEWMFKVAEGATALY++QLRGIQYITDRGAQQL
Sbjct  714  TLPQQLEPLAEGISNSDVNNDEAQIFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQL  773

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVLATFH+CLSTPR QLKELV+SD+GN LDLPTANLVCK+R
Sbjct  774  SVDIEYLSNVLSALSMPIPPVLATFHTCLSTPRDQLKELVQSDAGN-LDLPTANLVCKIR  832

Query  206  RVSLE  192
            R+SL+
Sbjct  833  RLSLD  837



>gb|EYU24953.1| hypothetical protein MIMGU_mgv1a001327mg [Erythranthe guttata]
 gb|AIU51132.1| embryo yellow protein, partial [Erythranthe guttata]
Length=839

 Score =   335 bits (858),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FADAVNELVYDVLI KVRQHFN+LSRLP+WSSVEE SA P+P+FSAYPQ YVTNVGEYLL
Sbjct  655  FADAVNELVYDVLILKVRQHFNELSRLPVWSSVEETSAHPVPSFSAYPQPYVTNVGEYLL  714

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNS+ANA+EAQ+FATEWMFKVAEGATALY++QLRGIQ ITDRGAQQL
Sbjct  715  TLPQQLEPLAEGISNSEANAEEAQFFATEWMFKVAEGATALYIEQLRGIQKITDRGAQQL  774

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP P VL+TFH+C STP  QLKE+VKSDSGNQLD+PTANLVCKMR
Sbjct  775  SVDIEYLSNVLSALSMPTPLVLSTFHTCSSTPTDQLKEIVKSDSGNQLDIPTANLVCKMR  834

Query  206  RVSLE  192
             + L+
Sbjct  835  GLRLD  839



>gb|KHN46499.1| Conserved oligomeric Golgi complex subunit 7 [Glycine soja]
Length=834

 Score =   335 bits (858),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 175/185 (95%), Gaps = 1/185 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F D VNELVYDVLISKVRQ  +D+SRLPIWSSVEE  + PLPTFSAYPQSYVT+VGEYLL
Sbjct  650  FTDTVNELVYDVLISKVRQRLSDVSRLPIWSSVEEQGSFPLPTFSAYPQSYVTSVGEYLL  709

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISN++ N DEAQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQL
Sbjct  710  TLPQQLEPLAEGISNNEVN-DEAQFFATEWMFKVAEGATALYIEQLRGIQYISDRGAQQL  768

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVLATF SCLSTPR+QLK+L+K+DSGNQLD+PTANLVCKMR
Sbjct  769  SVDIEYLSNVLSALSMPIPPVLATFQSCLSTPRNQLKDLLKTDSGNQLDMPTANLVCKMR  828

Query  206  RVSLE  192
            RV+L+
Sbjct  829  RVNLD  833



>gb|AIU51125.1| embryo yellow protein, partial [Chimonanthus praecox]
Length=828

 Score =   334 bits (856),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F D VNELVYDVLISKVR   +D+SRLPIWSSVEE SA  LP+FSAYPQSYVT+VGEYLL
Sbjct  646  FVDMVNELVYDVLISKVRHRLSDVSRLPIWSSVEEASAFHLPSFSAYPQSYVTSVGEYLL  705

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNSDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQY+TDRGAQQL
Sbjct  706  TLPQQLEPLAEGISNSDANTDEAQFFATEWMFKVAEGATALYIEQLRGIQYMTDRGAQQL  765

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVLSALSMP+PPVLATFH+CLSTPR QL++L+KSD GNQLDLPTANLVCK+R
Sbjct  766  SADIEYLSNVLSALSMPIPPVLATFHTCLSTPRDQLRDLLKSDGGNQLDLPTANLVCKIR  825

Query  206  RVS  198
            RV+
Sbjct  826  RVN  828



>gb|AIU51152.1| embryo yellow protein, partial [Platanus x acerifolia]
Length=839

 Score =   334 bits (856),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA PLP+FSAYPQSYVT+VGEYLL
Sbjct  655  FADTVNELVYDVLISKVRQRLSDVSRLPIWSSVEEPSAFPLPSFSAYPQSYVTSVGEYLL  714

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+SDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGA QL
Sbjct  715  TLPQQLEPLAEGISSSDANTDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGALQL  774

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVLSALSMP+P VLATFH+CLSTPR QL++L+KSD+GNQLDLPTA+LVCK+R
Sbjct  775  SADIEYLSNVLSALSMPIPQVLATFHTCLSTPRDQLRDLLKSDAGNQLDLPTAHLVCKIR  834

Query  206  RVSLE  192
            RV+L+
Sbjct  835  RVTLD  839



>ref|XP_006490119.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Citrus sinensis]
Length=835

 Score =   332 bits (852),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 174/185 (94%), Gaps = 1/185 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FADAVNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT+VGEYLL
Sbjct  652  FADAVNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAFHLPTFSAYPQTYVTSVGEYLL  711

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS SD N DEAQ+FATEWMFKVAEGA+ALY++QLRGIQYITD GAQQL
Sbjct  712  TLPQQLEPLAEGISTSDNN-DEAQFFATEWMFKVAEGASALYMEQLRGIQYITDHGAQQL  770

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALS+P+PP LATFH+CLSTPR QLK+L+KSDSGNQLDLPTANLVCK+R
Sbjct  771  SVDIEYLSNVLSALSVPIPPALATFHTCLSTPRDQLKDLLKSDSGNQLDLPTANLVCKIR  830

Query  206  RVSLE  192
            RVSL+
Sbjct  831  RVSLD  835



>gb|KDO65493.1| hypothetical protein CISIN_1g003266mg [Citrus sinensis]
 gb|AIU51117.1| embryo yellow protein, partial [Citrus sinensis]
Length=835

 Score =   332 bits (852),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 174/185 (94%), Gaps = 1/185 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FADAVNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT+VGEYLL
Sbjct  652  FADAVNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAFHLPTFSAYPQTYVTSVGEYLL  711

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS SD N DEAQ+FATEWMFKVAEGA+ALY++QLRGIQYITD GAQQL
Sbjct  712  TLPQQLEPLAEGISTSDNN-DEAQFFATEWMFKVAEGASALYMEQLRGIQYITDHGAQQL  770

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALS+P+PP LATFH+CLSTPR QLK+L+KSDSGNQLDLPTANLVCK+R
Sbjct  771  SVDIEYLSNVLSALSVPIPPALATFHTCLSTPRDQLKDLLKSDSGNQLDLPTANLVCKIR  830

Query  206  RVSLE  192
            RVSL+
Sbjct  831  RVSLD  835



>gb|AIU51106.1| embryo yellow protein, partial [Magnolia denudata]
Length=829

 Score =   331 bits (849),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D+SR+PIWSSVEE +A PLP+FSAYPQ+YVT+VGEYLL
Sbjct  647  FADMVNELVYDVLISKVRQRLSDVSRMPIWSSVEEPTAFPLPSFSAYPQAYVTSVGEYLL  706

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+SD N DEAQ+FATEWMFKVAEGAT LY++QLRGIQYITDRGAQQL
Sbjct  707  TLPQQLEPLAEGISSSDPNTDEAQFFATEWMFKVAEGATTLYMEQLRGIQYITDRGAQQL  766

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVLSALSMP+PP+LATFH+CLSTPR QL++LVKSD+GNQLDLPTA+LVCK+R
Sbjct  767  SADIEYLSNVLSALSMPIPPILATFHTCLSTPRDQLRDLVKSDAGNQLDLPTAHLVCKIR  826

Query  206  RVS  198
            RV+
Sbjct  827  RVT  829



>gb|AIU51123.1| embryo yellow protein, partial [Chloranthus japonicus]
Length=567

 Score =   323 bits (829),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  ND+SRLPIWSS +E SA PLP+FSAYPQ YVT+VGEYLL
Sbjct  386  FADTVNELVYDVLISKVRQRLNDVSRLPIWSSFDEPSAFPLPSFSAYPQPYVTSVGEYLL  445

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+S+AN DEAQ+FATEWMFKVAEGATALY++QLRGIQYIT+RGAQQL
Sbjct  446  TLPQQLEPLAEGISSSEANTDEAQFFATEWMFKVAEGATALYMEQLRGIQYITERGAQQL  505

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVLSALSMP+PP+LATFH+CLST R QL +LVKSD GNQLDLPTA+LVCK+R
Sbjct  506  SADIEYLSNVLSALSMPMPPILATFHTCLSTQRDQLHDLVKSDGGNQLDLPTAHLVCKIR  565

Query  206  RV  201
            RV
Sbjct  566  RV  567



>gb|AIU51151.1| embryo yellow protein, partial [Cinnamomum camphora]
Length=838

 Score =   330 bits (847),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D++RLPIWSSVEE SA  LP+FSAYPQ+YVT+VGEYLL
Sbjct  654  FADMVNELVYDVLISKVRQRLSDVARLPIWSSVEEASAFHLPSFSAYPQAYVTSVGEYLL  713

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+S+AN DEAQ+FATEWMFKVAEGATALY++QLRGI YITDRGAQQL
Sbjct  714  TLPQQLEPLAEGISSSEANTDEAQFFATEWMFKVAEGATALYMEQLRGIHYITDRGAQQL  773

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVLSALSMP+PPV+ATFH+CLSTPR QL++LVKSDSG+QLDLP ANLVCK+R
Sbjct  774  STDIEYLSNVLSALSMPIPPVMATFHTCLSTPRDQLRDLVKSDSGSQLDLPIANLVCKIR  833

Query  206  RVSLE  192
            RV+L+
Sbjct  834  RVNLD  838



>gb|AIU51111.1| embryo yellow protein, partial [Acorus calamus]
Length=827

 Score =   330 bits (845),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D+VNELVYDVLISKVRQ  +D+SRLPIWSSVEE +ARPLP+FSAYPQ YVT+VGEYLL
Sbjct  645  FSDSVNELVYDVLISKVRQRLSDVSRLPIWSSVEEPTARPLPSFSAYPQPYVTSVGEYLL  704

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+S+AN DEAQ+FATEWMFKVAEGATALY +QLRGIQYITDRGAQQL
Sbjct  705  TLPQQLEPLAEGISSSEANTDEAQFFATEWMFKVAEGATALYTEQLRGIQYITDRGAQQL  764

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVLSALSMP+P +LATF +CLSTP  QL+EL+KSDS NQLDLPTANLVCK+R
Sbjct  765  STDIEYLSNVLSALSMPIPQILATFQTCLSTPNDQLRELLKSDSANQLDLPTANLVCKIR  824

Query  206  RVS  198
            RVS
Sbjct  825  RVS  827



>ref|XP_006421663.1| hypothetical protein CICLE_v10004313mg [Citrus clementina]
 gb|ESR34903.1| hypothetical protein CICLE_v10004313mg [Citrus clementina]
 gb|AIU51113.1| embryo yellow protein, partial [Citrus clementina]
Length=835

 Score =   330 bits (845),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 173/185 (94%), Gaps = 1/185 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FADAVNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT+VGEYLL
Sbjct  652  FADAVNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAFHLPTFSAYPQTYVTSVGEYLL  711

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS SD N DEAQ+FATEWMFKVAEGA+ALY++QLRGIQYITD GAQQL
Sbjct  712  TLPQQLEPLAEGISTSDNN-DEAQFFATEWMFKVAEGASALYMEQLRGIQYITDHGAQQL  770

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALS+P+PP LATFH+CLSTPR QLK+ +KSDSGNQLDLPTANLVCK+R
Sbjct  771  SVDIEYLSNVLSALSVPIPPALATFHTCLSTPRDQLKDQLKSDSGNQLDLPTANLVCKIR  830

Query  206  RVSLE  192
            RVSL+
Sbjct  831  RVSLD  835



>gb|AIU51126.1| embryo yellow protein, partial [Pandanus utilis]
Length=477

 Score =   319 bits (818),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA PLP+FSAYPQ YVT+VGEYLL
Sbjct  295  FADKVNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSALPLPSFSAYPQPYVTSVGEYLL  354

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+S+A +DEAQ+FATEWMFKVAEGATAL+++QLRGI YITDRGAQQL
Sbjct  355  TLPQQLEPLAEGISSSEAGSDEAQFFATEWMFKVAEGATALFMEQLRGIHYITDRGAQQL  414

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVLSALSMP+PP L+T+H+CLSTPR QL++L+KSD   QLDLPTA+LVCK+R
Sbjct  415  SADIEYLSNVLSALSMPIPPFLSTYHTCLSTPRDQLRDLLKSDGATQLDLPTAHLVCKIR  474

Query  206  RVS  198
            R++
Sbjct  475  RIA  477



>gb|AIU51147.1| embryo yellow protein, partial [Schrenkiella parvula]
Length=831

 Score =   328 bits (841),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYD+LISKVRQ   D+SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLL
Sbjct  647  FADTVNELVYDILISKVRQRLGDVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLL  706

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISN D+N ++AQ+FATEWMFKVAEGATALYVDQLRGIQYI+DRGAQQL
Sbjct  707  TLPQQLEPLAEGISNGDSNNEDAQFFATEWMFKVAEGATALYVDQLRGIQYISDRGAQQL  766

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMR
Sbjct  767  SVDIEYLSNVLSALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMR  826

Query  206  RVSLE  192
            R+S +
Sbjct  827  RISFD  831



>gb|AIU51114.1| embryo yellow protein, partial [Gossypium raimondii]
 gb|KJB51433.1| hypothetical protein B456_008G216000 [Gossypium raimondii]
Length=830

 Score =   328 bits (841),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FA+AVNELVYDVLISKVRQ  +++SR+PIWS+ EE SA  LPTFSAYPQ YVT+VGEYLL
Sbjct  646  FAEAVNELVYDVLISKVRQRLSEVSRMPIWSAAEEQSAFRLPTFSAYPQPYVTSVGEYLL  705

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNSDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITD GAQQL
Sbjct  706  TLPQQLEPLAEGISNSDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDGGAQQL  765

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVLATF +CL TPR QLK+L+KSD+GNQLDLPTANLVCK+R
Sbjct  766  SVDIEYLSNVLSALSMPIPPVLATFQTCLGTPRDQLKDLLKSDNGNQLDLPTANLVCKIR  825

Query  206  RVSLE  192
            R++L+
Sbjct  826  RLNLD  830



>emb|CDY00472.1| BnaA10g08010D [Brassica napus]
Length=234

 Score =   310 bits (793),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 169/186 (91%), Gaps = 1/186 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYD+LISKVRQ   ++SRLPIWSSVEE +A  LP FS+YPQ+YVT+VGEYLL
Sbjct  49   FADTVNELVYDILISKVRQRLGEVSRLPIWSSVEEQTAFALPNFSSYPQAYVTSVGEYLL  108

Query  566  TLPQQLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQ  390
            TLPQQLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQ
Sbjct  109  TLPQQLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMEQLRGIQYISDRGAQQ  168

Query  389  LSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKM  210
            L VDIEYLSNVL+ALSMP+PPVLATF +CL+TPR +LK+++KSD+G +LD PTANLVCKM
Sbjct  169  LCVDIEYLSNVLAALSMPIPPVLATFQTCLATPRDELKDVMKSDAGRELDFPTANLVCKM  228

Query  209  RRVSLE  192
            RR+S +
Sbjct  229  RRISFD  234



>gb|AIU51103.1| embryo yellow protein, partial [Arabidopsis lyrata]
Length=835

 Score =   327 bits (839),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLL
Sbjct  651  FADTVNELVYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLL  710

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGI+N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQL
Sbjct  711  TLPQQLEPLAEGITNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQL  770

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVLATF +CL+TPR  LK+L+KS++GN+LD PTANLVCKMR
Sbjct  771  SVDIEYLSNVLSALSMPIPPVLATFQTCLATPRDDLKDLMKSEAGNELDFPTANLVCKMR  830

Query  206  RVSLE  192
            R+S +
Sbjct  831  RISFD  835



>gb|KEH17632.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=834

 Score =   327 bits (838),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 173/185 (94%), Gaps = 1/185 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D+SRLPIWSSVEE  A  LPTFSAYPQSYVT+VGEYLL
Sbjct  650  FADTVNELVYDVLISKVRQRLSDVSRLPIWSSVEEQGAFHLPTFSAYPQSYVTSVGEYLL  709

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+S+AN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQL
Sbjct  710  TLPQQLEPLAEGISSSEAN-DEAQFFATEWMFKVAEGATALYIEQLRGIQYITDRGAQQL  768

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDI+YLSNVLSALSMP+P VLATFHSCLST R QLK+L+K+DS NQLDLPTANLVCKMR
Sbjct  769  SVDIDYLSNVLSALSMPIPAVLATFHSCLSTSRDQLKDLLKTDSANQLDLPTANLVCKMR  828

Query  206  RVSLE  192
            +++L+
Sbjct  829  QLNLD  833



>gb|AIU51121.1| embryo yellow protein, partial [Buxus sinica]
Length=839

 Score =   327 bits (838),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D+SRLPIWS VEE SA PLP+FSAYPQSYVT+VGEYLL
Sbjct  655  FADTVNELVYDVLISKVRQRLSDVSRLPIWSLVEEPSAFPLPSFSAYPQSYVTSVGEYLL  714

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+SDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRG++QL
Sbjct  715  TLPQQLEPLAEGISSSDANTDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGSKQL  774

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVLSALSMP+P  LATFH+CLSTPR QL++LVKSD G+QLDLPTA+LVCK+R
Sbjct  775  SADIEYLSNVLSALSMPIPSTLATFHTCLSTPRDQLRDLVKSDQGSQLDLPTAHLVCKIR  834

Query  206  RVSLE  192
            R++L+
Sbjct  835  RINLD  839



>gb|AIU51104.1| embryo yellow protein, partial [Arabidopsis thaliana]
Length=835

 Score =   327 bits (837),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLL
Sbjct  651  FADTVNELVYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLL  710

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGI+N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQL
Sbjct  711  TLPQQLEPLAEGITNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQL  770

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVLATF +CL+TPR +LK+++KS++GN+LD PTANLVCKMR
Sbjct  771  SVDIEYLSNVLSALSMPIPPVLATFQTCLATPRGELKDVMKSEAGNELDCPTANLVCKMR  830

Query  206  RVSLE  192
            R+S +
Sbjct  831  RISFD  835



>ref|XP_010062289.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Eucalyptus grandis]
Length=722

 Score =   324 bits (830),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ   D+SRLP+WSSVEE SA  LPTFS+YPQ YVT++GEYLL
Sbjct  538  FADTVNELVYDVLISKVRQRLYDVSRLPVWSSVEEPSAFHLPTFSSYPQPYVTSIGEYLL  597

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+ DA+ DEAQ+FATEWMFKVAEGATAL+++QLRGIQY+TDRGAQQL
Sbjct  598  TLPQQLEPLAEGISSGDASNDEAQFFATEWMFKVAEGATALFMEQLRGIQYMTDRGAQQL  657

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMPVP VLATF +C STPR QLK+LVKSD+ NQLDLPTANLVCKMR
Sbjct  658  SVDIEYLSNVLSALSMPVPAVLATFQTCFSTPRDQLKDLVKSDAANQLDLPTANLVCKMR  717

Query  206  RVSLE  192
            RVSL+
Sbjct  718  RVSLD  722



>gb|AIU51116.1| embryo yellow protein, partial [Capsella rubella]
Length=835

 Score =   326 bits (835),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLL
Sbjct  651  FADTVNELVYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLL  710

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGI+N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQL
Sbjct  711  TLPQQLEPLAEGITNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQL  770

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PPVLATF +CL+TPR QLK+++KS++G++LD PTANLVCKMR
Sbjct  771  SVDIEYLSNVLSALSMPIPPVLATFQTCLATPRDQLKDVMKSEAGSELDFPTANLVCKMR  830

Query  206  RVSLE  192
            R+S +
Sbjct  831  RISFD  835



>ref|XP_004506344.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cicer arietinum]
Length=835

 Score =   326 bits (835),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 173/186 (93%), Gaps = 2/186 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA PLPTFSAYPQSYVT+VGEYLL
Sbjct  650  FADTVNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAFPLPTFSAYPQSYVTSVGEYLL  709

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+S+ N DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQL
Sbjct  710  TLPQQLEPLAEGISSSETN-DEAQFFATEWMFKVAEGATALYIEQLRGIQYITDRGAQQL  768

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS-DSGNQLDLPTANLVCKM  210
            SVDI+YLSNVLSALSMP+P VLATF SCLST R QLK+L+K+ DS NQLDLPTANLVCKM
Sbjct  769  SVDIDYLSNVLSALSMPIPAVLATFQSCLSTSRDQLKDLLKTPDSANQLDLPTANLVCKM  828

Query  209  RRVSLE  192
            RRV+L+
Sbjct  829  RRVNLD  834



>gb|AIU51108.1| embryo yellow protein, partial [Pinellia ternata]
Length=829

 Score =   325 bits (832),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  ND++RLPIWSSVEE SA PLPTFSAYPQSYVT++GEYLL
Sbjct  647  FADTVNELVYDVLISKVRQRLNDVARLPIWSSVEEQSAHPLPTFSAYPQSYVTSIGEYLL  706

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+S+  A+EAQ FATEWMFKVAEGATALY++QLRGIQYITDRGAQQL
Sbjct  707  TLPQQLEPLAEGISSSEPGAEEAQLFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQL  766

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVLSALSMP+PP LATFH+C+STPR QL E +KSD G+QLDLPTA+LVC++R
Sbjct  767  SADIEYLSNVLSALSMPIPPFLATFHTCVSTPRDQLPEQIKSDGGSQLDLPTAHLVCRIR  826

Query  206  RVS  198
            R++
Sbjct  827  RIT  829



>ref|XP_010692941.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Beta 
vulgaris subsp. vulgaris]
Length=836

 Score =   325 bits (833),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FA+ VNELVYDVLISKVRQ  +DLSR+PIWSS EE SA  LP+FSAYPQSYVT+VGEYLL
Sbjct  651  FAETVNELVYDVLISKVRQRLSDLSRMPIWSSAEETSAFHLPSFSAYPQSYVTSVGEYLL  710

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+ DAN DEAQ+FATEWMFKVAEGATA+Y++QLRGIQYITDRGAQQL
Sbjct  711  TLPQQLEPLAEGISSDDANTDEAQFFATEWMFKVAEGATAIYIEQLRGIQYITDRGAQQL  770

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYL+NVLSALS+P+PP+L+TF +CLSTPR QL++L+KSDSG QLDL TANL+CKMR
Sbjct  771  SVDIEYLANVLSALSVPIPPILSTFQTCLSTPRDQLRDLIKSDSGTQLDLSTANLICKMR  830

Query  206  RVSLE  192
            R++L+
Sbjct  831  RLNLD  835



>ref|XP_010062284.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Eucalyptus grandis]
 gb|KCW90838.1| hypothetical protein EUGRSUZ_A02893 [Eucalyptus grandis]
 gb|AIU51118.1| embryo yellow protein, partial [Eucalyptus grandis]
Length=838

