BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF024F19

Length=730
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002285602.1|  PREDICTED: TOM1-like protein 2                     258   3e-80   
ref|XP_011075789.1|  PREDICTED: target of Myb protein 1                 258   3e-80   Sesamum indicum [beniseed]
emb|CDP04931.1|  unnamed protein product                                255   3e-79   Coffea canephora [robusta coffee]
ref|XP_009608733.1|  PREDICTED: TOM1-like protein 2                     247   4e-76   Nicotiana tomentosiformis
ref|XP_002275091.1|  PREDICTED: TOM1-like protein 2                     244   7e-75   Vitis vinifera
ref|XP_007029586.1|  Target of Myb protein 1 isoform 1                  243   2e-74   
ref|XP_010267653.1|  PREDICTED: TOM1-like protein 2                     240   2e-73   Nelumbo nucifera [Indian lotus]
emb|CAN70382.1|  hypothetical protein VITISV_020135                     240   7e-73   Vitis vinifera
ref|XP_006347578.1|  PREDICTED: TOM1-like protein 2-like isoform X1     238   3e-72   Solanum tuberosum [potatoes]
ref|XP_002520034.1|  protein transporter, putative                      235   2e-71   Ricinus communis
ref|XP_004235312.1|  PREDICTED: TOM1-like protein 2                     235   2e-71   Solanum lycopersicum
ref|XP_009788191.1|  PREDICTED: TOM1-like protein 2                     235   3e-71   Nicotiana sylvestris
gb|EYU45379.1|  hypothetical protein MIMGU_mgv1a007671mg                234   8e-71   Erythranthe guttata [common monkey flower]
ref|XP_006376006.1|  hypothetical protein POPTR_0013s07880g             232   2e-70   Populus trichocarpa [western balsam poplar]
ref|XP_011084615.1|  PREDICTED: TOM1-like protein 2                     232   3e-70   
ref|XP_009351819.1|  PREDICTED: TOM1-like protein 2                     231   5e-70   
ref|XP_008382040.1|  PREDICTED: TOM1-like protein 2                     229   4e-69   Malus domestica [apple tree]
ref|XP_004511421.1|  PREDICTED: TOM1-like protein 2-like                229   6e-69   Cicer arietinum [garbanzo]
gb|KDP21763.1|  hypothetical protein JCGZ_00550                         228   7e-69   Jatropha curcas
ref|XP_009361163.1|  PREDICTED: TOM1-like protein 2 isoform X2          228   8e-69   Pyrus x bretschneideri [bai li]
ref|XP_010276808.1|  PREDICTED: TOM1-like protein 2                     228   9e-69   Nelumbo nucifera [Indian lotus]
ref|XP_004307860.1|  PREDICTED: target of Myb protein 1                 228   1e-68   Fragaria vesca subsp. vesca
ref|XP_010063284.1|  PREDICTED: TOM1-like protein 2                     227   2e-68   
ref|XP_006443227.1|  hypothetical protein CICLE_v10020497mg             227   3e-68   Citrus clementina [clementine]
ref|XP_008376923.1|  PREDICTED: TOM1-like protein 2 isoform X2          226   5e-68   Malus domestica [apple tree]
ref|NP_001239879.1|  uncharacterized protein LOC100793134               225   2e-67   Glycine max [soybeans]
ref|XP_009361159.1|  PREDICTED: TOM1-like protein 2 isoform X1          224   5e-67   
gb|AGS41185.1|  MYB transcription factor 9                              222   3e-66   Tamarix hispida
ref|XP_008376920.1|  PREDICTED: TOM1-like protein 2 isoform X1          222   3e-66   Malus domestica [apple tree]
ref|XP_011006026.1|  PREDICTED: TOM1-like protein 2                     221   5e-66   Populus euphratica
ref|XP_010919989.1|  PREDICTED: TOM1-like protein 2                     220   8e-66   Elaeis guineensis
ref|XP_007218111.1|  hypothetical protein PRUPE_ppa006768mg             220   2e-65   Prunus persica
gb|KJB18441.1|  hypothetical protein B456_003G052900                    218   2e-65   Gossypium raimondii
gb|KJB18439.1|  hypothetical protein B456_003G052900                    219   4e-65   Gossypium raimondii
gb|ABR28337.1|  MYB transcription factor MYB49                          219   5e-65   Medicago truncatula
gb|AFK35545.1|  unknown                                                 218   8e-65   Medicago truncatula
ref|XP_003610830.1|  Hepatocyte growth factor-regulated tyrosine ...    218   1e-64   Medicago truncatula
ref|XP_008234559.1|  PREDICTED: target of Myb protein 1                 217   2e-64   Prunus mume [ume]