 Score =   324 bits (831),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ   D+SRLP+WSSVEE SA  LPTFS+YPQ YVT++GEYLL
Sbjct  654  FADTVNELVYDVLISKVRQRLYDVSRLPVWSSVEEPSAFHLPTFSSYPQPYVTSIGEYLL  713

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+ DA+ DEAQ+FATEWMFKVAEGATAL+++QLRGIQY+TDRGAQQL
Sbjct  714  TLPQQLEPLAEGISSGDASNDEAQFFATEWMFKVAEGATALFMEQLRGIQYMTDRGAQQL  773

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMPVP VLATF +C STPR QLK+LVKSD+ NQLDLPTANLVCKMR
Sbjct  774  SVDIEYLSNVLSALSMPVPAVLATFQTCFSTPRDQLKDLVKSDAANQLDLPTANLVCKMR  833

Query  206  RVSLE  192
            RVSL+
Sbjct  834  RVSLD  838



>gb|AIU51112.1| embryo yellow protein, partial [Sarcandra glabra]
Length=836

 Score =   324 bits (830),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D+SRLPIWSS++E SA PLP+FSAYPQ YVT+VGEYLL
Sbjct  655  FADTVNELVYDVLISKVRQRLSDVSRLPIWSSIDEPSAFPLPSFSAYPQPYVTSVGEYLL  714

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+S+AN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQL
Sbjct  715  TLPQQLEPLAEGISSSEANTDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQL  774

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVLSALSMP+PP+LATFH+CLST R QL++LVKS+  NQLDLPTA+LVCK+R
Sbjct  775  SADIEYLSNVLSALSMPIPPILATFHTCLSTQRDQLRDLVKSEGSNQLDLPTAHLVCKIR  834

Query  206  RV  201
            RV
Sbjct  835  RV  836



>ref|XP_002865861.1| hypothetical protein ARALYDRAFT_495214 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42120.1| hypothetical protein ARALYDRAFT_495214 [Arabidopsis lyrata subsp. 
lyrata]
Length=836

 Score =   324 bits (830),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 171/186 (92%), Gaps = 1/186 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLL
Sbjct  651  FADTVNELVYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLL  710

Query  566  TLPQQLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQ  390
            TLPQQLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQ
Sbjct  711  TLPQQLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQ  770

Query  389  LSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKM  210
            LSVDIEYLSNVLSALSMP+PPVLATF +CL+TPR  LK+L+KS++GN+LD PTANLVCKM
Sbjct  771  LSVDIEYLSNVLSALSMPIPPVLATFQTCLATPRDDLKDLMKSEAGNELDFPTANLVCKM  830

Query  209  RRVSLE  192
            RR+S +
Sbjct  831  RRISFD  836



>ref|XP_006401980.1| hypothetical protein EUTSA_v10012691mg [Eutrema salsugineum]
 gb|ESQ43433.1| hypothetical protein EUTSA_v10012691mg [Eutrema salsugineum]
Length=832

 Score =   323 bits (829),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 172/186 (92%), Gaps = 1/186 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYD+LISKVRQ   D+SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLL
Sbjct  647  FADTVNELVYDILISKVRQRLGDVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLL  706

Query  566  TLPQQLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQ  390
            TLPQQLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALYVDQLRGIQYI+DRGAQQ
Sbjct  707  TLPQQLEPLAEGISSNGDSNNEDAQFFATEWMFKVAEGATALYVDQLRGIQYISDRGAQQ  766

Query  389  LSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKM  210
            LSVDIEYLSNVLSALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKM
Sbjct  767  LSVDIEYLSNVLSALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKM  826

Query  209  RRVSLE  192
            RR+S +
Sbjct  827  RRISFD  832



>ref|NP_199956.1| COG7-like protein EYE [Arabidopsis thaliana]
 dbj|BAB09754.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96080.1| COG complex component-related protein [Arabidopsis thaliana]
Length=836

 Score =   323 bits (828),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 172/186 (92%), Gaps = 1/186 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLL
Sbjct  651  FADTVNELVYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLL  710

Query  566  TLPQQLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQ  390
            TLPQQLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQ
Sbjct  711  TLPQQLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQ  770

Query  389  LSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKM  210
            LSVDIEYLSNVLSALSMP+PPVLATF +CL+TPR +LK+++KS++GN+LD PTANLVCKM
Sbjct  771  LSVDIEYLSNVLSALSMPIPPVLATFQTCLATPRGELKDVMKSEAGNELDCPTANLVCKM  830

Query  209  RRVSLE  192
            RR+S +
Sbjct  831  RRISFD  836



>gb|AIU51128.1| embryo yellow protein, partial [Aristolochia tagala]
Length=834

 Score =   323 bits (828),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA PLP+FSAYPQSYVT+VGEYLL
Sbjct  652  FADTVNELVYDVLISKVRQRLSDVSRLPIWSSVEEPSAHPLPSFSAYPQSYVTSVGEYLL  711

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGI++ ++N DEAQ+FATEWMFKVAEGATALY +QLRGIQYITDRGAQQL
Sbjct  712  TLPQQLEPLAEGIASRESNTDEAQFFATEWMFKVAEGATALYTEQLRGIQYITDRGAQQL  771

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            + DIEYLSNVLSALS+P+P VLATF +CLSTPR QL++LVKSD GNQLDLPTANL+CK+R
Sbjct  772  AADIEYLSNVLSALSVPIPQVLATFLTCLSTPREQLRDLVKSDGGNQLDLPTANLICKIR  831

Query  206  RVS  198
            R++
Sbjct  832  RIA  834



>dbj|BAF00649.1| hypothetical protein [Arabidopsis thaliana]
Length=836

 Score =   323 bits (828),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 172/186 (92%), Gaps = 1/186 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLL
Sbjct  651  FADTVNELVYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLL  710

Query  566  TLPQQLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQ  390
            TLPQQLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQ
Sbjct  711  TLPQQLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQ  770

Query  389  LSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKM  210
            LSVDIEYLSNVLSALSMP+PPVLATF +CL+TPR +LK+++KS++GN+LD PTANLVCKM
Sbjct  771  LSVDIEYLSNVLSALSMPIPPVLATFQTCLATPRGELKDVMKSEAGNELDCPTANLVCKM  830

Query  209  RRVSLE  192
            RR+S +
Sbjct  831  RRISFD  836



>ref|XP_008439087.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cucumis 
melo]
Length=834

 Score =   323 bits (827),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D+SRLPIWSSVEEHSA PLPTFS+YPQSYVT+VGEYLL
Sbjct  650  FADKVNELVYDVLISKVRQRLSDVSRLPIWSSVEEHSALPLPTFSSYPQSYVTSVGEYLL  709

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNS+AN DEAQ+FA EWM KVAEG  ALY +QLRGIQ++TDRGAQQL
Sbjct  710  TLPQQLEPLAEGISNSNANNDEAQFFAAEWMCKVAEGTAALYTEQLRGIQHVTDRGAQQL  769

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYL+NVLSALSM +PP L+TF +C STPR QLK+L+KSDSG +LDLPTANLVCKMR
Sbjct  770  SVDIEYLTNVLSALSMEIPPALSTFLTCFSTPREQLKDLLKSDSGRELDLPTANLVCKMR  829

Query  206  RVSLE  192
            RV+L+
Sbjct  830  RVNLD  834



>ref|XP_004148143.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cucumis sativus]
 gb|KGN57266.1| hypothetical protein Csa_3G175670 [Cucumis sativus]
Length=834

 Score =   322 bits (826),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D+SRLPIWSSVEEHSA PLPTFS+YPQSYVT+VGEYLL
Sbjct  650  FADKVNELVYDVLISKVRQRLSDVSRLPIWSSVEEHSALPLPTFSSYPQSYVTSVGEYLL  709

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNS+AN DEAQ+FA EWM KVAEG  ALY +QLRGIQ++TDRGAQQL
Sbjct  710  TLPQQLEPLAEGISNSNANNDEAQFFAAEWMCKVAEGTAALYTEQLRGIQHVTDRGAQQL  769

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYL+NVLSALSM +PP LATF +CLST R QLK+L+KSDSG +LDLPTANLVCKMR
Sbjct  770  SVDIEYLTNVLSALSMEIPPALATFLTCLSTSREQLKDLLKSDSGRELDLPTANLVCKMR  829

Query  206  RVSLE  192
            RV+L+
Sbjct  830  RVNLD  834



>ref|XP_004165037.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cucumis sativus]
Length=834

 Score =   322 bits (826),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D+SRLPIWSSVEEHSA PLPTFS+YPQSYVT+VGEYLL
Sbjct  650  FADKVNELVYDVLISKVRQRLSDVSRLPIWSSVEEHSALPLPTFSSYPQSYVTSVGEYLL  709

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNS+AN DEAQ+FA EWM KVAEG  ALY +QLRGIQ++TDRGAQQL
Sbjct  710  TLPQQLEPLAEGISNSNANNDEAQFFAAEWMCKVAEGTAALYTEQLRGIQHVTDRGAQQL  769

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYL+NVLSALSM +PP LATF +CLST R QLK+L+KSDSG +LDLPTANLVCKMR
Sbjct  770  SVDIEYLTNVLSALSMEIPPALATFLTCLSTSREQLKDLLKSDSGRELDLPTANLVCKMR  829

Query  206  RVSLE  192
            RV+L+
Sbjct  830  RVNLD  834



>ref|XP_006280007.1| hypothetical protein CARUB_v10025880mg [Capsella rubella]
 gb|EOA12905.1| hypothetical protein CARUB_v10025880mg [Capsella rubella]
Length=836

 Score =   322 bits (826),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 172/186 (92%), Gaps = 1/186 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLL
Sbjct  651  FADTVNELVYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLL  710

Query  566  TLPQQLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQ  390
            TLPQQLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQ
Sbjct  711  TLPQQLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQ  770

Query  389  LSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKM  210
            LSVDIEYLSNVLSALSMP+PPVLATF +CL+TPR QLK+++KS++G++LD PTANLVCKM
Sbjct  771  LSVDIEYLSNVLSALSMPIPPVLATFQTCLATPRDQLKDVMKSEAGSELDFPTANLVCKM  830

Query  209  RRVSLE  192
            RR+S +
Sbjct  831  RRISFD  836



>ref|XP_010443240.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=836

 Score =   322 bits (824),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 172/186 (92%), Gaps = 1/186 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLL
Sbjct  651  FADTVNELVYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLL  710

Query  566  TLPQQLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQ  390
            TLPQQLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQ
Sbjct  711  TLPQQLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQ  770

Query  389  LSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKM  210
            LSVDIEYLSNVLSALSMPVPPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKM
Sbjct  771  LSVDIEYLSNVLSALSMPVPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKM  830

Query  209  RRVSLE  192
            RR+S +
Sbjct  831  RRISFD  836



>ref|XP_010482477.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=836

 Score =   322 bits (824),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 172/186 (92%), Gaps = 1/186 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLL
Sbjct  651  FADTVNELVYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLL  710

Query  566  TLPQQLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQ  390
            TLPQQLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQ
Sbjct  711  TLPQQLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQ  770

Query  389  LSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKM  210
            LSVDIEYLSNVLSALSMPVPPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKM
Sbjct  771  LSVDIEYLSNVLSALSMPVPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKM  830

Query  209  RRVSLE  192
            RR+S +
Sbjct  831  RRISFD  836



>dbj|BAG15881.1| conserved oligomeric Golgi complex component 7-related [Arabidopsis 
thaliana]
Length=836

 Score =   320 bits (821),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 172/186 (92%), Gaps = 1/186 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLL
Sbjct  651  FADTVNELVYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLL  710

Query  566  TLPQQLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQ  390
            TLPQQLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQ
Sbjct  711  TLPQQLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQ  770

Query  389  LSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKM  210
            LSVDIEYLSNVLSALSMP+PPVLATF +CL+TPR +LK+++KS++GN+LD PTA+LVCKM
Sbjct  771  LSVDIEYLSNVLSALSMPIPPVLATFQTCLATPRGELKDVMKSEAGNELDCPTASLVCKM  830

Query  209  RRVSLE  192
            RR+S +
Sbjct  831  RRISFD  836



>ref|XP_010934963.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Elaeis 
guineensis]
Length=824

 Score =   320 bits (820),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 173/185 (94%), Gaps = 1/185 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  ND+SR+PIWSSVEE SA PLP+FSAYPQ+YVT++GEYLL
Sbjct  640  FSDTVNELVYDVLISKVRQRLNDVSRMPIWSSVEEPSALPLPSFSAYPQAYVTSIGEYLL  699

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+S+A  +EAQ+FA+EWMFKVAEGATAL+++QLRGIQYITDRGAQQL
Sbjct  700  TLPQQLEPLAEGISSSEAGTEEAQFFASEWMFKVAEGATALFMEQLRGIQYITDRGAQQL  759

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVLSALSMP+PP L TFH+CLSTPR Q+++L+KSD GNQLDLPTA+LVCK+R
Sbjct  760  SADIEYLSNVLSALSMPIPPFLTTFHTCLSTPRDQIRDLLKSD-GNQLDLPTAHLVCKIR  818

Query  206  RVSLE  192
            R++L+
Sbjct  819  RIALD  823



>gb|AIU51105.1| embryo yellow protein, partial [Lilium brownii]
Length=450

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +++SRLPIWSSVEE S+ PLP+FSAYPQ+YVT+VGEYLL
Sbjct  269  FADTVNELVYDVLISKVRQRLSEVSRLPIWSSVEEPSSLPLPSFSAYPQAYVTSVGEYLL  328

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+S+ NA+EAQ+FATEWMFKVAEGAT L+++QLRGI YIT+RGAQQL
Sbjct  329  TLPQQLEPLAEGISSSENNAEEAQFFATEWMFKVAEGATDLFMEQLRGIHYITERGAQQL  388

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYL+NVLSALSMP+PP L TFH+CLSTPR Q +EL+K+D G+QLD PTA+LVCK+R
Sbjct  389  SADIEYLTNVLSALSMPIPPFLTTFHTCLSTPRDQFRELLKADGGSQLDQPTAHLVCKIR  448

Query  206  RV  201
            R+
Sbjct  449  RL  450



>ref|XP_006838140.1| hypothetical protein AMTR_s00106p00086320 [Amborella trichopoda]
 gb|ERN00709.1| hypothetical protein AMTR_s00106p00086320 [Amborella trichopoda]
Length=827

 Score =   319 bits (818),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F++AVNELVYDVLISKVRQ  +D+++LP+WSSVEE  +  +P+FSAYPQ+YVT+VGEYLL
Sbjct  643  FSEAVNELVYDVLISKVRQRLSDVAKLPVWSSVEETVSHKMPSFSAYPQAYVTSVGEYLL  702

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGISNS++NADE+Q+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQL
Sbjct  703  TLPQQLEPLAEGISNSESNADESQFFATEWMFKVAEGATALYIEQLRGIQYITDRGAQQL  762

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVLSALSMPV P L+TFH+CL T R QL++LVKSD GNQLDLPTA L+CKMR
Sbjct  763  SADIEYLSNVLSALSMPVAPFLSTFHTCLLTQRDQLRDLVKSDGGNQLDLPTARLLCKMR  822

Query  206  RVSLE  192
            RVSL+
Sbjct  823  RVSLD  827



>ref|NP_001132532.1| uncharacterized protein LOC100193995 [Zea mays]
 gb|ACF81411.1| unknown [Zea mays]
Length=344

 Score =   305 bits (782),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLL
Sbjct  160  FSDTVNELVYDVLISKVRQRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLL  219

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS ++A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRG+QQL
Sbjct  220  TLPQQLEPLAEGISGNEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGSQQL  279

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            + DIEYL+NVLSALSMP+PP L+TFH+C+STPR Q+++L+KSD  +QLDLPT +LVCK+R
Sbjct  280  AADIEYLNNVLSALSMPIPPFLSTFHACVSTPRDQVRDLIKSDGASQLDLPTTHLVCKIR  339

Query  206  RVSLE  192
            R++L+
Sbjct  340  RITLD  344



>gb|AIU51143.1| embryo yellow protein, partial [Yucca filamentosa]
Length=822

 Score =   318 bits (816),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  +D+SR+P+WSSVEE SA PLP+FSAYPQ+Y+T+VGEYLL
Sbjct  640  FADTVNELVYDVLISKVRQRLSDVSRMPVWSSVEEPSALPLPSFSAYPQAYITSVGEYLL  699

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+SD   DEAQ+FATEWMFKVAEGATAL+++QLRGI YITDRGAQQL
Sbjct  700  TLPQQLEPLAEGISSSDGGTDEAQFFATEWMFKVAEGATALFMEQLRGIHYITDRGAQQL  759

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVLSALSMP+PP L+T+H+CLSTPR QL++L+KS++G+QLD+PTA+LVCK+R
Sbjct  760  SADIEYLSNVLSALSMPIPPFLSTYHTCLSTPRDQLQDLIKSEAGSQLDIPTAHLVCKIR  819

Query  206  RVS  198
            R++
Sbjct  820  RIA  822



>ref|XP_008796946.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Phoenix 
dactylifera]
Length=824

 Score =   318 bits (816),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 172/185 (93%), Gaps = 1/185 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  ND+SR+PIWSSVEE SA PLP+FSAYPQ+YVT+VGEYLL
Sbjct  640  FSDTVNELVYDVLISKVRQRLNDVSRMPIWSSVEEPSALPLPSFSAYPQAYVTSVGEYLL  699

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+S+A  +EAQ+FATEWMFKVAEGATAL+++QLRGIQYITDRGAQQL
Sbjct  700  TLPQQLEPLAEGISSSEAGTEEAQFFATEWMFKVAEGATALFMEQLRGIQYITDRGAQQL  759

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVLSALSMP+P  L TFH+CLSTPR Q+++L+KSD GNQLDLPTA+LVCK+R
Sbjct  760  SADIEYLSNVLSALSMPIPAFLTTFHTCLSTPRDQIRDLLKSD-GNQLDLPTAHLVCKIR  818

Query  206  RVSLE  192
            R++L+
Sbjct  819  RIALD  823



>ref|XP_003618191.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES74409.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=828

 Score =   318 bits (816),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 167/185 (90%), Gaps = 1/185 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F D VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LP FSAYPQSYVT+VGEYLL
Sbjct  644  FEDMVNELVYDVLISKVRQCLSDVSRLPIWSSVEEQSAFHLPAFSAYPQSYVTSVGEYLL  703

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS  +AN DEAQ+FATEWMFK+AEGAT LY++QLRGIQYITDRGAQQL
Sbjct  704  TLPQQLEPLAEGISTGEAN-DEAQFFATEWMFKIAEGATTLYIEQLRGIQYITDRGAQQL  762

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDI+YLSNVLSALSMP+P VL TFHSCLST R QLK+L+K+DS N LDLPTANLVCKMR
Sbjct  763  SVDIDYLSNVLSALSMPIPAVLTTFHSCLSTSRDQLKDLLKTDSANHLDLPTANLVCKMR  822

Query  206  RVSLE  192
            RV+L+
Sbjct  823  RVNLD  827



>gb|AIU51129.1| embryo yellow protein, partial [Medicago truncatula]
Length=827

 Score =   318 bits (816),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 167/185 (90%), Gaps = 1/185 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F D VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LP FSAYPQSYVT+VGEYLL
Sbjct  644  FEDMVNELVYDVLISKVRQCLSDVSRLPIWSSVEEQSAFHLPAFSAYPQSYVTSVGEYLL  703

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS  +AN DEAQ+FATEWMFK+AEGAT LY++QLRGIQYITDRGAQQL
Sbjct  704  TLPQQLEPLAEGISTGEAN-DEAQFFATEWMFKIAEGATTLYIEQLRGIQYITDRGAQQL  762

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDI+YLSNVLSALSMP+P VL TFHSCLST R QLK+L+K+DS N LDLPTANLVCKMR
Sbjct  763  SVDIDYLSNVLSALSMPIPAVLTTFHSCLSTSRDQLKDLLKTDSANHLDLPTANLVCKMR  822

Query  206  RVSLE  192
            RV+L+
Sbjct  823  RVNLD  827



>gb|KFK26748.1| hypothetical protein AALP_AA8G288200 [Arabis alpina]
Length=836

 Score =   318 bits (816),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 171/186 (92%), Gaps = 1/186 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ   D+S LPIWSSVEE +A PLP FS+YPQSYVT+VGEYLL
Sbjct  651  FADTVNELVYDVLISKVRQRLGDVSHLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLL  710

Query  566  TLPQQLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQ  390
            TLPQQLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQ
Sbjct  711  TLPQQLEPLAEGISSNGDSNNEDAQFFATEWMFKVAEGATALYMEQLRGIQYISDRGAQQ  770

Query  389  LSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKM  210
            LSVDIEYLSNVLSALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKM
Sbjct  771  LSVDIEYLSNVLSALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKM  830

Query  209  RRVSLE  192
            RR+S +
Sbjct  831  RRISFD  836



>ref|XP_010442640.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=681

 Score =   314 bits (805),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 170/186 (91%), Gaps = 1/186 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ   ++SRLPIWSSVEE +A  LP FS+YPQSYVT+VGEYLL
Sbjct  496  FADTVNELVYDVLISKVRQRLGEVSRLPIWSSVEEQTAFSLPNFSSYPQSYVTSVGEYLL  555

Query  566  TLPQQLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQ  390
            TLPQQLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQ
Sbjct  556  TLPQQLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQ  615

Query  389  LSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKM  210
            LSVDIEYLSNVLSALSMPVPPVLATF +CL+TPR +LK+++KS++G++LD  TANLVCKM
Sbjct  616  LSVDIEYLSNVLSALSMPVPPVLATFQTCLATPRDELKDVMKSEAGSELDFHTANLVCKM  675

Query  209  RRVSLE  192
            RR+S +
Sbjct  676  RRISFD  681



>gb|AIU51154.1| embryo yellow protein, partial [Houttuynia cordata]
Length=833

 Score =   318 bits (814),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD+VNELVYDVLISKVR   ND+S+LPIWS+VEE SA PLP+FSAYPQ YVT++GEYLL
Sbjct  651  FADSVNELVYDVLISKVRHRLNDVSQLPIWSAVEEPSAFPLPSFSAYPQLYVTSIGEYLL  710

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS++D+N+DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQL
Sbjct  711  TLPQQLEPLAEGISSNDSNSDEAQFFATEWMFKVAEGATALYLEQLRGIQYITDRGAQQL  770

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVLSALS P+P  LATFH+CLST R QL +LVKSD GNQLDLPTA+LVCK+R
Sbjct  771  SADIEYLSNVLSALSTPIPLALATFHTCLSTARDQLHDLVKSDGGNQLDLPTAHLVCKIR  830

Query  206  RVS  198
            R++
Sbjct  831  RIT  833



>ref|XP_006657236.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Oryza brachyantha]
Length=824

 Score =   317 bits (812),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  N+++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLL
Sbjct  640  FSDTVNELVYDVLISKVRQRLNEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLL  699

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS S+A  +EAQ+FATEW+FKVAEGATAL+ +QLRGI YITDRGAQQL
Sbjct  700  TLPQQLEPLAEGISGSEAGNEEAQFFATEWIFKVAEGATALFTEQLRGIHYITDRGAQQL  759

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            + DIEYLSNVLSALSMP+PP LATFH+C+STPR Q++EL+KSD G+QLDLPTA+LVCK+R
Sbjct  760  AADIEYLSNVLSALSMPIPPFLATFHTCISTPRDQVRELIKSDGGSQLDLPTAHLVCKIR  819

Query  206  RVS  198
            R+S
Sbjct  820  RIS  822



>gb|AIU51127.1| embryo yellow protein, partial [Asparagus officinalis]
Length=822

 Score =   317 bits (811),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ  ND+SR+PIWSSVEE SA PLP+FSAYPQ+YVT+VGEYLL
Sbjct  640  FADTVNELVYDVLISKVRQRLNDVSRMPIWSSVEEQSALPLPSFSAYPQAYVTSVGEYLL  699

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS++D   DEAQ+FATEWMFKVAEGATAL+++QLRGI YITDRGAQQL
Sbjct  700  TLPQQLEPLAEGISSNDGGTDEAQFFATEWMFKVAEGATALFMEQLRGIHYITDRGAQQL  759

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVL ALSMP+PP L+T+H+CLS PR QL++L+KS+ G+QLD+PTA+LVCK+R
Sbjct  760  SADIEYLSNVLFALSMPIPPFLSTYHTCLSKPRDQLRDLIKSEPGSQLDVPTAHLVCKIR  819

Query  206  RVS  198
            R++
Sbjct  820  RIA  822



>ref|XP_009127310.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Brassica rapa]
Length=829

 Score =   317 bits (811),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 171/186 (92%), Gaps = 1/186 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VN+LVYD+LISKVRQ   ++SRLPIWSS EE SA PLP+FS+YPQSYVT+VGEYLL
Sbjct  644  FADTVNKLVYDILISKVRQRLGEVSRLPIWSSSEEQSAFPLPSFSSYPQSYVTSVGEYLL  703

Query  566  TLPQQLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQ  390
            TLPQQLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALYV+QLRGIQYITDRGAQQ
Sbjct  704  TLPQQLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYVEQLRGIQYITDRGAQQ  763

Query  389  LSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKM  210
            LSVDIEYLSNVL ALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKM
Sbjct  764  LSVDIEYLSNVLLALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKM  823

Query  209  RRVSLE  192
            RR+S +
Sbjct  824  RRISFD  829



>ref|XP_010264264.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nelumbo 
nucifera]
Length=839

 Score =   317 bits (811),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FA+ VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA PLP+FSAYPQ+YVT+VGEYLL
Sbjct  654  FAEIVNELVYDVLISKVRQRLSDVSRLPIWSSVEEPSAFPLPSFSAYPQTYVTSVGEYLL  713

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+SDANADEAQ+FATEWMFKVAEGA A+Y +QLRGIQYITDRGAQQL
Sbjct  714  TLPQQLEPLAEGISSSDANADEAQFFATEWMFKVAEGAVAIYTEQLRGIQYITDRGAQQL  773

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVLSALSMPVP VL+TFH+ LST R ++++L+KSD+ +QLDLPTA+LVCKMR
Sbjct  774  SADIEYLSNVLSALSMPVPQVLSTFHTFLSTSRDKIQDLLKSDAVSQLDLPTAHLVCKMR  833

Query  206  RVSLE  192
            RV+L+
Sbjct  834  RVTLD  838



>ref|XP_010536539.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Tarenaya 
hassleriana]
Length=837

 Score =   316 bits (810),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 170/186 (91%), Gaps = 1/186 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ   D+S +PIWS+ EE +A PLPTFS+YPQSYVT+VGEYLL
Sbjct  652  FADTVNELVYDVLISKVRQRLGDVSHMPIWSAAEEQTAFPLPTFSSYPQSYVTSVGEYLL  711

Query  566  TLPQQLEPLAEGISN-SDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQ  390
            TLPQQLEPLAEGISN SDAN ++AQ+FATEWMFKVAEGATALY++QLRGIQ+ +DRGAQQ
Sbjct  712  TLPQQLEPLAEGISNNSDANNEDAQFFATEWMFKVAEGATALYMEQLRGIQHASDRGAQQ  771

Query  389  LSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKM  210
            LSVDIEYLSNVLSALSMP+PPVLATF +CL+T R QLK+L++S++ NQLDLPTANLVCKM
Sbjct  772  LSVDIEYLSNVLSALSMPIPPVLATFQTCLATSREQLKDLMRSEAANQLDLPTANLVCKM  831

Query  209  RRVSLE  192
            RRVS +
Sbjct  832  RRVSFD  837



>ref|XP_003563389.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Brachypodium 
distachyon]
Length=825

 Score =   315 bits (807),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  +++SRLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLL
Sbjct  641  FSDTVNELVYDVLISKVRQRLSEISRLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLL  700

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS S+A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL
Sbjct  701  TLPQQLEPLAEGISGSEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQL  760

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            + DIEYL+NVLSALSMP+PP L+TFH+C+STPR Q++ L+KSD G+QLDLPTANLVCK+R
Sbjct  761  AADIEYLNNVLSALSMPIPPFLSTFHTCISTPRDQVRGLIKSDGGSQLDLPTANLVCKIR  820

Query  206  RVSLE  192
            R+ LE
Sbjct  821  RIPLE  825



>gb|EMS57916.1| hypothetical protein TRIUR3_24838 [Triticum urartu]
Length=706

 Score =   312 bits (800),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ   +++RLPIWSSVEE    PLP+FSAYPQSYVT+VGEYLL
Sbjct  522  FSDKVNELVYDVLISKVRQRLCEIARLPIWSSVEEQGGLPLPSFSAYPQSYVTSVGEYLL  581

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS S+A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL
Sbjct  582  TLPQQLEPLAEGISGSEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQL  641

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            + DIEYL+NVLSALSMP+PP L+TFH+C+STPR Q+++L+KSD G QLDLPTA+LV K+R
Sbjct  642  AADIEYLNNVLSALSMPIPPFLSTFHACISTPRDQVRDLIKSDGGTQLDLPTAHLVSKIR  701

Query  206  RVSLE  192
            R+SLE
Sbjct  702  RISLE  706



>gb|EMT03910.1| hypothetical protein F775_26031 [Aegilops tauschii]
Length=697

 Score =   312 bits (799),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLL
Sbjct  513  FSDKVNELVYDVLISKVRQRLSEIARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLL  572

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS S+A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL
Sbjct  573  TLPQQLEPLAEGISGSEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQL  632

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            + DIEYL+NVLSALSMP+PP L+TFH+C+STPR Q+++L+KSD G QLDLPTA+LV K+R
Sbjct  633  AADIEYLNNVLSALSMPIPPFLSTFHACISTPRDQVRDLIKSDGGAQLDLPTAHLVSKIR  692

Query  206  RVSLE  192
            R+SLE
Sbjct  693  RISLE  697



>gb|AIU51102.1| embryo yellow protein, partial [Aquilegia coerulea]
Length=835

 Score =   314 bits (805),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VN+LVYDVLISKVRQ  +D++RLPIWS +EE S   LP+FS YPQSYVT+VGEYLL
Sbjct  651  FADTVNDLVYDVLISKVRQRLSDVARLPIWSKIEEPSTFALPSFSVYPQSYVTSVGEYLL  710

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQ EPLAEGIS  D+N DEAQ+ ATEWMFKVAEGA  LY +QLRGI YIT+RGAQQL
Sbjct  711  TLPQQFEPLAEGISGGDSNTDEAQFLATEWMFKVAEGAAVLYTEQLRGIHYITERGAQQL  770

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVLSALSMP+PPVLATFH+C STPR QL ELVKSD GN+LDLPTANLVCK+R
Sbjct  771  SADIEYLSNVLSALSMPIPPVLATFHTCFSTPREQLPELVKSDGGNELDLPTANLVCKIR  830

Query  206  RVSLE  192
            RV+L+
Sbjct  831  RVALD  835



>gb|AIU51109.1| embryo yellow protein, partial [Brachypodium distachyon]
Length=784

 Score =   313 bits (802),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  +++SRLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLL
Sbjct  603  FSDTVNELVYDVLISKVRQRLSEISRLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLL  662

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS S+A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL
Sbjct  663  TLPQQLEPLAEGISGSEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQL  722

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            + DIEYL+NVLSALSMP+PP L+TFH+C+STPR Q++ L+KSD G+QLDLPTANLVCK+R
Sbjct  723  AADIEYLNNVLSALSMPIPPFLSTFHTCISTPRDQVRGLIKSDGGSQLDLPTANLVCKIR  782

Query  206  RV  201
            R+
Sbjct  783  RI  784



>gb|EEE66191.1| hypothetical protein OsJ_22310 [Oryza sativa Japonica Group]
Length=790

 Score =   313 bits (801),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  N+++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLL
Sbjct  605  FSDTVNELVYDVLISKVRQRLNEVARLPIWSSVEEPGGLPLPSFSAYPQAYVTSVGEYLL  664

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS  +A  +EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL
Sbjct  665  TLPQQLEPLAEGISGGEAGNEEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQL  724

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            + DIEYLSNVLSALSMP+PP LATFH+C+STPR Q+++L+KSD G+QLDLPTA+LVCK+R
Sbjct  725  AADIEYLSNVLSALSMPIPPFLATFHTCISTPRDQVRDLIKSDGGSQLDLPTAHLVCKIR  784

Query  206  RVS  198
            R+S
Sbjct  785  RIS  787



>gb|AIU51130.1| embryo yellow protein, partial [Canna indica]
Length=815

 Score =   313 bits (802),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  +D+SRLPIWSSVEE S+ PLP+FSAYPQ+YVT+VGEYLL
Sbjct  633  FSDTVNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSSLPLPSFSAYPQAYVTSVGEYLL  692

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS S+A  +EAQ+FATEWMFKVAEGATAL+++QLRGIQYITDRGA QL
Sbjct  693  TLPQQLEPLAEGISGSEAGTEEAQFFATEWMFKVAEGATALFMEQLRGIQYITDRGALQL  752

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYL+NVLSALSM +PP L TFH+C+STPR QL +L+KSD GNQLD+PTA+LVCK+R
Sbjct  753  SADIEYLNNVLSALSMTIPPFLMTFHTCISTPREQLPDLIKSDGGNQLDIPTAHLVCKIR  812

Query  206  RVS  198
            R++
Sbjct  813  RIT  815



>gb|EEC81147.1| hypothetical protein OsI_24056 [Oryza sativa Indica Group]
Length=825

 Score =   313 bits (802),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  N+++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLL
Sbjct  640  FSDTVNELVYDVLISKVRQRLNEVARLPIWSSVEEPGGLPLPSFSAYPQAYVTSVGEYLL  699

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS  +A  +EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL
Sbjct  700  TLPQQLEPLAEGISGGEAGNEEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQL  759

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            + DIEYLSNVLSALSMP+PP LATFH+C+STPR Q+++L+KSD G+QLDLPTA+LVCK+R
Sbjct  760  AADIEYLSNVLSALSMPIPPFLATFHTCISTPRDQVRDLIKSDGGSQLDLPTAHLVCKIR  819

Query  206  RVS  198
            R+S
Sbjct  820  RIS  822



>gb|AIU51142.1| embryo yellow protein, partial [Dioscorea oppositifolia]
Length=831

 Score =   313 bits (802),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FA+ VNELVYDVLISKVRQ  +DLSRLPIWSSVEE SA PLP+FSAYPQ YVT+VGEYLL
Sbjct  649  FAETVNELVYDVLISKVRQRLSDLSRLPIWSSVEEQSALPLPSFSAYPQPYVTSVGEYLL  708

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+S+   DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL
Sbjct  709  TLPQQLEPLAEGISSSETGTDEAQFFATEWVFKVAEGATALFMEQLRGIHYITDRGAQQL  768

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVLSALSMP+PP L+TFH+CLSTPR Q+++L+K D+ +QLDLPTA+LVCK+R
Sbjct  769  SADIEYLSNVLSALSMPIPPFLSTFHTCLSTPRDQVRDLLKLDAASQLDLPTAHLVCKIR  828

Query  206  RVS  198
            R++
Sbjct  829  RIA  831



>gb|AIU51157.1| embryo yellow protein, partial [Trachycarpus fortunei]
Length=821

 Score =   312 bits (799),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 168/183 (92%), Gaps = 1/183 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  ND+SR+ IWSSVEE SA PLP+FSAYPQ+YVT+VGEYLL
Sbjct  640  FSDTVNELVYDVLISKVRQRLNDVSRMSIWSSVEEPSALPLPSFSAYPQAYVTSVGEYLL  699

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+S+A  +EAQ+FATEWMFKV EGATAL+++QLRGIQYITDRGA QL
Sbjct  700  TLPQQLEPLAEGISSSEAGTEEAQFFATEWMFKVVEGATALFMEQLRGIQYITDRGALQL  759

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVLSALSMP+PP L TFH+CLSTPR Q+++L+KSD GNQLDLPTA+LVCK+R
Sbjct  760  SADIEYLSNVLSALSMPIPPFLTTFHACLSTPRDQIRDLLKSD-GNQLDLPTAHLVCKIR  818

Query  206  RVS  198
            R++
Sbjct  819  RIA  821



>ref|XP_009399332.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Musa 
acuminata subsp. malaccensis]
Length=818

 Score =   311 bits (798),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  +D+SRLPIWSSVEE S+ PLP+FSAYPQ+YVT+VGEYLL
Sbjct  633  FSDTVNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSSLPLPSFSAYPQAYVTSVGEYLL  692

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+S++  +EAQ+FATEWMFKVAEGATAL+++QLRGIQYI+DRGAQQL
Sbjct  693  TLPQQLEPLAEGISSSESGTEEAQFFATEWMFKVAEGATALFMEQLRGIQYISDRGAQQL  752

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVLSALSM +PP LATFH+CL+TPR QL   +KSD G+QLD+PTA+LVCK+R
Sbjct  753  SADIEYLSNVLSALSMAIPPFLATFHTCLATPRDQLPAFLKSDGGSQLDIPTAHLVCKIR  812

Query  206  RVSLE  192
            R+ L+
Sbjct  813  RIPLD  817



>dbj|BAD45448.1| oligomeric golgi complex 7-like [Oryza sativa Japonica Group]
Length=873

 Score =   312 bits (800),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  N+++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLL
Sbjct  688  FSDTVNELVYDVLISKVRQRLNEVARLPIWSSVEEPGGLPLPSFSAYPQAYVTSVGEYLL  747

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS  +A  +EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL
Sbjct  748  TLPQQLEPLAEGISGGEAGNEEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQL  807

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            + DIEYLSNVLSALSMP+PP LATFH+C+STPR Q+++L+KSD G+QLDLPTA+LVCK+R
Sbjct  808  AADIEYLSNVLSALSMPIPPFLATFHTCISTPRDQVRDLIKSDGGSQLDLPTAHLVCKIR  867

Query  206  RVS  198
            R+S
Sbjct  868  RIS  870



>gb|AIU51107.1| embryo yellow protein, partial [Musa acuminata]
Length=814

 Score =   311 bits (796),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  +D+SRLPIWSSVEE S+ PLP+FSAYPQ+YVT+VGEYLL
Sbjct  633  FSDTVNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSSLPLPSFSAYPQAYVTSVGEYLL  692

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS+S++  +EAQ+FATEWMFKVAEGATAL+++QLRGIQYI+DRGAQQL
Sbjct  693  TLPQQLEPLAEGISSSESGTEEAQFFATEWMFKVAEGATALFMEQLRGIQYISDRGAQQL  752

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYLSNVLSALSM +PP LATFH+CL+TPR QL   +KSD G+QLD+PTA+LVCK+R
Sbjct  753  SADIEYLSNVLSALSMAIPPFLATFHTCLATPRDQLPAFLKSDGGSQLDIPTAHLVCKIR  812

Query  206  RV  201
            R+
Sbjct  813  RI  814



>emb|CDX99921.1| BnaC09g27840D [Brassica napus]
Length=641

 Score =   306 bits (784),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 169/186 (91%), Gaps = 1/186 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYD+LISKVRQ   ++SRLPIWSSVEE +A  LP FS+YPQ+YVT+VGEYLL
Sbjct  456  FADTVNELVYDILISKVRQRLGEVSRLPIWSSVEEQTAFALPNFSSYPQAYVTSVGEYLL  515

Query  566  TLPQQLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQ  390
            TLPQQLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQ
Sbjct  516  TLPQQLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMEQLRGIQYISDRGAQQ  575

Query  389  LSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKM  210
            L VDIEYLSNVL+ALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD  TANLVCKM
Sbjct  576  LCVDIEYLSNVLAALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFLTANLVCKM  635

Query  209  RRVSLE  192
            RR+S +
Sbjct  636  RRISFD  641



>ref|XP_009107451.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7-like [Brassica rapa]
Length=831

 Score =   311 bits (796),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 169/186 (91%), Gaps = 1/186 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYD+LISKVRQ   ++SRLPIWSSVEE +A  LP FS+YPQ+YVT+VG YLL
Sbjct  646  FADTVNELVYDILISKVRQRLGEVSRLPIWSSVEEQTAFALPNFSSYPQAYVTSVGXYLL  705

Query  566  TLPQQLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQ  390
            TLPQQLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQ
Sbjct  706  TLPQQLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMEQLRGIQYISDRGAQQ  765

Query  389  LSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKM  210
            L VDIEYLSNVL+ALSMP+PPVLATF +CL+TPR +LK+++KSD+G++LD PTANLVCKM
Sbjct  766  LCVDIEYLSNVLAALSMPIPPVLATFQTCLATPRDELKDVMKSDAGSELDFPTANLVCKM  825

Query  209  RRVSLE  192
            RR+S +
Sbjct  826  RRISFD  831



>ref|XP_002438832.1| hypothetical protein SORBIDRAFT_10g026850 [Sorghum bicolor]
 gb|EER90199.1| hypothetical protein SORBIDRAFT_10g026850 [Sorghum bicolor]
Length=820

 Score =   310 bits (795),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLL
Sbjct  636  FSDTVNELVYDVLISKVRQRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLL  695

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS ++A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRG+QQL
Sbjct  696  TLPQQLEPLAEGISGNEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGSQQL  755

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            + DIEYL+NVLSALSMP+PP L+TFH+C+STPR Q+++L+KSD G+QLDLPTA+LVCK+R
Sbjct  756  AADIEYLNNVLSALSMPIPPFLSTFHACVSTPRDQVRDLIKSDGGSQLDLPTAHLVCKIR  815

Query  206  RVSLE  192
            R++L+
Sbjct  816  RITLD  820



>gb|AIU51137.1| embryo yellow protein, partial [Panicum virgatum]
Length=818

 Score =   310 bits (793),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLL
Sbjct  636  FSDTVNELVYDVLISKVRQRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLL  695

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS ++A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL
Sbjct  696  TLPQQLEPLAEGISGNEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQL  755

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            + DIEYL+NVLSALSMP+PP L+TFH+C+STPR Q++ L+KSD G+QLDLPTA+LVCK+R
Sbjct  756  AADIEYLNNVLSALSMPIPPFLSTFHACVSTPRDQVRGLIKSDGGSQLDLPTAHLVCKIR  815

Query  206  RVS  198
            R+S
Sbjct  816  RIS  818



>gb|AIU51153.1| embryo yellow protein, partial [Ginkgo biloba]
Length=816

 Score =   309 bits (791),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+DAVNELVY+VLI K+R   +D+SR+ IW+SVEE +A  LP+FSAYPQ YVT++GEYLL
Sbjct  632  FSDAVNELVYEVLILKIRHRLSDVSRMAIWTSVEEDNAFSLPSFSAYPQPYVTSIGEYLL  691

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPL  G+SN+DA ADEAQ+FATEWMFKVAEGATALY++QLRGIQ ITDRGAQQL
Sbjct  692  TLPQQLEPLTTGLSNADATADEAQFFATEWMFKVAEGATALYIEQLRGIQSITDRGAQQL  751

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            S DIEYL NVLSALSMP PPVLATFHSCL+T R QL+ELVKSD+G+QLDLPTA LVCK+R
Sbjct  752  SADIEYLCNVLSALSMPTPPVLATFHSCLATSREQLRELVKSDAGSQLDLPTARLVCKIR  811

Query  206  RVSLE  192
             V+LE
Sbjct  812  HVTLE  816



>dbj|BAJ95800.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=823

 Score =   309 bits (791),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLL
Sbjct  639  FSDKVNELVYDVLISKVRQRLSEIARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLL  698

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPL EGIS S+A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL
Sbjct  699  TLPQQLEPLTEGISGSEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQL  758

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            + DIEYL+NVLSALSMP+PP L+TFH+C+STPR Q+++L+KS+ G QLDLPTA+LV K+R
Sbjct  759  AADIEYLNNVLSALSMPIPPFLSTFHACISTPRDQVRDLIKSEGGTQLDLPTAHLVSKIR  818

Query  206  RVSLE  192
            R+SLE
Sbjct  819  RISLE  823



>dbj|BAJ94393.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=823

 Score =   309 bits (791),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLL
Sbjct  639  FSDKVNELVYDVLISKVRQRLSEIARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLL  698

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPL EGIS S+A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL
Sbjct  699  TLPQQLEPLTEGISGSEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQL  758

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            + DIEYL+NVLSALSMP+PP L+TFH+C+STPR Q+++L+KS+ G QLDLPTA+LV K+R
Sbjct  759  AADIEYLNNVLSALSMPIPPFLSTFHACISTPRDQVRDLIKSEGGTQLDLPTAHLVSKIR  818

Query  206  RVSLE  192
            R+SLE
Sbjct  819  RISLE  823



>gb|AIU51146.1| embryo yellow protein, partial [Sorghum bicolor]
Length=818

 Score =   308 bits (790),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLL
Sbjct  636  FSDTVNELVYDVLISKVRQRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLL  695

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS ++A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRG+QQL
Sbjct  696  TLPQQLEPLAEGISGNEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGSQQL  755

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            + DIEYL+NVLSALSMP+PP L+TFH+C+STPR Q+++L+KSD G+QLDLPTA+LVCK+R
Sbjct  756  AADIEYLNNVLSALSMPIPPFLSTFHACVSTPRDQVRDLIKSDGGSQLDLPTAHLVCKIR  815

Query  206  RVS  198
            R++
Sbjct  816  RIT  818



>gb|AIU51149.1| embryo yellow protein, partial [Lactuca sativa]
Length=827

 Score =   307 bits (786),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 165/185 (89%), Gaps = 1/185 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F D VNELVYDVLISKVR+  N +S LPIWSSVEE +   LP+FSAY QSY+T VGEYLL
Sbjct  644  FVDTVNELVYDVLISKVRKQLNGVSNLPIWSSVEEQTTFHLPSFSAYAQSYITTVGEYLL  703