ref|XP_010492622.1|  PREDICTED: TOM1-like protein 2                     218   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_007157069.1|  hypothetical protein PHAVU_002G040300g             216   8e-64   Phaseolus vulgaris [French bean]
ref|XP_008813149.1|  PREDICTED: TOM1-like protein 2                     212   2e-62   Phoenix dactylifera
gb|KJB82229.1|  hypothetical protein B456_013G183000                    212   2e-62   Gossypium raimondii
gb|KJB82228.1|  hypothetical protein B456_013G183000                    212   3e-62   Gossypium raimondii
gb|KHG15259.1|  TOM1-like protein 2                                     211   6e-62   Gossypium arboreum [tree cotton]
ref|XP_011007173.1|  PREDICTED: TOM1-like protein 2                     210   7e-62   Populus euphratica
gb|KJB26742.1|  hypothetical protein B456_004G257100                    210   1e-61   Gossypium raimondii
gb|KHF97708.1|  TOM1-like protein 2                                     209   2e-61   Gossypium arboreum [tree cotton]
ref|XP_010940789.1|  PREDICTED: TOM1-like protein 2                     207   7e-61   Elaeis guineensis
ref|XP_010558637.1|  PREDICTED: TOM1-like protein 2                     205   6e-60   Tarenaya hassleriana [spider flower]
ref|XP_006854075.1|  hypothetical protein AMTR_s00048p00118270          205   9e-60   
ref|XP_010087473.1|  TOM1-like protein 2                                204   1e-59   Morus notabilis
gb|KDO47247.1|  hypothetical protein CISIN_1g0161121mg                  194   1e-58   Citrus sinensis [apfelsine]
ref|XP_009388422.1|  PREDICTED: TOM1-like protein 2                     200   4e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006371246.1|  hypothetical protein POPTR_0019s07660g             192   7e-58   
ref|XP_010671112.1|  PREDICTED: TOM1-like protein 2                     199   1e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006387339.1|  hypothetical protein POPTR_1218s00200g             191   1e-57   
ref|XP_010420395.1|  PREDICTED: TOM1-like protein 2                     199   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_004144724.1|  PREDICTED: TOM1-like protein 2-like                195   5e-56   Cucumis sativus [cucumbers]
ref|XP_004167394.1|  PREDICTED: TOM1-like protein 2-like                195   5e-56   
ref|NP_001047818.1|  Os02g0697300                                       195   6e-56   
ref|XP_006400231.1|  hypothetical protein EUTSA_v10013718mg             194   1e-55   Eutrema salsugineum [saltwater cress]
ref|XP_003570152.1|  PREDICTED: TOM1-like protein 2                     193   2e-55   Brachypodium distachyon [annual false brome]
gb|EMS45324.1|  TOM1-like protein 2                                     192   9e-55   Triticum urartu
emb|CBI20131.3|  unnamed protein product                                186   2e-54   Vitis vinifera
ref|XP_003580255.1|  PREDICTED: TOM1-like protein 2                     191   2e-54   Brachypodium distachyon [annual false brome]
ref|XP_006647730.1|  PREDICTED: TOM1-like protein 2-like                191   2e-54   Oryza brachyantha
ref|XP_010525051.1|  PREDICTED: TOM1-like protein 2                     191   3e-54   Tarenaya hassleriana [spider flower]
emb|CDX70725.1|  BnaC03g08090D                                          191   3e-54   
ref|XP_008452808.1|  PREDICTED: TOM1-like protein 2                     190   4e-54   Cucumis melo [Oriental melon]
ref|XP_009131569.1|  PREDICTED: TOM1-like protein 2                     187   7e-53   Brassica rapa
emb|CDX78717.1|  BnaA03g06290D                                          187   7e-53   
ref|XP_007131520.1|  hypothetical protein PHAVU_011G019800g             187   1e-52   Phaseolus vulgaris [French bean]
ref|XP_009399424.1|  PREDICTED: TOM1-like protein 2                     184   1e-51   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY16971.1|  BnaC09g40980D                                          183   2e-51   Brassica napus [oilseed rape]
ref|XP_010549833.1|  PREDICTED: TOM1-like protein 2                     183   2e-51   Tarenaya hassleriana [spider flower]
ref|XP_009121426.1|  PREDICTED: TOM1-like protein 2                     182   5e-51   Brassica rapa
emb|CDX69412.1|  BnaA10g17610D                                          182   6e-51   
gb|EMT04498.1|  TOM1-like protein 2                                     181   1e-50   
ref|XP_010453865.1|  PREDICTED: TOM1-like protein 2                     179   7e-50   Camelina sativa [gold-of-pleasure]
ref|XP_002882268.1|  VHS domain-containing protein                      178   3e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_002871740.1|  VHS domain-containing protein                      177   3e-49   
dbj|BAJ86080.1|  predicted protein                                      177   4e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006287873.1|  hypothetical protein CARUB_v10001100mg             177   4e-49   Capsella rubella
ref|XP_009384136.1|  PREDICTED: TOM1-like protein 2                     176   6e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006297827.1|  hypothetical protein CARUB_v10013862mg             176   7e-49   Capsella rubella
ref|NP_001148639.1|  protein transporter                                176   8e-49   
ref|NP_197190.1|  Target of Myb protein 1                               174   7e-48   Arabidopsis thaliana [mouse-ear cress]
gb|ABK24381.1|  unknown                                                 173   1e-47   Picea sitchensis
emb|CBI26517.3|  unnamed protein product                                166   1e-46   Vitis vinifera
ref|XP_004953557.1|  PREDICTED: TOM1-like protein 2-like isoform X1     169   3e-46   
gb|EMS61071.1|  TOM1-like protein 2                                     168   9e-46   Triticum urartu
gb|EMT21212.1|  TOM1-like protein 2                                     166   6e-45   
ref|XP_008643658.1|  PREDICTED: protein transporter isoform X1          165   1e-44   
ref|XP_006408352.1|  hypothetical protein EUTSA_v10020862mg             165   2e-44   Eutrema salsugineum [saltwater cress]
gb|EPS72882.1|  hypothetical protein M569_01871                         165   2e-44   Genlisea aurea
gb|AAL58181.1|AC027037_3  hepatocyte growth factor-regulated tyro...    164   3e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008800065.1|  PREDICTED: TOM1-like protein 2                     164   5e-44   Phoenix dactylifera
gb|ABR25582.1|  protein transporter                                     157   1e-43   Oryza sativa Indica Group [Indian rice]
gb|EAY79641.1|  hypothetical protein OsI_34785                          160   6e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_003607430.1|  Class E vacuolar protein-sorting machinery p...    158   7e-42   
gb|KEH30668.1|  protein transporter                                     158   1e-41   Medicago truncatula
ref|NP_001132563.1|  putative VHS/GAT domain containing family pr...    157   2e-41   Zea mays [maize]
gb|AFW63470.1|  putative VHS/GAT domain containing family protein       156   2e-41   
ref|XP_006592014.1|  PREDICTED: TOM1-like protein 2-like                154   3e-40   
gb|KHN46460.1|  TOM1-like protein 2                                     154   4e-40   Glycine soja [wild soybean]
ref|XP_006662105.1|  PREDICTED: TOM1-like protein 2-like                147   6e-38   Oryza brachyantha
gb|EMS54006.1|  TOM1-like protein 2                                     145   4e-37   Triticum urartu
gb|ADE76488.1|  unknown                                                 143   2e-36   Picea sitchensis
ref|XP_004983533.1|  PREDICTED: TOM1-like protein 2-like                143   2e-36   Setaria italica
gb|EMT15900.1|  TOM1-like protein 2                                     140   6e-35   
ref|XP_003574387.1|  PREDICTED: TOM1-like protein 2                     139   1e-34   Brachypodium distachyon [annual false brome]
ref|XP_002975969.1|  hypothetical protein SELMODRAFT_232686             136   9e-34   Selaginella moellendorffii
ref|XP_002968515.1|  hypothetical protein SELMODRAFT_89807              135   1e-33   Selaginella moellendorffii
ref|XP_010034944.1|  PREDICTED: TOM1-like protein 2                     132   2e-32   Eucalyptus grandis [rose gum]
gb|AFG59987.1|  hypothetical protein 2_7619_01                          124   2e-31   Pinus taeda
gb|AFG59986.1|  hypothetical protein 2_7619_01                          123   2e-31   Pinus taeda
gb|AFG59980.1|  hypothetical protein 2_7619_01                          123   4e-31   Pinus taeda
gb|ACJ85033.1|  unknown                                                 127   5e-31   Medicago truncatula