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAE ISN+DANA+EAQ+FATEWMFKVAEGA  L+++QLRGIQYIT+RGAQQL
Sbjct  704  TLPQQLEPLAETISNNDANAEEAQFFATEWMFKVAEGAAGLFMEQLRGIQYITERGAQQL  763

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMP+PP+LATFH+CLSTPR QLK+++K+D    LD+PTANLVCKMR
Sbjct  764  SVDIEYLSNVLSALSMPIPPILATFHTCLSTPRDQLKDVMKNDL-ESLDVPTANLVCKMR  822

Query  206  RVSLE  192
            RVSLE
Sbjct  823  RVSLE  827



>ref|XP_004966309.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Setaria italica]
Length=820

 Score =   306 bits (784),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VN+LVYDVLISKVR   ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLL
Sbjct  636  FSDTVNDLVYDVLISKVRMRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLL  695

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS ++   DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL
Sbjct  696  TLPQQLEPLAEGISGNETGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQL  755

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            + DIEYL+NVLSALSMP+PP L+TFH+C+STPR Q++ L+KSD G+QLDLPTA+LVCK+R
Sbjct  756  AADIEYLNNVLSALSMPIPPFLSTFHACVSTPRDQVRGLIKSDGGSQLDLPTAHLVCKIR  815

Query  206  RVSLE  192
            R+SL+
Sbjct  816  RISLD  820



>ref|XP_008658135.1| PREDICTED: uncharacterized protein LOC100193995 isoform X1 [Zea 
mays]
 gb|AFW87715.1| hypothetical protein ZEAMMB73_766806 [Zea mays]
Length=820

 Score =   306 bits (784),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLL
Sbjct  636  FSDTVNELVYDVLISKVRQRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLL  695

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS ++A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRG+QQL
Sbjct  696  TLPQQLEPLAEGISGNEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGSQQL  755

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            + DIEYL+NVLSALSMP+PP L+TFH+C+STPR Q+++L+KSD  +QLDLPT +LVCK+R
Sbjct  756  AADIEYLNNVLSALSMPIPPFLSTFHACVSTPRDQVRDLIKSDGASQLDLPTTHLVCKIR  815

Query  206  RVSLE  192
            R++L+
Sbjct  816  RITLD  820



>gb|AIU51155.1| embryo yellow protein, partial [Zea mays]
Length=818

 Score =   304 bits (779),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLL
Sbjct  636  FSDTVNELVYDVLISKVRQRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLL  695

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS ++A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRG+QQL
Sbjct  696  TLPQQLEPLAEGISGNEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGSQQL  755

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            + DIEYL+NVLSALSMP+PP L+TFH+C+STPR Q+++L+KSD  +QLDLPT +LVCK+R
Sbjct  756  AADIEYLNNVLSALSMPIPPFLSTFHACVSTPRDQVRDLIKSDGASQLDLPTTHLVCKIR  815

Query  206  RVS  198
            R++
Sbjct  816  RIT  818



>gb|AIU51144.1| embryo yellow protein, partial [Setaria italica]
Length=818

 Score =   304 bits (778),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VN+LVYDVLISKVR   ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLL
Sbjct  636  FSDTVNDLVYDVLISKVRMRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLL  695

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS ++   DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL
Sbjct  696  TLPQQLEPLAEGISGNETGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQL  755

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            + DIEYL+NVLSALSMP+PP L+TFH+C+STPR Q++ L+KSD G+QLDLPTA+LVCK+R
Sbjct  756  AADIEYLNNVLSALSMPIPPFLSTFHACVSTPRDQVRGLIKSDGGSQLDLPTAHLVCKIR  815

Query  206  RVS  198
            R+S
Sbjct  816  RIS  818



>gb|AIU51124.1| embryo yellow protein, partial [Ceratophyllum demersum]
Length=813

 Score =   302 bits (773),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FA+AVN+LVY VLISKVRQ   ++SRLPIWSSVEE +A PLPTFS+YPQ YVT+VGEYLL
Sbjct  631  FAEAVNDLVYAVLISKVRQRLKEVSRLPIWSSVEEPTAFPLPTFSSYPQPYVTSVGEYLL  690

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGI  ++ NADE+QYFATEWMFKVAEGAT LY++QLRGIQ+ITD GAQQL
Sbjct  691  TLPQQLEPLAEGILTNETNADESQYFATEWMFKVAEGATNLYLEQLRGIQHITDHGAQQL  750

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMPVP  LATFH C+ST R +L++L+KSDSGNQLD+PTA+L+CK+R
Sbjct  751  SVDIEYLSNVLSALSMPVPQPLATFHICMSTSRDKLRDLIKSDSGNQLDIPTAHLICKIR  810

Query  206  RVS  198
            +V+
Sbjct  811  QVT  813



>gb|AIU51156.1| embryo yellow protein, partial [Alisma plantago-aquatica]
Length=823

 Score =   298 bits (764),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 167/182 (92%), Gaps = 1/182 (1%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+DAVN+LVYDVLI+KVRQ  +D+SRLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLL
Sbjct  643  FSDAVNDLVYDVLIAKVRQRLSDVSRLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLL  702

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGIS +D   ++AQ+FATEWMFKVAEGATALY++QLRGIQY+TDRGAQQL
Sbjct  703  TLPQQLEPLAEGISGADTATEDAQFFATEWMFKVAEGATALYMEQLRGIQYLTDRGAQQL  762

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            + DIEYLSNVLSALSMP+PP L T+H+C++TPR +L++L+KS++ +QLDLPTA+LVCK+R
Sbjct  763  AADIEYLSNVLSALSMPIPPFLVTYHNCVATPRDELRDLLKSEN-HQLDLPTAHLVCKIR  821

Query  206  RV  201
            R+
Sbjct  822  RL  823



>gb|AIU51150.1| embryo yellow protein, partial [Ceratophyllum platyacanthum subsp. 
oryzetorum]
Length=813

 Score =   298 bits (763),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FA+AVN+LVY VLISKVRQ   ++SRL IW+SVEE +A PLPTFS+YPQ YVT+VGEYLL
Sbjct  631  FAEAVNDLVYAVLISKVRQRLKEVSRLSIWTSVEEPTAFPLPTFSSYPQPYVTSVGEYLL  690

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEGI  ++ NADE+QYFATEWMFKVAEGAT LY++QLRGIQ+ITD GAQQL
Sbjct  691  TLPQQLEPLAEGILTNETNADESQYFATEWMFKVAEGATNLYLEQLRGIQHITDHGAQQL  750

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDIEYLSNVLSALSMPVP  LATFH C+ST R +L++L+KSDSGNQLD+PTA+L+CK+R
Sbjct  751  SVDIEYLSNVLSALSMPVPQPLATFHICMSTSRDKLRDLIKSDSGNQLDIPTAHLICKIR  810

Query  206  RVS  198
            +V+
Sbjct  811  QVT  813



>ref|XP_003618197.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES74415.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=755

 Score =   291 bits (745),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 159/185 (86%), Gaps = 15/185 (8%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F D +NEL              D+SRL IWSSVEE +A  LPTFSAYPQSYVT+VGEYLL
Sbjct  585  FEDTINEL--------------DVSRLSIWSSVEEQTAFRLPTFSAYPQSYVTSVGEYLL  630

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPLAEG+S+S+AN DEAQ+FATEWMFKVAEGAT LY++QLRG+QYITDRGAQQL
Sbjct  631  TLPQQLEPLAEGVSSSEAN-DEAQFFATEWMFKVAEGATTLYIEQLRGVQYITDRGAQQL  689

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            SVDI+YLSNVLSALSMP+P VLATFHSCLST R QLK+LVK+DS NQLDLPTANLVCKMR
Sbjct  690  SVDIDYLSNVLSALSMPIPAVLATFHSCLSTSRDQLKDLVKTDSANQLDLPTANLVCKMR  749

Query  206  RVSLE  192
            RV+L+
Sbjct  750  RVNLD  754



>gb|AIU51158.1| embryo yellow protein, partial [Cabomba caroliniana]
Length=804

 Score =   291 bits (746),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVY+VLISKVRQ  ++++++PIWSS+EE S  P+P+FSAYPQ+YVT+VGEYLL
Sbjct  620  FSDLVNELVYEVLISKVRQRLSNVAQMPIWSSIEEQSGFPIPSFSAYPQAYVTSVGEYLL  679

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            TLPQQLEPL   +S+ ++N DEAQ+FA EWMFKVAEGATALY++QLR IQ ITDRGAQQL
Sbjct  680  TLPQQLEPLGGTVSSGESNNDEAQFFAAEWMFKVAEGATALYIEQLRSIQSITDRGAQQL  739

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  207
            + DIEYLSNVLSALSMP+PP+L TF +CLSTP  QL ELVKSD+G+QLDLP A LVCK+ 
Sbjct  740  ATDIEYLSNVLSALSMPIPPILYTFQACLSTPADQLPELVKSDAGSQLDLPAARLVCKIL  799

Query  206  RVSLE  192
            RV+LE
Sbjct  800  RVNLE  804



>gb|EPS73811.1| hypothetical protein M569_00940, partial [Genlisea aurea]
Length=838

 Score =   278 bits (712),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 10/193 (5%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSS--------VEEHSARPLPTFSAYPQSYV  591
            FA+AVN+LVYDVLI KVRQHF+DLSR P WSS         +E SA P+P+FSAYPQ YV
Sbjct  648  FAEAVNDLVYDVLILKVRQHFHDLSRQPTWSSSSSSSSSSTDEPSAHPVPSFSAYPQPYV  707

Query  590  TNVGEYLLTLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYI  411
            TNVGEYLLTLPQQLEPLAEGI+NS AN++EAQ+FATEWMFKVAEGATALYV+QLR IQ +
Sbjct  708  TNVGEYLLTLPQQLEPLAEGIANSHANSEEAQFFATEWMFKVAEGATALYVEQLRAIQKV  767

Query  410  TDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPT  231
            TDRGA+QLSVDIEYLSNVLSALSMP+P VL+TFH+C S    +L++LVKS   + LD+  
Sbjct  768  TDRGAEQLSVDIEYLSNVLSALSMPIPQVLSTFHACFSGSMDELRDLVKSR--DDLDVVA  825

Query  230  ANLVCKMRRVSLE  192
            ANLVCKMR V L+
Sbjct  826  ANLVCKMRGVRLD  838



>ref|XP_002992562.1| hypothetical protein SELMODRAFT_135591 [Selaginella moellendorffii]
 gb|EFJ06368.1| hypothetical protein SELMODRAFT_135591 [Selaginella moellendorffii]
Length=779

 Score =   226 bits (576),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 140/188 (74%), Gaps = 4/188 (2%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F DA NELVY+VLISKVR    D++ +P+WS+ +E +   LP+FSAYP  YVT++GEYLL
Sbjct  593  FVDAANELVYEVLISKVRVRLADVASMPVWSAPQEDNPYALPSFSAYPLPYVTSIGEYLL  652

Query  566  TLPQQLEPLAEGISNSDANA---DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGA  396
            TLPQQLEPL   ++ SD +    +E QYFATEWMFKVAEGATALYVDQ+RGI+ + +RGA
Sbjct  653  TLPQQLEPLTSSMTTSDTSDDIDEEGQYFATEWMFKVAEGATALYVDQIRGIRNLNERGA  712

Query  395  QQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVC  216
            QQLS DI+YL NVL+ALSM VP VL+TF  C+   R QL E  K   G  LD PT  LVC
Sbjct  713  QQLSADIDYLCNVLTALSMNVPAVLSTFQQCVGATRDQLAEFAKG-VGPDLDGPTVRLVC  771

Query  215  KMRRVSLE  192
            KMR+V +E
Sbjct  772  KMRQVPVE  779



>ref|XP_002972505.1| hypothetical protein SELMODRAFT_148467 [Selaginella moellendorffii]
 gb|EFJ26591.1| hypothetical protein SELMODRAFT_148467 [Selaginella moellendorffii]
Length=779

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 140/188 (74%), Gaps = 4/188 (2%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F DA NELVY+VLISKVR    D++ +P+WS+ +E +   LP+FSAYP  YVT++GEYLL
Sbjct  593  FVDAANELVYEVLISKVRVRLADVASMPVWSAPQEDNPYALPSFSAYPLPYVTSIGEYLL  652

Query  566  TLPQQLEPLAEGISNSDANA---DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGA  396
            TLPQQLEPL   ++ SD +    +E QYFATEWMFKVAEGATALYVDQ+RGI+ + +RGA
Sbjct  653  TLPQQLEPLTSSMTTSDTSDDINEEGQYFATEWMFKVAEGATALYVDQIRGIRNLNERGA  712

Query  395  QQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVC  216
            QQLS DI+YL NVL+ALSM VP VL+TF  C+   R QL E  K   G  LD PT  LVC
Sbjct  713  QQLSADIDYLCNVLTALSMNVPAVLSTFQQCVGATREQLAEFTKG-VGPDLDGPTVRLVC  771

Query  215  KMRRVSLE  192
            KMR+V +E
Sbjct  772  KMRQVLVE  779



>emb|CDY56655.1| BnaA02g11250D [Brassica napus]
Length=788

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 132/186 (71%), Gaps = 43/186 (23%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYD+LISKVRQ                                         
Sbjct  645  FADTVNELVYDILISKVRQRLG--------------------------------------  666

Query  566  TLPQQLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQ  390
                +LEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALYV+QLRGIQYITDRGAQQ
Sbjct  667  ----ELEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYVEQLRGIQYITDRGAQQ  722

Query  389  LSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKM  210
            LSVDIEYLSNVL ALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKM
Sbjct  723  LSVDIEYLSNVLLALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKM  782

Query  209  RRVSLE  192
            RR+S +
Sbjct  783  RRISFD  788



>emb|CDY00475.1| BnaA10g07980D [Brassica napus]
Length=788

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 132/186 (71%), Gaps = 43/186 (23%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYD+LISKVRQ                                         
Sbjct  645  FADTVNELVYDILISKVRQRLG--------------------------------------  666

Query  566  TLPQQLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQ  390
                +LEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQ
Sbjct  667  ----ELEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMEQLRGIQYISDRGAQQ  722

Query  389  LSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKM  210
            L VDIEYLSNVL+ALSMP+PPVLATF +CL+TPR +LK+++KSD+G++LD PTANLVCKM
Sbjct  723  LCVDIEYLSNVLAALSMPIPPVLATFQTCLATPRDELKDVMKSDAGSELDFPTANLVCKM  782

Query  209  RRVSLE  192
            RR+S +
Sbjct  783  RRISFD  788



>emb|CDX91578.1| BnaC02g15820D [Brassica napus]
Length=801

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 132/186 (71%), Gaps = 43/186 (23%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYD+LISKVRQ                                         
Sbjct  645  FADTVNELVYDILISKVRQRLG--------------------------------------  666

Query  566  TLPQQLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQ  390
                +LEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALYV+QLRGI+YITDRGAQQ
Sbjct  667  ----ELEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYVEQLRGIEYITDRGAQQ  722

Query  389  LSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKM  210
            LSVDIEYLSNVL ALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKM
Sbjct  723  LSVDIEYLSNVLLALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKM  782

Query  209  RRVSLE  192
            RR+S +
Sbjct  783  RRISFD  788



>ref|XP_001770876.1| predicted protein [Physcomitrella patens]
 gb|EDQ64400.1| predicted protein [Physcomitrella patens]
Length=849

 Score =   207 bits (527),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 141/188 (75%), Gaps = 7/188 (4%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F DAVN+LVY+VL+SKVR    D++R  +W+  EE +   LP FSAY   Y+T++GEYLL
Sbjct  664  FTDAVNDLVYEVLMSKVRAKLADMAREAVWNQQEEQNLFSLPNFSAYASEYITSIGEYLL  723

Query  566  TLPQQLEPLAEGISNSDA---NADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGA  396
            TLPQQL PLA G  N +     +D+AQYFATEWMFKVAEGATA Y +Q+RGIQ +++RGA
Sbjct  724  TLPQQLLPLA-GSGNPEGVEEGSDDAQYFATEWMFKVAEGATAAYTEQIRGIQALSERGA  782

Query  395  QQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVC  216
            QQLS DIEYL NVL+ALSM  PPVL TFH C+STPR++L E+V+ D    +D  T  LVC
Sbjct  783  QQLSADIEYLCNVLNALSMSTPPVLHTFHVCVSTPRNKLFEVVEQDG---IDNATFRLVC  839

Query  215  KMRRVSLE  192
            KMR+V LE
Sbjct  840  KMRQVKLE  847



>gb|AIU51139.1| embryo yellow protein, partial [Artemisia annua]
Length=98

 Score =   177 bits (448),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 93/99 (94%), Gaps = 1/99 (1%)
 Frame = -2

Query  488  ATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFH  309
            +TEWMFKVAEGA AL+++QLRGIQYITDRGAQQLSVDIEYLSNVLS LSMP+PP+LATFH
Sbjct  1    STEWMFKVAEGAAALFMEQLRGIQYITDRGAQQLSVDIEYLSNVLSVLSMPIPPILATFH  60

Query  308  SCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  192
            +CLSTPR QLK+++K+DS   LDLPTANLVCKMRRVSLE
Sbjct  61   TCLSTPRDQLKDVIKTDS-ESLDLPTANLVCKMRRVSLE  98



>ref|XP_008376425.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Malus domestica]
Length=648

 Score =   175 bits (444),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FAD VNELVYDVLISKVRQ F+D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEY+L
Sbjct  526  FADTVNELVYDVLISKVRQCFSDVSRLPIWSSVEEQSAYNLPTFSAYPQAYVTSIGEYIL  585

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEG  456
            TLPQQLEPL EG+SNSD N DEAQ FATEWMFKVAEG
Sbjct  586  TLPQQLEPLTEGVSNSDTNNDEAQIFATEWMFKVAEG  622



>ref|NP_001058323.2| Os06g0669600 [Oryza sativa Japonica Group]
 dbj|BAF20237.2| Os06g0669600, partial [Oryza sativa Japonica Group]
Length=160

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  N+++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLL
Sbjct  28   FSDTVNELVYDVLISKVRQRLNEVARLPIWSSVEEPGGLPLPSFSAYPQAYVTSVGEYLL  87

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKV  465
            TLPQQLEPLAEGIS  +A  +EAQ+FATEW+FKV
Sbjct  88   TLPQQLEPLAEGISGGEAGNEEAQFFATEWIFKV  121



>ref|XP_006491716.1| PREDICTED: uncharacterized protein LOC102619662 [Citrus sinensis]
Length=870

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 90/102 (88%), Gaps = 5/102 (5%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            FADAVNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT+VGEYLL
Sbjct  358  FADAVNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAFHLPTFSAYPQTYVTSVGEYLL  417

Query  566  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALY  441
            TLPQQLEPLAEGIS SD N DEAQ+FATEWMFKV    T+LY
Sbjct  418  TLPQQLEPLAEGISTSD-NNDEAQFFATEWMFKV----TSLY  454



>ref|XP_001418731.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97024.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=816

 Score =   131 bits (330),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 106/187 (57%), Gaps = 6/187 (3%)
 Frame = -2

Query  737  AVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++ + VYD L+ +V      +S   +WS+    SA  LPTFSAYPQ  +TN GEYLL+LP
Sbjct  626  SLEKFVYDTLLGRVSLELKGISTSEVWSAKPAESAYKLPTFSAYPQERMTNAGEYLLSLP  685

Query  557  QQLE-----PLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGA  396
            Q L+      LA   S + D+NA +    +  W+ K+AE +  L + ++R I  +TD+GA
Sbjct  686  QHLDNMHDDDLARATSLSGDSNAAQEPATSEAWIAKIAEASAELLLKEVRAIASLTDQGA  745

Query  395  QQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVC  216
             QLS D+EY SN+++ALS+  P  L  ++ C S PR + ++  ++ +   +D+       
Sbjct  746  AQLSADLEYFSNIVAALSLAPPSALIAWYKCASAPRDEYEDFARAATSEGIDVRVVRAAA  805

Query  215  KMRRVSL  195
              R + L
Sbjct  806  ATRGIKL  812



>gb|AIU51120.1| embryo yellow protein, partial [Illicium henryi]
Length=720

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F+D VNELVYDVLISKVRQ  ND+SR+PIWSSVEE S  PLP+FSAYPQ YVT+VGEYLL
Sbjct  648  FSDMVNELVYDVLISKVRQRLNDVSRMPIWSSVEETSGLPLPSFSAYPQPYVTSVGEYLL  707

Query  566  TLPQQLEPLAEGI  528
            TLPQQLEPL+EGI
Sbjct  708  TLPQQLEPLSEGI  720



>ref|XP_003080398.1| conserved oligomeric Golgi complex component-related / COG complex 
component-related (ISS) [Ostreococcus tauri]
Length=396

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 104/188 (55%), Gaps = 6/188 (3%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
             A  + + V+D L+ +V      +    +WS+    SA  LPTFSAYPQ  +TN GEYLL
Sbjct  207  LARTLEKFVHDTLLGRVSLELKGIGASDVWSAKPTESAYKLPTFSAYPQERMTNAGEYLL  266

Query  566  TLPQQLEP-----LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDR  402
            +LPQ L+      +   +S SD +    Q  + +W+ K+AE +  L + +++ I  +T++
Sbjct  267  SLPQHLDGANDDDIPRTVSLSD-DVRSGQDTSEDWIAKIAEASAELLLKEVQSIGSLTEQ  325

Query  401  GAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANL  222
            GA QL+VD+EY SN+++ALS   P  L+ ++ C+S PR +     +S +   +D      
Sbjct  326  GAAQLAVDLEYFSNIVAALSFDPPSALSAWYRCVSVPREEYDAFARSANAEGIDARIVRA  385

Query  221  VCKMRRVS  198
            V   R ++
Sbjct  386  VAATRGIA  393



>emb|CEF98773.1| Conserved oligomeric Golgi complex subunit 7 [Ostreococcus tauri]
Length=786

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 104/188 (55%), Gaps = 6/188 (3%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
             A  + + V+D L+ +V      +    +WS+    SA  LPTFSAYPQ  +TN GEYLL
Sbjct  597  LARTLEKFVHDTLLGRVSLELKGIGASDVWSAKPTESAYKLPTFSAYPQERMTNAGEYLL  656

Query  566  TLPQQLE-----PLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDR  402
            +LPQ L+      +   +S SD +    Q  + +W+ K+AE +  L + +++ I  +T++
Sbjct  657  SLPQHLDGANDDDIPRTVSLSD-DVRSGQDTSEDWIAKIAEASAELLLKEVQSIGSLTEQ  715

Query  401  GAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANL  222
            GA QL+VD+EY SN+++ALS   P  L+ ++ C+S PR +     +S +   +D      
Sbjct  716  GAAQLAVDLEYFSNIVAALSFDPPSALSAWYRCVSVPREEYDAFARSANAEGIDARIVRA  775