gb|AFG59978.1|  hypothetical protein 2_7619_01                          122   6e-31   Pinus taeda
ref|XP_001779411.1|  predicted protein                                  127   8e-31   
gb|AFG59991.1|  hypothetical protein 2_7619_01                          121   2e-30   Pinus taeda
ref|XP_001757968.1|  predicted protein                                  117   7e-27   
gb|KCW46173.1|  hypothetical protein EUGRSUZ_K00082                     109   2e-24   Eucalyptus grandis [rose gum]
gb|AFK45485.1|  unknown                                               79.7    1e-15   Medicago truncatula
ref|NP_850834.1|  Target of Myb protein 1                             82.8    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008805226.1|  PREDICTED: TOM1-like protein 2                   80.5    4e-14   Phoenix dactylifera
ref|XP_006857283.1|  hypothetical protein AMTR_s00067p00032430        80.1    4e-14   Amborella trichopoda
ref|XP_010935906.1|  PREDICTED: TOM1-like protein 2                   76.3    8e-13   Elaeis guineensis
ref|XP_007050288.1|  ENTH/VHS/GAT family protein                      73.2    1e-11   
ref|XP_010679306.1|  PREDICTED: TOM1-like protein 2                   72.4    3e-11   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG16514.1|  TOM1-like protein 2                                   70.1    1e-10   Gossypium arboreum [tree cotton]
gb|EYU17922.1|  hypothetical protein MIMGU_mgv1a008118mg              70.1    2e-10   Erythranthe guttata [common monkey flower]
gb|KDO60489.1|  hypothetical protein CISIN_1g0411491mg                66.6    2e-10   Citrus sinensis [apfelsine]
ref|XP_006417945.1|  hypothetical protein EUTSA_v10007923mg           69.3    2e-10   Eutrema salsugineum [saltwater cress]
gb|KJB09952.1|  hypothetical protein B456_001G177600                  68.6    2e-10   Gossypium raimondii
ref|XP_006479538.1|  PREDICTED: TOM1-like protein 1-like isoform X1   68.9    3e-10   Citrus sinensis [apfelsine]
ref|XP_011004050.1|  PREDICTED: TOM1-like protein 2 isoform X2        68.2    7e-10   Populus euphratica
emb|CDY10185.1|  BnaC05g04280D                                        67.8    7e-10   Brassica napus [oilseed rape]
ref|XP_004289949.1|  PREDICTED: TOM1-like protein 2                   68.2    7e-10   Fragaria vesca subsp. vesca
ref|XP_002307649.2|  hypothetical protein POPTR_0005s24650g           68.2    8e-10   
ref|XP_002300774.2|  hypothetical protein POPTR_0002s03910g           67.8    9e-10   
gb|KJB42271.1|  hypothetical protein B456_007G146500                  67.8    9e-10   Gossypium raimondii
gb|KHG07549.1|  TOM1-like protein 2                                   67.8    9e-10   Gossypium arboreum [tree cotton]
ref|XP_002278050.1|  PREDICTED: TOM1-like protein 2                   67.4    9e-10   
ref|XP_011013579.1|  PREDICTED: TOM1-like protein 2                   67.8    1e-09   Populus euphratica
ref|XP_011028806.1|  PREDICTED: TOM1-like protein 2                   67.8    1e-09   Populus euphratica
emb|CBI37124.3|  unnamed protein product                              67.4    2e-09   Vitis vinifera
ref|XP_011004048.1|  PREDICTED: TOM1-like protein 2 isoform X1        67.0    2e-09   Populus euphratica
ref|XP_002889591.1|  VHS domain-containing protein                    66.6    2e-09   Arabidopsis lyrata subsp. lyrata
gb|KJB11326.1|  hypothetical protein B456_001G253900                  66.6    2e-09   Gossypium raimondii
ref|XP_009796852.1|  PREDICTED: TOM1-like protein 2                   66.6    2e-09   Nicotiana sylvestris
ref|XP_006351672.1|  PREDICTED: target of Myb protein 1-like          66.6    2e-09   Solanum tuberosum [potatoes]
ref|NP_563762.1|  ENTH/VHS/GAT family protein                         66.2    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305076.1|  hypothetical protein CARUB_v10009444mg           66.2    3e-09   Capsella rubella
ref|XP_002993154.1|  hypothetical protein SELMODRAFT_136575           66.2    3e-09   
ref|XP_002964154.1|  hypothetical protein SELMODRAFT_82329            66.2    3e-09   
ref|XP_010246780.1|  PREDICTED: TOM1-like protein 2                   66.2    3e-09   Nelumbo nucifera [Indian lotus]