Query  221  VCKMRRVS  198
            V   R ++
Sbjct  776  VAATRGIA  783



>ref|XP_007513783.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16308.1| predicted protein [Bathycoccus prasinos]
Length=978

 Score =   114 bits (284),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 91/161 (57%), Gaps = 11/161 (7%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F DA   LV D L+ +VR+   ++    IW+ +   +A  LPTFSAYPQ   TN GEYLL
Sbjct  768  FRDACERLVRDFLLHRVRRELENIENEQIWTKMAAQTAHDLPTFSAYPQEKATNSGEYLL  827

Query  566  TLPQQLEPLAEGISNSD-----------ANADEAQYFATEWMFKVAEGATALYVDQLRGI  420
            +LP +LE L   + +              N DE +  A+ WM +VAE +  +++++++ I
Sbjct  828  SLPTRLEALVNVVGDDVGSAASASAGIFGNDDEDEDLASIWMERVAEASATIFLERVKSI  887

Query  419  QYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLS  297
            + +++ GA QL+ D+EY SNV++AL+      L  +  C S
Sbjct  888  RRLSEPGAAQLAADLEYFSNVVTALTSRPQRGLLAYMQCAS  928



>ref|XP_002503576.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64834.1| predicted protein [Micromonas sp. RCC299]
Length=770

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 104/195 (53%), Gaps = 13/195 (7%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F D   + V DVL+SKVR  F  L++   WS+  E S   LPTFSAYPQ YVT  GEYLL
Sbjct  577  FEDCARDFVLDVLLSKVRSEFRGLAKRAEWSTSAESSDFDLPTFSAYPQGYVTTAGEYLL  636

Query  566  TLPQQLEPLAEGISNSDANADE----------AQYF-ATEWMFKVAEGATALYVDQLRGI  420
            +LPQ LE +A+      A A            A++F + EWM +VAE A  L + ++R I
Sbjct  637  SLPQHLESIADAAEEERAAAAAAGEMGRAATAAEHFDSGEWMTRVAEAAAGLLLAEVRAI  696

Query  419  QYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLD  240
              + + GA QL+ D+EY +N++SAL    P  L T+  C +  R      V+   G   D
Sbjct  697  TTLGEPGAAQLAADLEYFNNIISALFSEPPSALRTYAVCAAAARDSYAISVRDVEGMDED  756

Query  239  LPTANLVCKMRRVSL  195
            +  A  V K R + L
Sbjct  757  VIRA--VAKARGIKL  769



>ref|XP_003055554.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60806.1| predicted protein [Micromonas pusilla CCMP1545]
Length=809

 Score =   112 bits (280),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 99/190 (52%), Gaps = 10/190 (5%)
 Frame = -2

Query  740  DAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTL  561
            DA N+ V DVL SKVR     +     W          LPTFSAYPQ Y+TN GEYLL+L
Sbjct  605  DAANQFVLDVLASKVRNELRGMRGRAEWGETRASGGLNLPTFSAYPQEYMTNAGEYLLSL  664

Query  560  PQQLEPLAEGISNSDANA-----DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGA  396
            P  L+ +A   + + A       D  +  A EWM KVA  A +L + ++RGI  +TD GA
Sbjct  665  PTTLDAIAGAGAVAGAAGPGGADDVPELDAGEWMAKVAAAAASLLLTEVRGISALTDLGA  724

Query  395  QQLSVDIEYLSNVLSALSM---PVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTAN  225
             QL+ D++Y  NV++ALS+   P    L  F +C +  R     ++ +  G+ +D     
Sbjct  725  AQLAADLDYFVNVIAALSLDDVPDAKKLRCFATCCAAARDAY--VMSTRDGDAVDEDIVK  782

Query  224  LVCKMRRVSL  195
            +V   R + L
Sbjct  783  IVAAARGIKL  792



>emb|CBI21190.3| unnamed protein product [Vitis vinifera]
Length=135

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -2

Query  626  LPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATA  447
            LP+F+AYPQ+YVT+VGEYLLTLPQQLEPLAEGI +SD NADEAQ+FATEWMFKV     +
Sbjct  55   LPSFNAYPQAYVTSVGEYLLTLPQQLEPLAEGICSSDPNADEAQFFATEWMFKVTNLYCS  114

Query  446  LY  441
            L+
Sbjct  115  LH  116



>ref|XP_002731007.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Saccoglossus kowalevskii]
Length=259

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 97/193 (50%), Gaps = 21/193 (11%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSSVEEHS--ARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++  +D++   ++    DLS + +WSSV   +  +  LP+FS  P  Y+T +G+YL+TLP
Sbjct  71   HKFAFDIVFCPLKVQLADLSTMEVWSSVGSGAVLSVDLPSFSLSPMEYITKIGQYLMTLP  130

Query  557  QQLEPLAEGISNSDANA--------------DEAQYFATEWMFKVAEGATALYVDQLRGI  420
            QQLE      + +   A               E      +W+  +A      YV+Q+  +
Sbjct  131  QQLESFTTQDNTALEKALQMGKLPFPDTQGEHEEDTVVDQWIGSIARATMHHYVEQILMV  190

Query  419  QYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLD  240
              +T +G +QLS DI+YL NVL AL +P    L++  + L TP +Q +E+     G+ ++
Sbjct  191  PQLTTQGTKQLSADIDYLCNVLDALGIPASTSLSSVDTLLKTPIAQYEEI-----GDDIE  245

Query  239  LPTANLVCKMRRV  201
                N V  MR +
Sbjct  246  ARLINAVVGMRSI  258



>ref|XP_005847546.1| hypothetical protein CHLNCDRAFT_133750 [Chlorella variabilis]
 gb|EFN55444.1| hypothetical protein CHLNCDRAFT_133750 [Chlorella variabilis]
Length=753

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 76/139 (55%), Gaps = 6/139 (4%)
 Frame = -2

Query  737  AVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
             V   V +VL  + R     L RL  W   +   A  LPTFSAYP  YVT+VGEYL+ LP
Sbjct  571  GVGSCVLEVLTQRPRAQLAGLPRLGEWQ--QRAGALLLPTFSAYPLQYVTSVGEYLMMLP  628

Query  557  QQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  378
            QQLE    G    + N +EA     +W+ KVA    A Y  QL  +  +T +GA QL+ D
Sbjct  629  QQLESALLG----EDNGEEAGQLVGDWIDKVALDTAAHYQQQLAALPGLTAQGAAQLAAD  684

Query  377  IEYLSNVLSALSMPVPPVL  321
            +EY  NVL+ L + VPP L
Sbjct  685  LEYFCNVLTTLGVAVPPSL  703



>ref|XP_005643872.1| hypothetical protein COCSUDRAFT_67854 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19328.1| hypothetical protein COCSUDRAFT_67854 [Coccomyxa subellipsoidea 
C-169]
Length=731

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 79/153 (52%), Gaps = 17/153 (11%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSAR-------PLPTFSAYPQSYVT  588
            F +    LVYDVL S        L   P+W +              PLP FSAYPQ  VT
Sbjct  549  FQETAQALVYDVLGS-----LEGLGAQPVWGARGGEGGGAGGGAGGPLPAFSAYPQQAVT  603

Query  587  NVGEYLLTLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYIT  408
              GEYL+ LPQ LE L  G S +     E +    EW+ +VA GA  LYV +L  I  ++
Sbjct  604  AAGEYLMMLPQTLEGLLGGDSEA-----EEEAVDAEWLDRVAAGAAELYVRELAKIAALS  658

Query  407  DRGAQQLSVDIEYLSNVLSALSMPVPPVLATFH  309
            + GA QL+ D++Y  NVL+AL + VP  L T+ 
Sbjct  659  ESGAAQLAADLDYFCNVLAALGVAVPLQLVTWQ  691



>ref|XP_001701937.1| component of oligomeric golgi complex 7 [Chlamydomonas reinhardtii]
 gb|EDP06912.1| component of oligomeric golgi complex 7 [Chlamydomonas reinhardtii]
Length=758

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/203 (33%), Positives = 94/203 (46%), Gaps = 19/203 (9%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGE  576
            F+  V   V+DVL+++V      L  LP W    E   H A PLP+F+ YP  YVT +G+
Sbjct  548  FSATVQSTVFDVLLARVASLLASLPVLPEWRKGAEGSAHPAAPLPSFNTYPLPYVTAIGD  607

Query  575  YLLTLPQQLEPLAEGISNSDANADEAQYFATEWMF--------------KVAEGATALYV  438
            +L+ +PQQLE L  G +  D +A  A   A                   K   GA A+Y 
Sbjct  608  HLMAMPQQLEVLM-GDTGDDTSATAAAGGADASGGGAAEWEELAAEWLDKAVSGAAAMYA  666

Query  437  DQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSD  258
            D +  I  +  +G  QL+ D+EY  NV+ AL +  PP L T          +  EL +  
Sbjct  667  DAIFKIGDLGQQGGCQLATDVEYFVNVMGALHVAPPPSLLTVQLLAGAAPEEFAELGRGA  726

Query  257  -SGNQLDLPTANLVCKMRRVSLE  192
             +    D P    +  MRR++LE
Sbjct  727  LAEGAADGPALRALAGMRRIALE  749



>ref|XP_797564.3| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Strongylocentrotus purpuratus]
Length=348

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 85/168 (51%), Gaps = 14/168 (8%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQ  552
            ++L + ++  +++   + +S++ +W+      +  LPTFS  PQ Y+T +G+YL+TLPQQ
Sbjct  160  HKLAFGIVFFQLQLQLSQVSQMEVWTDEGGMLSADLPTFSLSPQEYITKIGQYLMTLPQQ  219

Query  551  LEPLAEGISNSDANADEAQ--------------YFATEWMFKVAEGATALYVDQLRGIQY  414
            LE      + +   A EA               + A  W+  VA     +YV+ +  I  
Sbjct  220  LETCTSQDNPAMEKALEASQLPFPPSPGSPEVAHLADYWIGSVARATMHMYVEVILRING  279

Query  413  ITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKEL  270
            +T + A+QLS DI+YL NV+ AL +   P L      L  P SQ  E+
Sbjct  280  LTQQAARQLSTDIDYLCNVVDALGIHPSPNLKHIEELLKMPLSQYGEV  327



>gb|EKC24157.1| Conserved oligomeric Golgi complex subunit 7 [Crassostrea gigas]
Length=774

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 78/150 (52%), Gaps = 14/150 (9%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSA--RPLPTFSAYPQSYVTNVGEY  573
             ++ V++  +D++   +R +  D+S + IW+S     A    LPTFS  PQ Y+T VG++
Sbjct  582  LSEDVHKFSFDIVFGTLRGYLADVSNMEIWTSKSAGGALTSDLPTFSLSPQEYITKVGQF  641

Query  572  LLTLPQQLEP------------LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQL  429
            L+TLPQ LEP            L  G        +  ++ A  W+  +A G   LY +Q+
Sbjct  642  LMTLPQHLEPFTMQDNPSVLVALKHGKLPYTDETELPEHVADLWLESIARGTMHLYCEQI  701

Query  428  RGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
              IQ +++   +QL  DI+YL NVL  L +
Sbjct  702  LKIQELSNHAVKQLITDIDYLCNVLDDLGL  731



>ref|XP_011431811.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Crassostrea gigas]
Length=754

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 78/150 (52%), Gaps = 14/150 (9%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSA--RPLPTFSAYPQSYVTNVGEY  573
             ++ V++  +D++   +R +  D+S + IW+S     A    LPTFS  PQ Y+T VG++
Sbjct  562  LSEDVHKFSFDIVFGTLRGYLADVSNMEIWTSKSAGGALTSDLPTFSLSPQEYITKVGQF  621

Query  572  LLTLPQQLEP------------LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQL  429
            L+TLPQ LEP            L  G        +  ++ A  W+  +A G   LY +Q+
Sbjct  622  LMTLPQHLEPFTMQDNPSVLVALKHGKLPYTDETELPEHVADLWLESIARGTMHLYCEQI  681

Query  428  RGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
              IQ +++   +QL  DI+YL NVL  L +
Sbjct  682  LKIQELSNHAVKQLITDIDYLCNVLDDLGL  711



>ref|XP_005105726.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Aplysia californica]
Length=750

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 80/159 (50%), Gaps = 14/159 (9%)
 Frame = -2

Query  734  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARP--LPTFSAYPQSYVTNVGEYLLTL  561
            V++  ++++ S+++ + N +S + IW+S     A    LPTFS  PQ Y+T VG+YL+TL
Sbjct  562  VHKFAFEIVFSQLKTYLNGVSIMEIWTSQSAGGAMTSDLPTFSLSPQEYITKVGQYLMTL  621

Query  560  PQQLEP------------LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQ  417
            PQ L+P            L  G      + +  ++ A  W+  VA G    Y +++  I 
Sbjct  622  PQHLDPFTLQESPALITALKHGRLPYTNHQELPEHLADIWLESVAMGTMHTYTEEILKIP  681

Query  416  YITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCL  300
            Y T  G +QL  DI+YL NVL  L +     +    + L
Sbjct  682  YATPHGCKQLITDIDYLCNVLEDLGLKASETMTHIQTLL  720



>ref|XP_786237.3| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Strongylocentrotus purpuratus]
Length=762

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 85/168 (51%), Gaps = 14/168 (8%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQ  552
            ++L + ++  +++   + +S++ +W+      +  LPTFS  PQ Y+T +G+YL+TLPQQ
Sbjct  574  HKLAFGIVFFQLQLQLSQVSQMEVWTDEGGMLSADLPTFSLSPQEYITKIGQYLMTLPQQ  633

Query  551  LEPLAEGISNSDANADEAQ--------------YFATEWMFKVAEGATALYVDQLRGIQY  414
            LE      + +   A EA               + A  W+  VA     +YV+ +  I  
Sbjct  634  LETCTSQDNPAMEKALEASQLPFPPSPGSPEVAHLADYWIGSVARATMHMYVEVILRINE  693

Query  413  ITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKEL  270
            +T + A+QLS DI+YL NV+ AL +   P L      L  P SQ  E+
Sbjct  694  LTQQAARQLSTDIDYLCNVVDALGIHPSPNLKHIEELLKMPLSQYGEV  741



>gb|EFA86654.1| oligomeric Golgi complex component [Polysphondylium pallidum 
PN500]
Length=785

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 62/216 (29%), Positives = 98/216 (45%), Gaps = 49/216 (23%)
 Frame = -2

Query  725  LVYDVLISKVRQHFNDLSRLPIW---SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  555
             V++ +I+ +R    DL RLP W   S  E +   P         SY+T + E+LL +PQ
Sbjct  577  FVFETMINFIRLKLKDLPRLPEWKQQSGTESYQTNPSQV------SYITQIAEHLLNIPQ  630

Query  554  QLEPLAE----------GISNSDANADEAQYF----------------------------  489
            QL+P +E           +S   AN D  Q                              
Sbjct  631  QLDPYSEEELIRFSYRIALSQPIANDDFYQNLVRQLYKSEQTTSAATISEDEEEEEEDGI  690

Query  488  ATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFH  309
            A +WM  VA+    LY+  +  I  +TD G QQL+ DI YL N+LSA+ +P  P+L+   
Sbjct  691  AHQWMSLVAKATEKLYLQSIVEISTLTDSGCQQLANDISYLFNILSAIGVPHDPLLSLTQ  750

Query  308  SCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  201
              +S P+ +  E + +   ++ ++  +NL+ KMR +
Sbjct  751  QLISIPKDKYLESIANYESSEKNI--SNLISKMRGI  784



>ref|XP_011402672.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Amphimedon queenslandica]
Length=553

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 84/167 (50%), Gaps = 21/167 (13%)
 Frame = -2

Query  725  LVYDVLISKVRQHFNDLSRLPIWSS-----VEEHSARP--LPTFSAYPQSYVTNVGEYLL  567
            L +DV+ S+++Q   ++ +L +WS      +E   A    LP+FS  P +Y+T +G++LL
Sbjct  360  LAFDVVFSQLKQKLIEIPKLKVWSRSTSSPLESPQALTDDLPSFSLSPLTYITEIGDHLL  419

Query  566  TLPQQLEP--------LAEGISNS------DANADEAQYFATEWMFKVAEGATALYVDQL  429
            TLP+QLEP        LA  + +       D   +     +  W+  +A G    YV+ +
Sbjct  420  TLPEQLEPFTSQDNPSLAAAMKHGRLPFTEDDGENRDLSLSDMWLDAIARGTMETYVESI  479

Query  428  RGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPR  288
              I  +TD  A QLS DI YL NVL+AL  P  P L      L + +
Sbjct  480  LKIPRLTDAAALQLSTDIGYLCNVLAALDQPPIPALTALEKLLKSDK  526



>ref|XP_009062761.1| hypothetical protein LOTGIDRAFT_194952 [Lottia gigantea]
 gb|ESO86524.1| hypothetical protein LOTGIDRAFT_194952 [Lottia gigantea]
Length=737

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 81/150 (54%), Gaps = 14/150 (9%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSA--RPLPTFSAYPQSYVTNVGEY  573
              + V++  ++++ ++++++ +++S + IW+S     A    LP+FS  PQ Y+T +G+Y
Sbjct  545  LCEEVHKFGFEIVFAQLKKYLSNISNMEIWTSKRAEGALTSDLPSFSLSPQEYITKIGQY  604

Query  572  LLTLPQQLEP------------LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQL  429
            L+T+PQ LEP            L  G      + D  ++ A  W+  VA+G   +Y +++
Sbjct  605  LMTIPQHLEPFMLHDNPTLTTALKYGKLPYIDDQDLPEHLADLWLESVAKGTMHIYCEEI  664

Query  428  RGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
              I  ++    +QL  DIEYL NVL  L +
Sbjct  665  LKIINLSPHATKQLITDIEYLLNVLDDLGL  694



>ref|XP_001844946.1| conserved hypothetical protein [Culex quinquefasciatus]
 gb|EDS38841.1| conserved hypothetical protein [Culex quinquefasciatus]
Length=727

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 79/155 (51%), Gaps = 12/155 (8%)
 Frame = -2

Query  722  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  543
            +   ++  + +HFN +     +S+ +E     LP +S  PQ Y+T +G+YLLTLPQ LEP
Sbjct  552  IMKFILYAIEKHFNGMR----FSANKEGEGFNLPDYSYAPQEYITQIGQYLLTLPQHLEP  607

Query  542  LAE--------GISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  387
            L           + + D    + ++ A   +  + E  TA Y + +  IQ +T  G++QL
Sbjct  608  LLLSPSPSLKFALQSCDDAYSKDKFCADVLLALIVEETTAFYQESIDNIQSLTAAGSKQL  667

Query  386  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQ  282
            +VDIEY  NVL  +S+P    L      L TP  Q
Sbjct  668  AVDIEYFGNVLEEMSLPFNATLQQTVVLLRTPLEQ  702



>gb|ELT88100.1| hypothetical protein CAPTEDRAFT_161050 [Capitella teleta]
Length=754

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 74/148 (50%), Gaps = 15/148 (10%)
 Frame = -2

Query  737  AVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSA--RPLPTFSAYPQSYVTNVGEYLLT  564
            ++++  +DV+ + ++Q    L    IW S  +  A    LP F   PQ Y+T +G+YL+T
Sbjct  563  SLHQFAFDVVFAPLQQLLMSLPDFEIWQSESQAGAITTNLPAFGLTPQEYITKIGQYLMT  622

Query  563  LPQQLEPLAEG-------------ISNSDANADEAQYFATEWMFKVAEGATALYVDQLRG  423
            LPQQLEP  +              + ++    D  +  A  W+  VA G+  LY +Q+  
Sbjct  623  LPQQLEPFTQEDNPALCVALKHGRLPHTLDQTDMPEQLADLWLESVANGSMRLYAEQILN  682

Query  422  IQYITDRGAQQLSVDIEYLSNVLSALSM  339
            I  ++    QQL +DI+Y  NV+  L +
Sbjct  683  IPKLSTLATQQLLIDIDYFCNVMDDLGL  710



>ref|XP_004206189.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Hydra vulgaris]
Length=216

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 85/171 (50%), Gaps = 12/171 (7%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARP-LPTFSAYPQSYVTNVGEYLLTLPQ  555
            + L +D++  + +   + +S + +W + E+ +A   LP FS  PQSY+T +G+ LLTLPQ
Sbjct  31   HSLAFDLIFYQFKCLLDGVSSMEVWRTEEKEAAGGDLPKFSLSPQSYITQIGDSLLTLPQ  90

Query  554  QLEP----------LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITD  405
            QLE           ++  +        E  +    W+  +A  A+A YV+ +  I Y+T 
Sbjct  91   QLEGYFNEQNVSLIVSLKVGRLPFQETEGAHLDHCWLESLARSASANYVEAIIKIPYLTA  150

Query  404  RGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSG  252
             G +QL  DI+Y   +L AL + V   L T    +    S   E V +++G
Sbjct  151  YGTRQLLADIDYYLKILGALEVNVNEKLLTIQKLMIADPSSFNE-VAAETG  200



>ref|XP_002407978.1| conserved oligomeric golgi complex subunit, putative [Ixodes 
scapularis]
 gb|EEC12391.1| conserved oligomeric golgi complex subunit, putative [Ixodes 
scapularis]
Length=749

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 80/161 (50%), Gaps = 14/161 (9%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSSVEEHSA--RPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++  +D + ++V+ HFN +  L +W+      A  R LP FS  P  Y+T +G+YLLT+P
Sbjct  563  SKFTFDTVFAEVQSHFNTVPSLKVWALENPGGAIARDLPAFSISPLEYITQIGQYLLTIP  622

Query  557  QQLEP--------LAEGISNSD----ANADEAQYFATEWMFKVAEGATALYVDQLRGIQY  414
            Q +EP        LA  +  S+      +    + A   +  VA+     Y+D +  I  
Sbjct  623  QHIEPFIVEENEALAMALKYSNLPHVIESTSTDHVADYLLGCVAQATMYTYLDTVMQIDR  682

Query  413  ITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTP  291
            +T + + QL+ DI YL NVL  L +P+   L    + L +P
Sbjct  683  LTQQASAQLATDIGYLCNVLDDLGLPLLENLQQLAALLKSP  723



>emb|CDS12214.1| hypothetical protein LRAMOSA04409 [Absidia idahoensis var. thermophila]
Length=892

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 87/193 (45%), Gaps = 50/193 (26%)
 Frame = -2

Query  725  LVYDVLISKVRQHFNDLSRL-PIWSSVEEHSARP----------LPTFSAYPQSYVTNVG  579
            +++  ++  + +H + +  L  +W++ E  S R           +P FS  P +Y+T +G
Sbjct  699  MLHKAILGPIIRHLDTIPTLRSVWTAPEPPSRRKNVQDATIHVDMPQFSLSPNAYITRIG  758

Query  578  EYLLTLPQQLEPLAEG------------ISNSDANA---DEAQYFATE------------  480
            E LL LPQ+ E  A+             I  SD +A   +E    A+E            
Sbjct  759  EKLLMLPQEFEVYADDSSLRYHIESAPFIEKSDLSAHDEEEDTIDASEEHQQQPLDNEEE  818

Query  479  ------------WMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMP  336
                        W   +A G  A ++D++R IQ  T +G +QL  DIEYL NVLSAL + 
Sbjct  819  EEEEEGSDVIQLWTTSIARGTMARFLDEIRKIQKTTPQGQRQLRTDIEYLVNVLSALDVQ  878

Query  335  VPPVLATFHSCLS  297
              P L  FHS LS
Sbjct  879  PLPDLVEFHSTLS  891



>ref|XP_006682175.1| hypothetical protein BATDEDRAFT_27828 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77069.1| hypothetical protein BATDEDRAFT_27828 [Batrachochytrium dendrobatidis 
JAM81]
Length=846

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 85/187 (45%), Gaps = 18/187 (10%)
 Frame = -2

Query  743  ADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSA-----RPLPTFSAYPQSYVTNVG  579
            A A  +LV+  L+ ++ +  + +  L  W+S   ++        LP FS  P +Y+TN+G
Sbjct  641  AIASQKLVFQCLLQRMTREMDGMFALSCWTSQYTNTVAGSFDTQLPEFSLLPLAYMTNIG  700

Query  578  EYLLTLPQQLEPLAE------------GISNSDANADEAQYFATEWMFKVAEGATALYVD  435
            E LL LP  L+  A             G+   D    E+      W+  ++    +  +D
Sbjct  701  EQLLALPLHLDTFAGEQSLQYSLATLPGVECIDLEDQESIDVTHVWILSMSRAIESRLMD  760

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQL-KELVKSD  258
            Q++ I  ++ RG +QL+ DI YLSNV SA+ +     L     CL      L K + + D
Sbjct  761  QVKRIPTLSSRGCRQLATDINYLSNVFSAMEIEPHMTLQVMIQCLECNEQDLEKRMTEQD  820

Query  257  SGNQLDL  237
            +    D+
Sbjct  821  TAENSDI  827



>ref|XP_005825555.1| oligomeric Golgi complex subunit 7 [Guillardia theta CCMP2712]
 gb|EKX38575.1| oligomeric Golgi complex subunit 7 [Guillardia theta CCMP2712]
Length=842

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 77/146 (53%), Gaps = 15/146 (10%)
 Frame = -2

Query  734  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  555
            V  L+ D  +S VR+   ++++L +W   E      LP+FS+ P  +VTN+ E+L +LP+
Sbjct  651  VELLLQDTALSFVRRQLINVAKLQVWG--ENKKKGHLPSFSSSPLPHVTNIAEHLFSLPE  708

Query  554  QLEPLAEG---ISNSDA-------NADEA---QYFATEWMFKVAEGATALYVDQLRGIQY  414
            QL+P A      S S A       N DE      F  +W+ ++     +LYV+++  I  
Sbjct  709  QLDPAAHDEVPCSTSAALQLTQPQNVDEGSSEHKFMQKWLSRITGEVVSLYVEKILEIPA  768

Query  413  ITDRGAQQLSVDIEYLSNVLSALSMP  336
            ++  G  QL  DI+Y+S++L  L  P
Sbjct  769  LSPSGRVQLGTDIQYISSILDTLGAP  794



>ref|XP_004535745.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Ceratitis capitata]
Length=751

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/191 (30%), Positives = 92/191 (48%), Gaps = 24/191 (13%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
              +  +E+  ++L+  V +H  ++   P      +  +  +P FS  PQ  +T +G+YLL
Sbjct  565  LCEDTHEIALNILLKPVEEHLLNIE--PSQHLNSDSLSATMPEFSFVPQESITQIGQYLL  622

Query  566  TLPQQLEP--------LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYI  411
            TLPQ LEP        L + +   +A   ++   A   +  V E    LY  Q+  ++ +
Sbjct  623  TLPQHLEPLLFTPSALLKQALEICNAKYTQSIPCADILLSLVVEQCCQLYQSQILQVKVM  682

Query  410  TDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPT  231
                ++Q +VDIEYLSNVL  L + +           ST  SQ+  L+K+DSGN L L  
Sbjct  683  PVSSSKQFAVDIEYLSNVLEELGLNI-----------STSLSQILVLLKADSGNYLALSV  731

Query  230  ANLVCKMRRVS  198
                C+ R V+
Sbjct  732  G---CEPRLVT  739



>ref|XP_003703617.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Megachile rotundata]
Length=764

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 78/148 (53%), Gaps = 15/148 (10%)
 Frame = -2

Query  719  YDVLISKVRQHFNDLSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  549
            Y+V+ + +      + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  578  YEVIFAPIFTQLLLVQKAPAWSTETNKMTHLSADLPDYSFAPQEYITQVGQYLMTLPQHL  637

Query  548  EP--LAEGIS-NSDANADEAQYF--ATEWMFK------VAEGATALYVDQLRGI-QYITD  405
            EP  L E  S N    A + QY    TE  F       +A+G   +++DQ  GI Q+++ 
Sbjct  638  EPFLLRENPSLNQALKAADPQYAQGTTESGFTGILLDIIAKGTCQMFLDQTLGICQFLSS  697

Query  404  RGAQQLSVDIEYLSNVLSALSMPVPPVL  321
               +QL+ DI+YL NVL  L + +   L
Sbjct  698  AACKQLATDIDYLGNVLEELGLSLSENL  725



>ref|XP_011299085.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X3 [Fopius arisanus]
Length=698

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 75/155 (48%), Gaps = 16/155 (10%)
 Frame = -2

Query  719  YDVLISKVRQHFNDLSRLPIW----SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQ  552
            Y+V+ + +      + R P W    + V+  S+  LP +S  PQ Y+T VG+YL+TLPQ 
Sbjct  513  YEVIFAPIFTQLVLIQRAPAWFGDGAKVQGLSS-DLPDYSFAPQEYITQVGQYLMTLPQH  571

Query  551  LEP--------LAEGISNSDANADEAQY---FATEWMFKVAEGATALYVDQLRGIQYITD  405
            LEP        L   +  +DA   +      F    +  VA+G   ++ DQ  GI  +  
Sbjct  572  LEPFLLRDNPSLVHALRAADAQYTQGSAEGGFTATLLGIVAKGTCQMFQDQALGICELNT  631

Query  404  RGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCL  300
               +QL+ DI+YL NVL  L +P+   L    + L
Sbjct  632  GACKQLATDIDYLGNVLEELGLPLSDNLQQMSTLL  666



>ref|XP_002109935.1| hypothetical protein TRIADDRAFT_53345 [Trichoplax adhaerens]
 gb|EDV28101.1| hypothetical protein TRIADDRAFT_53345 [Trichoplax adhaerens]
Length=710

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 73/152 (48%), Gaps = 22/152 (14%)
 Frame = -2

Query  677  LSRLPIWSS---VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLA----------  537
            L  + +WS+   V + S   LPTF + P SY+T +G+YLL LPQQLEP A          
Sbjct  539  LKSVKVWSAEKEVSDVSNEDLPTFIS-PSSYITQIGDYLLNLPQQLEPFATQNNPSLEMA  597

Query  536  --EG------ISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  381
              EG       S+++  +         W+  VA G    YV+ +  I  +TD  A+QL  
Sbjct  598  LKEGKLPYPDTSDNEDTSLNVNDTTIYWLGAVARGTVLTYVENIMKIPTLTDHAARQLIE  657

Query  380  DIEYLSNVLSALSMPVPPVLATFHSCLSTPRS  285
            DIEYL N+L AL +     L      L +P S
Sbjct  658  DIEYLFNILEALEISPGIKLKQIVLLLKSPSS  689



>ref|XP_011299078.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Fopius arisanus]
Length=736

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 75/155 (48%), Gaps = 16/155 (10%)
 Frame = -2

Query  719  YDVLISKVRQHFNDLSRLPIW----SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQ  552
            Y+V+ + +      + R P W    + V+  S+  LP +S  PQ Y+T VG+YL+TLPQ 
Sbjct  551  YEVIFAPIFTQLVLIQRAPAWFGDGAKVQGLSS-DLPDYSFAPQEYITQVGQYLMTLPQH  609

Query  551  LEP--------LAEGISNSDANADEAQY---FATEWMFKVAEGATALYVDQLRGIQYITD  405
            LEP        L   +  +DA   +      F    +  VA+G   ++ DQ  GI  +  
Sbjct  610  LEPFLLRDNPSLVHALRAADAQYTQGSAEGGFTATLLGIVAKGTCQMFQDQALGICELNT  669

Query  404  RGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCL  300
               +QL+ DI+YL NVL  L +P+   L    + L
Sbjct  670  GACKQLATDIDYLGNVLEELGLPLSDNLQQMSTLL  704



>ref|XP_011299070.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Fopius arisanus]
Length=750

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 75/155 (48%), Gaps = 16/155 (10%)
 Frame = -2

Query  719  YDVLISKVRQHFNDLSRLPIW----SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQ  552
            Y+V+ + +      + R P W    + V+  S+  LP +S  PQ Y+T VG+YL+TLPQ 
Sbjct  565  YEVIFAPIFTQLVLIQRAPAWFGDGAKVQGLSS-DLPDYSFAPQEYITQVGQYLMTLPQH  623

Query  551  LEP--------LAEGISNSDANADEAQY---FATEWMFKVAEGATALYVDQLRGIQYITD  405
            LEP        L   +  +DA   +      F    +  VA+G   ++ DQ  GI  +  
Sbjct  624  LEPFLLRDNPSLVHALRAADAQYTQGSAEGGFTATLLGIVAKGTCQMFQDQALGICELNT  683

Query  404  RGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCL  300
               +QL+ DI+YL NVL  L +P+   L    + L
Sbjct  684  GACKQLATDIDYLGNVLEELGLPLSDNLQQMSTLL  718



>ref|XP_006872058.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chrysochloris 
asiatica]
Length=770

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 48/178 (27%), Positives = 83/178 (47%), Gaps = 24/178 (13%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWS--SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  W+  SV E  A  LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMDSWNAVSVGEPLAEDLPTFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  261
             +  I  +T    +QL+ DI+YL+NV+ AL +     L    + L T     ++  KS
Sbjct  696  VILQIPELTPHSTKQLATDIDYLTNVMDALGLQPSRTLQNIVTLLKTKPEDYRQATKS  753



>dbj|GAM17697.1| hypothetical protein SAMD00019534_008720 [Acytostelium subglobosum 
LB1]
Length=735

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 60/110 (55%), Gaps = 2/110 (2%)
 Frame = -2

Query  518  DANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
            D N DE    A +WM  VA     LY+  +  I  +++ G QQLS DI YL NVLSAL +
Sbjct  626  DENIDEMDGIAHQWMTLVASATEKLYLQSIVEISMLSEFGCQQLSNDIGYLFNVLSALGV  685

Query  338  PVPPVLATFHSCLSTPRSQLKELVKS--DSGNQLDLPTANLVCKMRRVSL  195
               P+L+     +STP+ +  E++ +   S N  +   ANL+ KMR + L
Sbjct  686  SADPLLSRTQQLVSTPKERYAEIISNIMKSDNNAEKNIANLIAKMRGIKL  735



>ref|XP_004080382.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Oryzias 
latipes]
Length=769

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 74/152 (49%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIW--SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            N+L +D +  +++     +S++ I   S + E+    LPTFS  PQ Y+TN+G+YL++LP
Sbjct  578  NQLAFDSVFLQIKHQLGLVSKMEIQEASGIGENFTEDLPTFSLSPQEYITNIGQYLMSLP  637

Query  557  QQLEPLAEGISNSDANADEAQY-------------------FATEWMFKVAEGATALYVD  435
              LEP    ++  D   + A +                    A  W+  +A      Y D
Sbjct  638  LHLEPF---VTQEDPALEMALHAGKLPFPPEQGDDLPELDNTADYWLGSIARATMQTYCD  694

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  +T    +QL+ DI+YLSNV+ AL +
Sbjct  695  AILLIPQLTPHSTKQLATDIDYLSNVMDALGL  726



>ref|XP_006637161.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Lepisosteus oculatus]
Length=728

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 78/174 (45%), Gaps = 18/174 (10%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++   + + R+  WSS    E     LPTFS  P  Y+TN+G+Y+++LP
Sbjct  537  HQLAFDAVFLQIKHQLSLVHRMESWSSSGTGETLTEDLPTFSLSPLEYITNIGQYIMSLP  596

Query  557  QQLEPL-------------AEGISNSDANAD---EAQYFATEWMFKVAEGATALYVDQLR  426
              LEP              A  +      AD   E    A  W+  +A      Y D + 
Sbjct  597  LHLEPFVTQEDPALELALHAGKLPFPPEQADDLPELDNIADYWLGSIARATMQTYCDAIL  656

Query  425  GIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVK  264
             I  +T   A+QL+ DI+YLSNV+ AL +     L    + L       ++  K
Sbjct  657  QIPELTPHSAKQLATDIDYLSNVMDALGLQASRTLQQIVTLLKAKPEDFRQTAK  710



>ref|XP_007571518.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Poecilia formosa]
Length=224

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIW--SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            N+L +D +  +++     +S++     S++ E     LPTFS  PQ Y+TN+G+YL++LP
Sbjct  33   NQLAFDSVFLQIKHQLCLVSKMESQDASAIGESYTEDLPTFSLSPQEYITNIGQYLMSLP  92

Query  557  QQLEPLAEGISNSDANADEAQY-------------------FATEWMFKVAEGATALYVD  435
              LEP    ++  D   + A +                    A  W+  +A      Y D
Sbjct  93   LHLEPF---VTQEDPALEMALHAGKLPFPPDQGDDLPELDNTADYWLGSIARATMQTYCD  149

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  ++    +QL+ DIEYLSNV+ AL +
Sbjct  150  AILLIPRLSPHSTKQLATDIEYLSNVMDALGL  181



>ref|XP_006892752.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Elephantulus 
edwardii]
Length=770

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 80/167 (48%), Gaps = 24/167 (14%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  WS+  + E  A  LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMDSWSTAGIGETLADDLPTFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLST  294
             +  I  +T    +QL+ DI+YL+NV+ AL +    +L    + L T
Sbjct  696  VILQIPELTPHSTKQLTTDIDYLTNVMDALGLQPSRLLQNIVTLLKT  742



>ref|XP_005810284.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Xiphophorus maculatus]
Length=769

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 74/152 (49%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIW--SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            N+L +D +  +++     +S++     S++ E     LPTFS  PQ Y+TN+G+YL++LP
Sbjct  578  NQLAFDSVFLQIKHQLCLVSKMESQDASAIGESYTEDLPTFSLSPQEYITNIGQYLMSLP  637

Query  557  QQLEPLAEGISNSDANADEAQY-------------------FATEWMFKVAEGATALYVD  435
              LEP    ++  D   D A +                    A  W+  +A      Y D
Sbjct  638  LHLEPF---VTQEDPALDMALHAGKLPFPPEQGDDLPELDNTADYWLGSIARATMQTYCD  694

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I +++    +QL+ DIEYLSNV+ AL +
Sbjct  695  AILLIPHLSPHSTKQLATDIEYLSNVMDALGL  726



>ref|XP_003490215.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Bombus impatiens]
Length=783

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 92/189 (49%), Gaps = 19/189 (10%)
 Frame = -2

Query  719  YDVLISKVRQHFNDLSRLPIWSS---VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  549
            Y+V+ + +      + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  598  YEVIFAPIFTQLLSVQKAPAWSTEINKMTHLSADLPDYSFAPQEYITQVGQYLMTLPQHL  657

Query  548  EP--LAEGISNSDA-NADEAQYF--ATEWMFK------VAEGATALYVDQLRGIQYITDR  402
            EP  L E  S + A  A + QY   +TE  F       +A+    +++DQ  GI  ++  
Sbjct  658  EPFLLRENPSLTQALKAADPQYAQSSTESGFTGILLEIIAKETCQMFLDQTLGICQLSSA  717

Query  401  GAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANL  222
              +QL+ DI+YL NVL  L + +   L      L  P    +   KS SG    +  A  
Sbjct  718  ACKQLATDIDYLGNVLEELGLSLSENLQHMSLLLRLPPEDYQ---KSSSGCNARVVAA--  772

Query  221  VCKMRRVSL  195
            V +MR ++ 
Sbjct  773  VRQMRNITF  781



>ref|XP_004706118.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Echinops 
telfairi]
Length=770

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 74/152 (49%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWS--SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  WS  SV E     LPTFS  P  Y++N+G+YL++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLISKMDSWSTASVGETLTDDLPTFSLTPLEYISNIGQYLMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDEPPELDNMADNWLGAIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  +T    +QL+ DI+YL+NV+ AL +
Sbjct  696  VILQIPELTPHSTKQLATDIDYLTNVMDALGL  727



>ref|XP_003397366.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Bombus terrestris]
Length=735

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 93/189 (49%), Gaps = 19/189 (10%)
 Frame = -2

Query  719  YDVLISKVRQHFNDLSRLPIWSS---VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  549
            Y+V+ + +      + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  550  YEVIFAPIFTQLLSVQKAPAWSTEINKMTHLSADLPDYSFAPQEYITQVGQYLMTLPQHL  609

Query  548  EP--LAEGISNSDA-NADEAQYF--ATEWMFK------VAEGATALYVDQLRGIQYITDR  402
            EP  L E  S + A  A + QY   +TE  F       +A+    +++DQ  GI  ++  
Sbjct  610  EPFLLRENPSLTQALKAADPQYAQSSTESGFTGILLEIIAKETCQMFLDQTLGICQLSSA  669

Query  401  GAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANL  222
              +QL+ DI+YL NVL  L + +   L      L  P    ++  KS SG    +  A  
Sbjct  670  ACKQLATDIDYLGNVLEELGLSLSENLQHMSLLLRLPP---EDYHKSSSGCNARVVAA--  724

Query  221  VCKMRRVSL  195
            V +MR ++ 
Sbjct  725  VRQMRNITF  733



>ref|XP_007951381.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Orycteropus 
afer afer]
Length=731

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 78/167 (47%), Gaps = 24/167 (14%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  540  HQLAFDSIFLRIKQQLLLVSKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  599

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  600  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLVSIARATMQTYCD  656

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLST  294
             +  I  +T    +QL+ DI+YL+NV+ AL +     L    + L T
Sbjct  657  VILQIPELTPHSTKQLATDIDYLTNVMDALGLQPSRTLHNIVTLLKT  703



>ref|XP_006003103.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Latimeria chalumnae]
 ref|XP_006003104.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Latimeria chalumnae]
 ref|XP_006003105.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X3 [Latimeria chalumnae]
Length=769

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 74/152 (49%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q  + +SR+  WSS  + E     LPTFS  P  Y+TN+G+Y+++LP
Sbjct  578  HQLAFDSVFLRIKQQLSLVSRMESWSSGGMGETLTDDLPTFSLTPLEYITNIGQYIMSLP  637

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D   +                   E    A  W+  +A      Y +
Sbjct  638  LHLEPF---VTQEDPALELALHAGKLPYPPEQGDELPELDNMADYWLGSIARATMQTYCE  694

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  +T    +QL+ DI+YLSNV+ AL +
Sbjct  695  IILQIPELTMHSTKQLATDIDYLSNVMDALGL  726



>gb|EPY74529.1| conserved oligomeric Golgi complex subunit 7-like protein [Camelus 
ferus]
Length=800

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 88/198 (44%), Gaps = 29/198 (15%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  609  HQLAFDSVFLRIKQQLLLISKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  668

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  669  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  725

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  255
             L  I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K   
Sbjct  726  ALLQIPGLTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG--  783

Query  254  GNQLDLPTANLVCKMRRV  201
               L    A+ V  MR V
Sbjct  784  ---LPRRLASTVATMRSV  798



>ref|XP_006193181.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Camelus 
ferus]
Length=770

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 88/198 (44%), Gaps = 29/198 (15%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLISKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  255
             L  I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K   
Sbjct  696  ALLQIPGLTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG--  753

Query  254  GNQLDLPTANLVCKMRRV  201
               L    A+ V  MR V
Sbjct  754  ---LPRRLASTVATMRSV  768



>ref|XP_010985221.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Camelus dromedarius]
Length=705

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 88/198 (44%), Gaps = 29/198 (15%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  514  HQLAFDSVFLRIKQQLLLISKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  573

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  574  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  630

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  255
             L  I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K   
Sbjct  631  ALLQIPGLTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG--  688

Query  254  GNQLDLPTANLVCKMRRV  201
               L    A+ V  MR V
Sbjct  689  ---LPRRLASTVAAMRSV  703



>ref|XP_010959320.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Camelus 
bactrianus]
 ref|XP_010985220.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Camelus dromedarius]
Length=770

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 88/198 (44%), Gaps = 29/198 (15%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLISKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  255
             L  I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K   
Sbjct  696  ALLQIPGLTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG--  753

Query  254  GNQLDLPTANLVCKMRRV  201
               L    A+ V  MR V
Sbjct  754  ---LPRRLASTVAAMRSV  768



>gb|KDR16116.1| Conserved oligomeric Golgi complex subunit 7 [Zootermopsis nevadensis]
Length=742

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/154 (30%), Positives = 73/154 (47%), Gaps = 16/154 (10%)
 Frame = -2

Query  734  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSAR---PLPTFSAYPQSYVTNVGEYLLT  564
            V+   + V+   +      +   P WS+  + +A     LP FS  PQ Y+T +G+YL+T
Sbjct  550  VHHTTFQVIFVPISVQLEQVQSAPAWSNANKQAATVAADLPDFSFAPQEYITQIGQYLMT  609

Query  563  LPQQLEP----------LAEGISNSD---ANADEAQYFATEWMFKVAEGATALYVDQLRG  423
            LPQ LEP          LA  +++ +    +A+    FA   +  +A G    Y D + G
Sbjct  610  LPQHLEPFLLQDNPSLTLALQVADVEYGLLSAEAEGGFAGVLLGIIARGTCQTYCDNILG  669

Query  422  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVL  321
            I  +     +QL+ DI+YL NVL  L + +   L
Sbjct  670  ICELGSSSCKQLATDIDYLGNVLEDLGLSLSEHL  703



>ref|XP_004373515.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Trichechus 
manatus latirostris]
Length=770

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 82/178 (46%), Gaps = 24/178 (13%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADHWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  261
             +  I  +T    +QL+ DI+YL+NV+ AL +     L    + L T     ++  KS
Sbjct  696  VILQIPELTPHSTKQLATDIDYLTNVMDALGLQPSRTLQNIVTLLKTKPEDYRQATKS  753



>ref|XP_003418948.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Loxodonta 
africana]
Length=770

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 82/178 (46%), Gaps = 24/178 (13%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADHWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  261
             +  I  +T    +QL+ DI+YL+NV+ AL +     L    + L T     ++  KS
Sbjct  696  VILQIPELTPHSTKQLATDIDYLTNVMDALGLQPSRTLQNIVTLLKTKPEDYRQATKS  753



>ref|XP_011340196.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Cerapachys biroi]
Length=705

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 76/147 (52%), Gaps = 14/147 (10%)
 Frame = -2

Query  719  YDVLISKVRQHFNDLSRLPIWS---SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  549
            Y+V+ + +      + + P WS   S   + +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  520  YEVIFAPIFTQLLLVQKAPAWSADTSKMSNLSSDLPDYSFAPQEYITQVGQYLMTLPQHL  579

Query  548  EP--LAEGISNSDA-NADEAQY--FATEWMFK------VAEGATALYVDQLRGIQYITDR  402
            EP  L +  S + A  A + QY   +TE  F       VA G   +++DQ  GI  +   
Sbjct  580  EPFLLRDNPSLTQALKAADPQYAQVSTESGFTGILLDIVARGTCQMFLDQTLGICQLNSV  639

Query  401  GAQQLSVDIEYLSNVLSALSMPVPPVL  321
              +QL+ DI+YL NVL  L + +   L
Sbjct  640  ACKQLATDIDYLGNVLEELGLCLSENL  666



>ref|XP_007058642.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chelonia 
mydas]
 gb|EMP36935.1| Conserved oligomeric Golgi complex subunit 7 [Chelonia mydas]
Length=770

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 48/178 (27%), Positives = 81/178 (46%), Gaps = 24/178 (13%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +SR+  WSS  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLISRMEGWSSGGIGETLTDDLPNFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  VA      Y +
Sbjct  639  LHLEPF---VTQEDSALELALHAGKLPYPPEQGDELPELDNMADYWLGSVARATMQTYCE  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  261
             +  I  +T   A+QL+ DI+YL NV+ AL +     L    + L T     ++  KS
Sbjct  696  VILQIPELTLHSAKQLATDIDYLINVMDALGLQPSKTLQNIVTLLKTKPEDYRQTAKS  753



>gb|EFZ22757.1| hypothetical protein SINV_01051 [Solenopsis invicta]
Length=780

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 74/158 (47%), Gaps = 16/158 (10%)
 Frame = -2

Query  719  YDVLISKVRQHFNDLSRLPIWSSVEEHS----ARPLPTFSAYPQSYVTNVGEYLLTLPQQ  552
            Y+V+ + +      + + P WS VE +     +  LP +S  PQ Y+T VG+YL+TLPQ 
Sbjct  595  YEVIFAPIFTQLLLVQKAPAWS-VETNKMSNLSSELPDYSFAPQEYITQVGQYLMTLPQH  653

Query  551  LEP--------LAEGISNSD---ANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITD  405
            LEP        L + +  +D   A       F +  +  VA G   ++ DQ  GI  +  
Sbjct  654  LEPFLLRDNPSLTQALKAADPQYAQGSTESGFTSILLDIVARGTCQMFQDQTLGICQLNS  713

Query  404  RGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTP  291
               +QL+ DI+YL NVL  L + +   L      L  P
Sbjct  714  VACKQLATDIDYLGNVLEELGLCLSENLQHMSLLLRLP  751



>ref|XP_008434639.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Poecilia 
reticulata]
Length=769

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIW--SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            N+L +D +  +++     +S++     S++ E     LPTFS  PQ Y+TN+G+YL++LP
Sbjct  578  NQLAFDSVFLQIKHQLCLVSKMESQDASAIGESYTEDLPTFSLSPQEYITNIGQYLMSLP  637

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D   +                   E    A  W+  +A      Y D
Sbjct  638  LHLEPF---VTQEDPALELALHAGKLPFPPEQGDDLPELDNTADYWLGSIARATMQTYCD  694

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I +++    +QL+ DIEYLSNV+ AL +
Sbjct  695  AILLIPHLSPHSTKQLATDIEYLSNVMDALGL  726



>ref|XP_006125865.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Pelodiscus sinensis]
Length=700

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/178 (26%), Positives = 82/178 (46%), Gaps = 24/178 (13%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  WSS  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  509  HQLAFDSVFLRIKQQLLLISKMEGWSSGGIGETLTEDLPNFSLTPLEYISNIGQYIMSLP  568

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y +
Sbjct  569  LHLEPF---VTQEDSALELALHAGKLPYPPEQGDELPELDNMADYWLGSIARATMQTYCE  625

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  261
             +  I  +T   A+QL+ DI+YL NV+ AL +     L    + L T     +++ KS
Sbjct  626  VILQIPELTLHSAKQLATDIDYLINVMDALGLQPSKTLQNIVTLLKTKPEDYRQIAKS  683



>ref|XP_011340195.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Cerapachys biroi]
 gb|EZA53204.1| Conserved oligomeric Golgi complex subunit [Cerapachys biroi]
Length=735

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 76/147 (52%), Gaps = 14/147 (10%)
 Frame = -2

Query  719  YDVLISKVRQHFNDLSRLPIWS---SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  549
            Y+V+ + +      + + P WS   S   + +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  550  YEVIFAPIFTQLLLVQKAPAWSADTSKMSNLSSDLPDYSFAPQEYITQVGQYLMTLPQHL  609

Query  548  EP--LAEGISNSDA-NADEAQY--FATEWMFK------VAEGATALYVDQLRGIQYITDR  402
            EP  L +  S + A  A + QY   +TE  F       VA G   +++DQ  GI  +   
Sbjct  610  EPFLLRDNPSLTQALKAADPQYAQVSTESGFTGILLDIVARGTCQMFLDQTLGICQLNSV  669

Query  401  GAQQLSVDIEYLSNVLSALSMPVPPVL  321
              +QL+ DI+YL NVL  L + +   L
Sbjct  670  ACKQLATDIDYLGNVLEELGLCLSENL  696



>ref|XP_011159533.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Solenopsis 
invicta]
Length=735

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 74/158 (47%), Gaps = 16/158 (10%)
 Frame = -2

Query  719  YDVLISKVRQHFNDLSRLPIWSSVEEHS----ARPLPTFSAYPQSYVTNVGEYLLTLPQQ  552
            Y+V+ + +      + + P WS VE +     +  LP +S  PQ Y+T VG+YL+TLPQ 
Sbjct  550  YEVIFAPIFTQLLLVQKAPAWS-VETNKMSNLSSELPDYSFAPQEYITQVGQYLMTLPQH  608

Query  551  LEP--------LAEGISNSD---ANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITD  405
            LEP        L + +  +D   A       F +  +  VA G   ++ DQ  GI  +  
Sbjct  609  LEPFLLRDNPSLTQALKAADPQYAQGSTESGFTSILLDIVARGTCQMFQDQTLGICQLNS  668

Query  404  RGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTP  291
               +QL+ DI+YL NVL  L + +   L      L  P
Sbjct  669  VACKQLATDIDYLGNVLEELGLCLSENLQHMSLLLRLP  706



>ref|XP_005288959.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chrysemys 
picta bellii]
Length=770

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 81/178 (46%), Gaps = 24/178 (13%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +SR+  WSS  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLISRMEGWSSAGIGETLTDDLPNFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y +
Sbjct  639  LHLEPF---VTQEDSALELALHAGKLPYPPEQGDELPELDNMADYWLGSIARATMQTYCE  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  261
             +  I  +T   A+QL+ DI+YL NV+ AL +     L    + L T     ++  KS
Sbjct  696  VILQIPELTLHSAKQLATDIDYLINVMDALGLQPSKTLQNIVTLLKTKPEDYRQTAKS  753



>ref|XP_002953697.1| component of oligomeric golgi complex 7 [Volvox carteri f. nagariensis]
 gb|EFJ45321.1| component of oligomeric golgi complex 7 [Volvox carteri f. nagariensis]
Length=957

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/141 (32%), Positives = 66/141 (47%), Gaps = 26/141 (18%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEH----SARPLPTFSAYPQSYVTNVG  579
            F+  V   V+DVL+++V      L  LP W          +A PLPTF+ YP  YVT +G
Sbjct  652  FSSTVQSTVFDVLLARVASLLAPLPSLPEWRKAAGADPGTAAAPLPTFNTYPLPYVTAIG  711

Query  578  EYLLTLPQQLEPL--------AEGISNSDANADEA--------------QYFATEWMFKV  465
            ++L+ +PQQLE L        A G++   A A  A              +  A EW+ K 
Sbjct  712  DHLMAMPQQLEVLMGDTADEAASGVTIGTAAAVSADGSGAGSGDPTAEWEELAAEWLDKA  771

Query  464  AEGATALYVDQLRGIQYITDR  402
              GA  +Y D +  I  +T++
Sbjct  772  VSGAAGMYADTIFKIPTLTEQ  792



>ref|XP_004604166.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Sorex 
araneus]
Length=770

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    + R+  W++  + E     LPTFS  P  Y++N+G+YL++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVCRMDSWTTAGIGETLTDDLPTFSLTPLEYISNIGQYLMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADHWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  +T    +QL+ DI+YL+NV+ AL +
Sbjct  696  VILQIPELTPHSTKQLATDIDYLTNVMDALGL  727



>ref|XP_003961343.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Takifugu rubripes]
Length=769

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 72/152 (47%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWS--SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            N+L +D +  +++     +S++         E+    LPTFS  PQ Y+TN+G+YL++LP
Sbjct  578  NQLAFDSVFLQIKHQLCLVSKMETHEPPGFGENYTEDLPTFSLSPQEYITNIGQYLMSLP  637

Query  557  QQLEPLAEGISNSDANADEAQY-------------------FATEWMFKVAEGATALYVD  435
              LEP    ++  D   + A +                    A  W+  +A      Y D
Sbjct  638  LHLEPF---VTQEDPALEMALHAGKLPFPPEQGDDLPELDNVADYWLGSIARATMQTYCD  694

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  ++ R  +QL+ DI+YLSNV+ AL +
Sbjct  695  AILLIPQLSTRSTKQLATDIDYLSNVMDALGL  726



>gb|ENN72949.1| hypothetical protein YQE_10420, partial [Dendroctonus ponderosae]
Length=247

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 75/165 (45%), Gaps = 14/165 (8%)
 Frame = -2

Query  734  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSAR--PLPTFSAYPQSYVTNVGEYLLTL  561
            V+   Y V+   V  H   +S    W+  +  S     LP +S  PQ Y+T +G+YLL L
Sbjct  58   VHHTTYQVVFGPVSAHLEIVSASETWAQFDGSSLHNSDLPDYSFSPQEYITQIGQYLLEL  117

Query  560  PQQLEPL-----------AEGISNSDANA-DEAQYFATEWMFKVAEGATALYVDQLRGIQ  417
            PQ LEP             + I    A+A D     A  ++ KVA G    + +++  I 
Sbjct  118  PQHLEPFLFKENPALTCALKAIDQEYADAPDREGALAQIFLQKVARGICNSFAEKVLSIS  177

Query  416  YITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQ  282
             ++   ++QLS DI YL+N+L  L + +   L    + L  P  Q
Sbjct  178  TLSQPASRQLSHDINYLNNILQDLGITMSENLQQLLALLKIPPDQ  222



>ref|XP_007571524.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Poecilia formosa]
Length=769

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIW--SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            N+L +D +  +++     +S++     S++ E     LPTFS  PQ Y+TN+G+YL++LP
Sbjct  578  NQLAFDSVFLQIKHQLCLVSKMESQDASAIGESYTEDLPTFSLSPQEYITNIGQYLMSLP  637

Query  557  QQLEPLAEGISNSDANADEAQY-------------------FATEWMFKVAEGATALYVD  435
              LEP    ++  D   + A +                    A  W+  +A      Y D
Sbjct  638  LHLEPF---VTQEDPALEMALHAGKLPFPPEQGDDLPELDNTADYWLGSIARATMQTYCD  694

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  ++    +QL+ DIEYLSNV+ AL +
Sbjct  695  AILLIPRLSPHSTKQLATDIEYLSNVMDALGL  726



>ref|XP_007571519.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Poecilia formosa]
Length=769

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIW--SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            N+L +D +  +++     +S++     S++ E     LPTFS  PQ Y+TN+G+YL++LP
Sbjct  578  NQLAFDSVFLQIKHQLCLVSKMESQDASAIGESYTEDLPTFSLSPQEYITNIGQYLMSLP  637

Query  557  QQLEPLAEGISNSDANADEAQY-------------------FATEWMFKVAEGATALYVD  435
              LEP    ++  D   + A +                    A  W+  +A      Y D
Sbjct  638  LHLEPF---VTQEDPALEMALHAGKLPFPPDQGDDLPELDNTADYWLGSIARATMQTYCD  694

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  ++    +QL+ DIEYLSNV+ AL +
Sbjct  695  AILLIPRLSPHSTKQLATDIEYLSNVMDALGL  726



>ref|XP_001652664.1| AAEL007307-PA [Aedes aegypti]
 gb|EAT41036.1| AAEL007307-PA [Aedes aegypti]
Length=708

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 67/133 (50%), Gaps = 9/133 (7%)
 Frame = -2

Query  653  SVEEHSAR-PLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEG--------ISNSDANADE  501
            ++++HS    LP +S  PQ YVT +G+YLLTLPQ LEPL           +   +     
Sbjct  551  TIKQHSENYDLPDYSYAPQEYVTQIGQYLLTLPQHLEPLLLSPSPALKFIMEFCEDKYKG  610

Query  500  AQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVL  321
             +  A   +F + E  TA+Y +++  I  ++   A+QL+ DIEY  NVL  +S+ +   L
Sbjct  611  EKACADVLLFLIVEETTAMYQEKIDEILSLSASSAKQLATDIEYFGNVLEEMSLTLSTNL  670

Query  320  ATFHSCLSTPRSQ  282
                  L  P  Q
Sbjct  671  QQIIVLLRAPLDQ  683



>ref|XP_009194445.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Papio 
anubis]
Length=781

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 74/152 (49%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++ IW++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  590  HQLAFDSVFLRIKQQLLLISKMDIWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  649

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  650  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  706

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  ++   A+QL+ DI+YL NV+ AL +
Sbjct  707  AILQIPELSPHSAKQLATDIDYLINVMDALGL  738



>gb|ABC86343.1| IP14069p [Drosophila melanogaster]
Length=271

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 75/148 (51%), Gaps = 16/148 (11%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSAR--PLPTFSAYPQSYVTNVGEY  573
            FAD  +++  ++L+  +  H   + R P    V++H+A    +P+FS  PQ  +T +G+Y
Sbjct  87   FADT-HDITLNILLQPIETHLAHI-RPP----VQDHAASGIEMPSFSFAPQESITQIGQY  140

Query  572  LLTLPQQ--------LEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQ  417
            LLTLPQ            L + +   +    +A   A   +  V E    LYV Q+  I+
Sbjct  141  LLTLPQHLEPLLLSPSSLLKQALEVCNIKYTQAIPCADVLLSLVVEQCCVLYVTQILQIK  200

Query  416  YITDRGAQQLSVDIEYLSNVLSALSMPV  333
             +    A QLSVDIEYLSNVL  L + +
Sbjct  201  SLPSSAATQLSVDIEYLSNVLEELGLSI  228



>ref|XP_004360949.1| oligomeric Golgi complex component [Dictyostelium fasciculatum]
 gb|EGG23098.1| oligomeric Golgi complex component [Dictyostelium fasciculatum]
Length=861

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 95/219 (43%), Gaps = 43/219 (20%)
 Frame = -2

Query  746  FADAVNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLL  567
            F       +Y+ +I+ ++  F ++ ++  W    + +   + ++ +   +Y T + ++LL
Sbjct  648  FCSQSQHFIYETMITFIKLKFKEVPKMNEW----KQNLNIVDSYQSNQSAYSTQIADHLL  703

Query  566  TLPQQLEPLAE-------------------------------------GISNSDANADEA  498
            T+PQQL+P +E                                      IS++    D+ 
Sbjct  704  TIPQQLDPYSEEISLRFSYQIAISYPTNDEMYQNIIKQLHQTMLNETKDISDTSDIEDDM  763

Query  497  QYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLA  318
               A +W+  VA     LY+  +  I  +TD G   L+ DI YL NVLSAL +   P+L+
Sbjct  764  VGIAHQWIHIVACATEKLYLQSIVEITSLTDYGCHHLANDITYLFNVLSALGVAPDPLLS  823

Query  317  TFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  201
                 +  P+    E ++S  G + ++  A L+ KMR +
Sbjct  824  KTQLLVQIPKEAYLESIQSLEGGEKNI--AILISKMRSI  860



>ref|XP_006201263.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Vicugna 
pacos]
Length=770

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLISKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  696  AILQIPGLTPHSTKQLATDIDYLINVMDALGL  727



>ref|XP_008150973.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Eptesicus 
fuscus]
Length=770

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 80/178 (45%), Gaps = 24/178 (13%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            +EL +D +  +++Q    + ++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HELAFDSVFLRIKQQLLLIPKMESWSTAGIGETLTDALPTFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  261
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K 
Sbjct  696  VILQIPELTPHSTKQLATDIDYLVNVMDALGLQPSRTLQHVGTLLKTKPEDYRQVSKG  753



>ref|XP_003341699.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Monodelphis domestica]
Length=769

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 89/199 (45%), Gaps = 29/199 (15%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  578  HQLAFDSVFLRIKQQLLLISKMESWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  637

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  638  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADYWLGSIARATMQTYCD  694

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  255
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K   
Sbjct  695  VILQIPELTPHSTKQLATDIDYLINVMDALGLQPSRTLQNMVTLLKTKPEDYRQVAKG--  752

Query  254  GNQLDLPTANLVCKMRRVS  198
               L    A+ V  MR V+
Sbjct  753  ---LPRRLASKVASMRNVN  768



>ref|XP_006623839.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X2 [Apis dorsata]
Length=734

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 75/147 (51%), Gaps = 14/147 (10%)
 Frame = -2

Query  719  YDVLISKVRQHFNDLSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  549
            Y+V+ + +      + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  549  YEVIFAPIFTQLLLVQKAPAWSTEANKMIHLSADLPDYSFAPQEYITQVGQYLMTLPQHL  608

Query  548  EP--LAEGISNSDA-NADEAQYF--ATEWMFK------VAEGATALYVDQLRGIQYITDR  402
            EP  L E  S + A  A + QY   +TE  F       + +    +++DQ  GI  +   
Sbjct  609  EPFLLRENPSLTQALKAADPQYTQSSTESGFTDILLEIITKETCQMFLDQTLGICQLNSA  668

Query  401  GAQQLSVDIEYLSNVLSALSMPVPPVL  321
              +QL+ DI+YL NVL  L + +   L
Sbjct  669  ACKQLATDIDYLGNVLEELGLSLSENL  695



>ref|XP_006623838.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X1 [Apis dorsata]
Length=760

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 75/147 (51%), Gaps = 14/147 (10%)
 Frame = -2

Query  719  YDVLISKVRQHFNDLSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  549
            Y+V+ + +      + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  575  YEVIFAPIFTQLLLVQKAPAWSTEANKMIHLSADLPDYSFAPQEYITQVGQYLMTLPQHL  634

Query  548  EP--LAEGISNSDA-NADEAQYF--ATEWMFK------VAEGATALYVDQLRGIQYITDR  402
            EP  L E  S + A  A + QY   +TE  F       + +    +++DQ  GI  +   
Sbjct  635  EPFLLRENPSLTQALKAADPQYTQSSTESGFTDILLEIITKETCQMFLDQTLGICQLNSA  694

Query  401  GAQQLSVDIEYLSNVLSALSMPVPPVL  321
              +QL+ DI+YL NVL  L + +   L
Sbjct  695  ACKQLATDIDYLGNVLEELGLSLSENL  721



>ref|XP_004398866.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Odobenus 
rosmarus divergens]
Length=770

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 87/198 (44%), Gaps = 29/198 (15%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  255
             +  I  +T    +QL+ D++YL NV+ AL +     L    + L T     +++ K   
Sbjct  696  VILHIPELTPHSTKQLATDMDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG--  753

Query  254  GNQLDLPTANLVCKMRRV  201
               L    A  V  MR V
Sbjct  754  ---LPRRLATTVANMRNV  768



>ref|XP_003691700.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Apis florea]
Length=697

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 75/147 (51%), Gaps = 14/147 (10%)
 Frame = -2

Query  719  YDVLISKVRQHFNDLSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  549
            Y+V+ + +      + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  512  YEVIFAPIFTQLLLVQKAPAWSTEANKMIHLSADLPDYSFAPQEYITQVGQYLMTLPQHL  571

Query  548  EP--LAEGISNSDA-NADEAQYF--ATEWMFK------VAEGATALYVDQLRGIQYITDR  402
            EP  L E  S + A  A + QY   +TE  F       + +    +++DQ  GI  +   
Sbjct  572  EPFLLRENPSLTQALKAADPQYTQSSTESGFTDILLEIITKETCQMFLDQTLGICQLNSA  631

Query  401  GAQQLSVDIEYLSNVLSALSMPVPPVL  321
              +QL+ DI+YL NVL  L + +   L
Sbjct  632  ACKQLATDIDYLGNVLEELGLSLSENL  658



>ref|XP_008695386.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Ursus maritimus]
Length=761

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 87/198 (44%), Gaps = 29/198 (15%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  570  HQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  629

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  630  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  686

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  255
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K   
Sbjct  687  VILQIPELTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG--  744

Query  254  GNQLDLPTANLVCKMRRV  201
               L    A  V  MR V
Sbjct  745  ---LPRRLATTVANMRNV  759



>ref|XP_004442758.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ceratotherium 
simum simum]
Length=770

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/178 (25%), Positives = 81/178 (46%), Gaps = 24/178 (13%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLISKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  261
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K 
Sbjct  696  VILQIPELTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG  753



>ref|XP_394713.2| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Apis 
mellifera]
Length=733

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 75/147 (51%), Gaps = 14/147 (10%)
 Frame = -2

Query  719  YDVLISKVRQHFNDLSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  549
            Y+V+ + +      + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  548  YEVIFAPIFTQLLLVQKAPAWSTEANKMIHLSADLPDYSFAPQEYITQVGQYLMTLPQHL  607

Query  548  EP--LAEGISNSDA-NADEAQYF--ATEWMFK------VAEGATALYVDQLRGIQYITDR  402
            EP  L E  S + A  A + QY   +TE  F       + +    +++DQ  GI  +   
Sbjct  608  EPFLLRENPSLTQALKAADPQYTQSSTESGFTDILLEIITKETCQMFLDQTLGICQLNSA  667

Query  401  GAQQLSVDIEYLSNVLSALSMPVPPVL  321
              +QL+ DI+YL NVL  L + +   L
Sbjct  668  ACKQLATDIDYLGNVLEELGLCLSENL  694



>ref|XP_002927171.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ailuropoda 
melanoleuca]
 gb|EFB18307.1| hypothetical protein PANDA_016927 [Ailuropoda melanoleuca]
Length=770

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 87/198 (44%), Gaps = 29/198 (15%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADSWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  255
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K   
Sbjct  696  VILQIPELTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG--  753

Query  254  GNQLDLPTANLVCKMRRV  201
               L    A  V  MR V
Sbjct  754  ---LPRRLATTVAHMRNV  768



>ref|XP_004268622.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Orcinus 
orca]
Length=770

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+L+LP
Sbjct  579  HQLAFDSVFLRIKQQLLLISKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYILSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELSELDNMADSWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  696  AVLQIPELTPHSTKQLATDIDYLINVMDALGL  727



>ref|XP_011068677.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Acromyrmex 
echinatior]
Length=735

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 79/162 (49%), Gaps = 14/162 (9%)
 Frame = -2

Query  734  VNELVYDVLISKVRQHFNDLSRLPIWS---SVEEHSARPLPTFSAYPQSYVTNVGEYLLT  564
            ++ + Y+V+ + +      + + P W+   +   + +  LP +S  PQ Y+T VG+YL+T
Sbjct  545  LHHITYEVIFAPIFSQLLLVQKAPAWTLEANKMSNLSSDLPDYSFAPQEYITQVGQYLMT  604

Query  563  LPQQLEP--LAEGISNSDA-NADEAQY--------FATEWMFKVAEGATALYVDQLRGIQ  417
            LPQ LEP  L +  S + A  A + QY        F +  +  +A G   ++ DQ  GI 
Sbjct  605  LPQHLEPFLLRDNPSLTQALKAADPQYVQGSSESGFTSILLDIIARGTCQMFQDQTLGIC  664

Query  416  YITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTP  291
             +     +QL+ DI+YL NVL  L + +   L      L  P
Sbjct  665  QLNSVACKQLATDIDYLGNVLEELGLCLSENLQHMSLLLRLP  706



>gb|EGI69206.1| Conserved oligomeric Golgi complex subunit 7 [Acromyrmex echinatior]
Length=864

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 79/162 (49%), Gaps = 14/162 (9%)
 Frame = -2

Query  734  VNELVYDVLISKVRQHFNDLSRLPIWS---SVEEHSARPLPTFSAYPQSYVTNVGEYLLT  564
            ++ + Y+V+ + +      + + P W+   +   + +  LP +S  PQ Y+T VG+YL+T
Sbjct  674  LHHITYEVIFAPIFSQLLLVQKAPAWTLEANKMSNLSSDLPDYSFAPQEYITQVGQYLMT  733

Query  563  LPQQLEP--LAEGISNSDA-NADEAQY--------FATEWMFKVAEGATALYVDQLRGIQ  417
            LPQ LEP  L +  S + A  A + QY        F +  +  +A G   ++ DQ  GI 
Sbjct  734  LPQHLEPFLLRDNPSLTQALKAADPQYVQGSSESGFTSILLDIIARGTCQMFQDQTLGIC  793

Query  416  YITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTP  291
             +     +QL+ DI+YL NVL  L + +   L      L  P
Sbjct  794  QLNSVACKQLATDIDYLGNVLEELGLCLSENLQHMSLLLRLP  835



>ref|XP_010903275.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
 ref|XP_010903283.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
 ref|XP_010903290.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
Length=768

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 71/152 (47%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            N+L +D +  +++     +S++    +    E  A  LPTFS  PQ Y+TN+G+Y+++LP
Sbjct  577  NQLAFDSVFLQIKHQLCLVSKMESRDAGGFGESYAEDLPTFSLSPQEYITNIGQYIMSLP  636

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D   +                   E    A  W+  +A      Y D
Sbjct  637  LHLEPF---VTQEDPALELALHAGKLPFPPEQGDDLPELDNTADYWLGSIARATMQTYCD  693

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  +T    +QL+ DIEYLSNV+ AL +
Sbjct  694  AILLIPELTAHSTKQLATDIEYLSNVMDALGL  725



>gb|ELK37852.1| Conserved oligomeric Golgi complex subunit 7 [Myotis davidii]
Length=705

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 72/152 (47%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    + ++  WS+  + E     LPTFS  P  Y++N+G+Y+L+LP
Sbjct  514  HQLAFDSVFLRIKQQLLLIPKMESWSTAGIGETLTDALPTFSLTPLEYISNIGQYILSLP  573

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  574  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  630

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  631  VILQIPELTPHSTKQLATDIDYLVNVMDALGL  662



>ref|XP_004900783.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Heterocephalus glaber]
 gb|EHB13186.1| Conserved oligomeric Golgi complex subunit 7 [Heterocephalus 
glaber]
Length=770

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/178 (25%), Positives = 80/178 (45%), Gaps = 24/178 (13%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTEELPAFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALRAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  261
             +  I  +T    +QL+ DI YL NV+ AL +   P L +  + L       ++L K 
Sbjct  696  VILQIPELTPHSTKQLATDIAYLINVVDALGLRPSPTLQSIVTLLKAKPEGYRQLSKG  753



>ref|XP_004855999.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Heterocephalus 
glaber]
Length=770

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/178 (25%), Positives = 80/178 (45%), Gaps = 24/178 (13%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTEELPAFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALRAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  261
             +  I  +T    +QL+ DI YL NV+ AL +   P L +  + L       ++L K 
Sbjct  696  VILQIPELTPHSTKQLATDIAYLINVVDALGLRPSPTLQSIVTLLKAKPEGYRQLSKG  753



>ref|XP_007516677.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Erinaceus 
europaeus]
Length=759

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 81/178 (46%), Gaps = 24/178 (13%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    ++++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  568  HQLAFDSVFLRIKQQLLLVTKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  627

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  628  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  684

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  261
             +  I  +T    +QL+ DI+YL NV+ AL +     L +  + L T     ++  K 
Sbjct  685  IILQIPELTPHSTKQLATDIDYLINVMDALGLQPSRTLQSIATLLKTKPGDFRQASKG  742



>ref|XP_006753680.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Myotis 
davidii]
Length=770

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 72/152 (47%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    + ++  WS+  + E     LPTFS  P  Y++N+G+Y+L+LP
Sbjct  579  HQLAFDSVFLRIKQQLLLIPKMESWSTAGIGETLTDALPTFSLTPLEYISNIGQYILSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  696  VILQIPELTPHSTKQLATDIDYLVNVMDALGL  727



>ref|NP_001029061.1| conserved oligomeric Golgi complex subunit 7 [Rattus norvegicus]
 sp|Q3T1G7.1|COG7_RAT RecName: Full=Conserved oligomeric Golgi complex subunit 7; Short=COG 
complex subunit 7; AltName: Full=Component of oligomeric 
Golgi complex 7 [Rattus norvegicus]
 gb|AAI01932.1| Component of oligomeric golgi complex 7 [Rattus norvegicus]
 gb|EDM17578.1| component of oligomeric golgi complex 7 [Rattus norvegicus]
Length=770

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 80/178 (45%), Gaps = 24/178 (13%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGEELPELDNMADNWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  261
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L     + +++ K 
Sbjct  696  GILQIPAVTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIATLLKAKPEEYRQVSKG  753



>ref|XP_007615834.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cricetulus 
griseus]
Length=770

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 72/152 (47%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  696  VILQISEVTPHSTKQLATDIDYLINVMDALGL  727



>ref|XP_007105719.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Physeter 
catodon]
Length=770

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  VA      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADSWLGSVARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  696  AVLQIPELTPHSTKQLATDIDYLINVMDALGL  727



>ref|XP_007233023.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Astyanax mexicanus]
Length=545

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/178 (26%), Positives = 79/178 (44%), Gaps = 26/178 (15%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIW---SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTL  561
            N+L +D +  +++     L+  P +   + + E     LPTFS  PQ Y+TN+G+Y+++L
Sbjct  354  NQLAFDSVFLQIKHQLC-LANKPEFRGSAGLGETLNENLPTFSLSPQEYITNIGQYIMSL  412

Query  560  PQQLEPLAEGISNSDA-------------------NADEAQYFATEWMFKVAEGATALYV  438
            P  LEP    ++  D                    +  E +  A  W+  +A      Y 
Sbjct  413  PLHLEPF---VTQEDPALELALHTGKLPYPPEQGDDVPELENTADYWLGSIARATMQTYC  469

Query  437  DQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVK  264
            D +  IQ +     +QL+ DI+YLSNV+ AL +     L    + L     + ++  K
Sbjct  470  DVILQIQELNPHSTKQLATDIDYLSNVMDALGLQTSRTLQNITTLLRAKPEEFRQTAK  527



>ref|XP_007450043.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Lipotes 
vexillifer]
Length=770

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLISKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADSWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  696  AVLQIPELTPHSTKQLATDIDYLINVMDALGL  727



>gb|EPQ17692.1| Conserved oligomeric Golgi complex subunit 7 [Myotis brandtii]
Length=705

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 44/178 (25%), Positives = 80/178 (45%), Gaps = 24/178 (13%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    + ++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  514  HQLAFDSVFLRIKQQLLLIPKMESWSTAGIGETLTDALPTFSLTPLEYISNIGQYIMSLP  573

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  574  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  630

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  261
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K 
Sbjct  631  VILQIPELTPHSTKQLATDIDYLVNVMDALGLQPSRTLQHVGTLLKTKPEDYRQVSKG  688



>gb|ERL93874.1| hypothetical protein D910_11160 [Dendroctonus ponderosae]
Length=663

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 75/165 (45%), Gaps = 14/165 (8%)
 Frame = -2

Query  734  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSAR--PLPTFSAYPQSYVTNVGEYLLTL  561
            V+   Y V+   V  H   +S    W+  +  S     LP +S  PQ Y+T +G+YLL L
Sbjct  474  VHHTTYQVVFGPVSAHLEIVSASETWAQFDGSSLHNSDLPDYSFSPQEYITQIGQYLLEL  533

Query  560  PQQLEPL-----------AEGISNSDANA-DEAQYFATEWMFKVAEGATALYVDQLRGIQ  417
            PQ LEP             + I    A+A D     A  ++ KVA G    + +++  I 
Sbjct  534  PQHLEPFLFKENPALTCALKAIDQEYADAPDREGALAQIFLQKVARGICNSFAEKVLSIS  593

Query  416  YITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQ  282
             ++   ++QLS DI YL+NVL  L + +   L    + L  P  Q
Sbjct  594  TLSQPASRQLSHDINYLNNVLQDLGITMSENLQQLLALLKIPPDQ  638



>ref|XP_004453849.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Dasypus 
novemcinctus]
Length=770

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLISKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDDLPELDNMADNWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  696  VILQIPELTPHSTKQLATDIDYLINVMDALGL  727



>ref|XP_010184345.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Mesitornis 
unicolor]
 gb|KFQ27417.1| Conserved oligomeric Golgi complex subunit 7 [Mesitornis unicolor]
Length=769

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 44/178 (25%), Positives = 80/178 (45%), Gaps = 24/178 (13%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            + L +D + ++++Q    +S++  W+S  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  578  HHLAFDSVFTRIKQQLLLVSKMEGWNSGGIGETLTEDLPNFSLTPLEYISNIGQYIMSLP  637

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y +
Sbjct  638  LHLEPF---VTQEDSALEVALHAGKLPYPPEQGDELPELDNMADYWLGSIARATMQTYCE  694

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  261
             +  I  +T   A+QL+ DI+YL NV+ AL +     L    + L       ++  KS
Sbjct  695  VILQIPELTAHSAKQLATDIDYLINVMDALGLQPSRTLQNIVALLKAKPEDFRQTAKS  752



>gb|ERE78144.1| conserved oligomeric Golgi complex subunit 7 [Cricetulus griseus]
Length=1090

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 72/152 (47%), Gaps = 24/152 (16%)
 Frame = -2

Query  731   NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
             ++L +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  899   HQLAFDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  958

Query  557   QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
               LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  959   LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  1015

Query  434   QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
              +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  1016  VILQISEVTPHSTKQLATDIDYLINVMDALGL  1047



>ref|XP_004691773.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Condylura 
cristata]
Length=770

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 82/178 (46%), Gaps = 24/178 (13%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMERWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  261
             +  I  +T    +QL+ DI+YL NV+ AL +    +L +  + L     + ++  K 
Sbjct  696  VILQIPELTPHSTKQLATDIDYLINVMDALGLQPSRMLQSIATLLKAKPEEYRQASKG  753



>ref|XP_005882395.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Myotis 
brandtii]
Length=757

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 44/178 (25%), Positives = 80/178 (45%), Gaps = 24/178 (13%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    + ++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  566  HQLAFDSVFLRIKQQLLLIPKMESWSTAGIGETLTDALPTFSLTPLEYISNIGQYIMSLP  625

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  626  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  682

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  261
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K 
Sbjct  683  VILQIPELTPHSTKQLATDIDYLVNVMDALGLQPSRTLQHVGTLLKTKPEDYRQVSKG  740



>ref|XP_004670260.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Jaculus 
jaculus]
Length=770

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 87/199 (44%), Gaps = 29/199 (15%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    + ++  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVPKMDSWTTAGIGETLTEDLPAFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  VA      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELAELDNMADNWLGSVARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  255
             +  I  +T    +QL+ DI+YL NV+ AL +     L +  + L     + ++L K   
Sbjct  696  MILQIPELTLHSTKQLATDIDYLINVMDALGLQPSRTLQSIITLLKAKPEEYRQLSKG--  753

Query  254  GNQLDLPTANLVCKMRRVS  198
               L    A  V  MR VS
Sbjct  754  ---LPRRLATTVAAMRGVS  769



>ref|XP_001510180.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ornithorhynchus 
anatinus]
Length=777

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/178 (25%), Positives = 81/178 (46%), Gaps = 24/178 (13%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  W+S  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  586  HQLAFDSVFLRIKQQLLLVSKMESWNSGGIGETLTEDLPTFSLTPLEYISNIGQYIMSLP  645

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y +
Sbjct  646  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADYWLGSIARATMQTYCE  702

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  261
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L T   + ++  K 
Sbjct  703  VILQIPELTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEEYRQTAKG  760



>gb|EDL17254.1| component of oligomeric golgi complex 7 [Mus musculus]
Length=823

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 80/178 (45%), Gaps = 24/178 (13%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  632  HQLAFDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  691

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  692  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  748

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  261
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L     + +++ K 
Sbjct  749  VILQIPEVTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIAALLKAKPEEYRQVSKG  806



>ref|XP_005351192.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Microtus 
ochrogaster]
Length=770

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 80/178 (45%), Gaps = 24/178 (13%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  261
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L     + +++ K 
Sbjct  696  VILQIPEVTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKAKPEEYRQISKG  753



>ref|XP_003795773.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
1 [Otolemur garnettii]
Length=772

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/152 (26%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q  + +S++  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  581  HQLAFDSVFLRIKQQLSLISKMDSWNTAGIGETLTDELPAFSLTPLEYISNIGQYIMSLP  640

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  641  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  697

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  698  VILQIPELTPHSTKQLATDIDYLINVMDALGL  729



>ref|XP_006912615.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Pteropus 
alecto]
Length=755

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    + ++  WS+  V E  A  LP FS  P  Y++N+G+Y+++LP
Sbjct  564  HQLAFDSVFLRIKQQLLLVPKMESWSTAGVGESLADGLPAFSLTPLEYISNIGQYIMSLP  623

Query  557  QQLEPLAEGISNSDANADEAQY-------------------FATEWMFKVAEGATALYVD  435
              LEP    ++  D+  + A +                    A  W+  +A      Y D
Sbjct  624  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  680

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  681  VILQIPTLTPHSTKQLATDIDYLINVMDALGL  712



>ref|XP_004778381.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Mustela putorius furo]
 ref|XP_004819145.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Mustela putorius furo]
Length=770

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDEPPELDNMADNWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  696  VILQIPELTPHSTKQLATDIDYLINVMDALGL  727



>sp|Q3UM29.1|COG7_MOUSE RecName: Full=Conserved oligomeric Golgi complex subunit 7; Short=COG 
complex subunit 7; AltName: Full=Component of oligomeric 
Golgi complex 7 [Mus musculus]
 dbj|BAE26269.1| unnamed protein product [Mus musculus]
Length=770

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 80/178 (45%), Gaps = 24/178 (13%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  261
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L     + +++ K 
Sbjct  696  VILQIPEVTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIAALLKAKPEEYRQVSKG  753



>ref|XP_006085923.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Myotis lucifugus]
Length=949

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 72/152 (47%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    + ++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  758  HQLAFDSVFLRIKQQLLLIPKMESWSTAGIGETLTDALPTFSLTPLEYISNIGQYIMSLP  817

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  818  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  874

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  875  VILQIPELTPHSTKQLATDIDYLVNVMDALGL  906



>ref|XP_005405157.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X4 [Chinchilla lanigera]
Length=685

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/199 (25%), Positives = 89/199 (45%), Gaps = 29/199 (15%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  494  HQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTEELPAFSLTPLEYISNIGQYIMSLP  553

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  554  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADSWLGSIARATMQTYCD  610

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  255
             +  I  +T   ++QL+ DI+YL NV+ AL +     L +  + L       ++L K   
Sbjct  611  VILQIPELTAHSSKQLATDIDYLINVMDALGLQPSRTLQSIVTLLKAKPEDYRQLSKG--  668

Query  254  GNQLDLPTANLVCKMRRVS  198
               L    A+ V  MR V+
Sbjct  669  ---LPRRLASTVAAMRGVN  684



>ref|XP_005405155.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Chinchilla lanigera]
Length=770

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/199 (25%), Positives = 89/199 (45%), Gaps = 29/199 (15%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTEELPAFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADSWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  255
             +  I  +T   ++QL+ DI+YL NV+ AL +     L +  + L       ++L K   
Sbjct  696  VILQIPELTAHSSKQLATDIDYLINVMDALGLQPSRTLQSIVTLLKAKPEDYRQLSKG--  753

Query  254  GNQLDLPTANLVCKMRRVS  198
               L    A+ V  MR V+
Sbjct  754  ---LPRRLASTVAAMRGVN  769



>ref|NP_001028490.2| conserved oligomeric Golgi complex subunit 7 [Mus musculus]
 dbj|BAE32768.1| unnamed protein product [Mus musculus]
Length=770

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 80/178 (45%), Gaps = 24/178 (13%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  261
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L     + +++ K 
Sbjct  696  VILQIPEVTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIAALLKAKPEEYRQVSKG  753



>ref|XP_006808092.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Neolamprologus brichardi]
Length=769

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/177 (27%), Positives = 78/177 (44%), Gaps = 24/177 (14%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            N+L +D +  +++     +S++    S  + E     LP FS  PQ Y+TN+G+YL++LP
Sbjct  578  NQLAFDSVFMQIKHQLCLVSKMESQESPGLGESYTEDLPNFSLSPQEYITNIGQYLMSLP  637

Query  557  QQLEPLAEGISNSD----------------ANADEAQYF---ATEWMFKVAEGATALYVD  435
              LEP    ++  D                   DE       A  W+  +A      Y D
Sbjct  638  LHLEPF---VTQEDPALEMALHAGKLPFPPEQGDELTELDNTADYWLGSIARATMQTYCD  694

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVK  264
             +  I  ++    +QL+ DI+YLSNV+ AL +     L    + L T   + ++  K
Sbjct  695  AILLIPQLSTHSTKQLATDIDYLSNVMDALGLQPSRTLQNIVTLLRTKPQEYRQTAK  751



>ref|XP_006085922.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Myotis lucifugus]
Length=950

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 72/152 (47%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    + ++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  759  HQLAFDSVFLRIKQQLLLIPKMESWSTAGIGETLTDALPTFSLTPLEYISNIGQYIMSLP  818

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  819  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  875

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  876  VILQIPELTPHSTKQLATDIDYLVNVMDALGL  907



>ref|XP_005405156.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X3 [Chinchilla lanigera]
Length=705

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/199 (25%), Positives = 89/199 (45%), Gaps = 29/199 (15%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  514  HQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTEELPAFSLTPLEYISNIGQYIMSLP  573

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  574  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADSWLGSIARATMQTYCD  630

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  255
             +  I  +T   ++QL+ DI+YL NV+ AL +     L +  + L       ++L K   
Sbjct  631  VILQIPELTAHSSKQLATDIDYLINVMDALGLQPSRTLQSIVTLLKAKPEDYRQLSKG--  688

Query  254  GNQLDLPTANLVCKMRRVS  198
               L    A+ V  MR V+
Sbjct  689  ---LPRRLASTVAAMRGVN  704



>gb|ELK12106.1| Conserved oligomeric Golgi complex subunit 7 [Pteropus alecto]
Length=660

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 72/152 (47%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    + ++  WS+  V E  A  LP FS  P  Y++N+G+Y+++LP
Sbjct  469  HQLAFDSVFLRIKQQLLLVPKMESWSTAGVGESLADGLPAFSLTPLEYISNIGQYIMSLP  528

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  529  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  585

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  586  VILQIPTLTPHSTKQLATDIDYLINVMDALGL  617



>ref|XP_005405154.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Chinchilla lanigera]
Length=794

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/199 (25%), Positives = 89/199 (45%), Gaps = 29/199 (15%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  603  HQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTEELPAFSLTPLEYISNIGQYIMSLP  662

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  663  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADSWLGSIARATMQTYCD  719

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  255
             +  I  +T   ++QL+ DI+YL NV+ AL +     L +  + L       ++L K   
Sbjct  720  VILQIPELTAHSSKQLATDIDYLINVMDALGLQPSRTLQSIVTLLKAKPEDYRQLSKG--  777

Query  254  GNQLDLPTANLVCKMRRVS  198
               L    A+ V  MR V+
Sbjct  778  ---LPRRLASTVAAMRGVN  793



>gb|AAQ88995.1| COG7 [Homo sapiens]
Length=491

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/152 (26%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  300  HQLAFDSVFLRIKQQLLLISKMDSWNTAGIGETLTDELPAFSLTPLEYISNIGQYIMSLP  359

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  360  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  416

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  ++   A+QL+ DI+YL NV+ AL +
Sbjct  417  AILQIPELSPHSAKQLATDIDYLINVMDALGL  448



>ref|XP_003261698.2| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nomascus 
leucogenys]
Length=712

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/152 (26%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +S++  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  521  HQLAFDSVFMRIKQQLLLISKMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  580

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  581  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  637

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  ++   A+QL+ DI+YL NV+ AL +
Sbjct  638  AILQIPELSPHSAKQLATDIDYLINVMDALGL  669



>ref|XP_005063464.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Mesocricetus 
auratus]
Length=715

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 72/152 (47%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  524  HQLAFDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  583

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  584  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  640

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  641  VILQIPEVTPHSTKQLATDIDYLINVMDALGL  672



>ref|XP_003513853.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cricetulus 
griseus]
 gb|EGV91994.1| Conserved oligomeric Golgi complex subunit 7 [Cricetulus griseus]
Length=770

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 72/152 (47%), Gaps = 24/152 (16%)
 Frame = -2

Query  731  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  558
            ++L +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  638

Query  557  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  435
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  434  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  339
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  696  VILQIPEVTPHSTKQLATDIDYLINVMDALGL  727



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1374325004630