emb|CDY69303.1|  BnaA06g39960D                                        63.5    3e-09   Brassica napus [oilseed rape]
ref|XP_010485879.1|  PREDICTED: TOM1-like protein 2                   66.2    3e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010457748.1|  PREDICTED: target of Myb protein 1-like          65.9    4e-09   Camelina sativa [gold-of-pleasure]
ref|XP_009118551.1|  PREDICTED: target of Myb protein 1-like          65.9    4e-09   Brassica rapa
emb|CDY06201.1|  BnaA09g50020D                                        65.5    4e-09   
ref|XP_009631518.1|  PREDICTED: TOM1-like protein 2                   65.5    5e-09   Nicotiana tomentosiformis
ref|XP_010475349.1|  PREDICTED: target of Myb protein 1-like          65.5    6e-09   Camelina sativa [gold-of-pleasure]
gb|KDP26526.1|  hypothetical protein JCGZ_17684                       65.1    6e-09   Jatropha curcas
ref|XP_004246945.1|  PREDICTED: TOM1-like protein 2                   65.1    7e-09   
emb|CDY47727.1|  BnaA10g04160D                                        61.2    8e-09   Brassica napus [oilseed rape]
ref|XP_002532031.1|  protein transporter, putative                    64.3    1e-08   Ricinus communis
emb|CDY47726.1|  BnaA10g04150D                                        63.9    1e-08   Brassica napus [oilseed rape]
gb|KHN10745.1|  hypothetical protein glysoja_019176                   63.5    1e-08   Glycine soja [wild soybean]
emb|CDY09983.1|  BnaC08g44680D                                        63.9    2e-08   Brassica napus [oilseed rape]
ref|XP_002973972.1|  hypothetical protein SELMODRAFT_57331            62.8    2e-08   
emb|CDP03748.1|  unnamed protein product                              63.2    3e-08   Coffea canephora [robusta coffee]
ref|XP_008364318.1|  PREDICTED: TOM1-like protein 1                   62.8    4e-08   
gb|EYU46453.1|  hypothetical protein MIMGU_mgv1a023292mg              62.0    7e-08   Erythranthe guttata [common monkey flower]
gb|AAK27511.1|AF343969_1  ADP-ribosylation factor 60                  59.3    7e-08   Coffea arabica [arabica coffee]
ref|XP_007162547.1|  hypothetical protein PHAVU_001G161300g           62.0    8e-08   Phaseolus vulgaris [French bean]
gb|AGV54699.1|  target of Myb protein 1-like protein                  62.0    9e-08   Phaseolus vulgaris [French bean]
gb|KHN02502.1|  Target of Myb protein 1                               61.6    1e-07   Glycine soja [wild soybean]
ref|XP_002969092.1|  hypothetical protein SELMODRAFT_67275            60.5    1e-07   
ref|XP_008235674.1|  PREDICTED: uncharacterized protein LOC103334474  61.2    1e-07   Prunus mume [ume]
ref|XP_011080045.1|  PREDICTED: TOM1-like protein 2                   61.2    2e-07   Sesamum indicum [beniseed]
gb|KEH23932.1|  ENTH/VHS/GAT family protein                           61.2    2e-07   Medicago truncatula
ref|XP_007199901.1|  hypothetical protein PRUPE_ppa006710mg           60.8    2e-07   Prunus persica
ref|XP_010522149.1|  PREDICTED: target of Myb protein 1               60.5    2e-07   Tarenaya hassleriana [spider flower]
ref|XP_004493778.1|  PREDICTED: target of Myb protein 1-like          60.1    3e-07   Cicer arietinum [garbanzo]
ref|XP_002990208.1|  hypothetical protein SELMODRAFT_44205            52.0    2e-04   
gb|AAX96738.1|  seed protein B32E                                     51.2    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009400790.1|  PREDICTED: TOM1-like protein 1                   50.8    5e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE51810.1|  hypothetical protein OsJ_33283                        50.4    6e-04   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001067438.1|  Os11g0199700                                     50.4    6e-04   
gb|AAL65395.1|  seed protein B32E                                     50.1    6e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002992483.1|  hypothetical protein SELMODRAFT_269934           50.4    6e-04   
gb|EEC67842.1|  hypothetical protein OsI_35454                        50.4    7e-04   Oryza sativa Indica Group [Indian rice]



>ref|XP_002285602.1| PREDICTED: TOM1-like protein 2 [Vitis vinifera]
 ref|XP_010644084.1| PREDICTED: TOM1-like protein 2 [Vitis vinifera]
 ref|XP_010644085.1| PREDICTED: TOM1-like protein 2 [Vitis vinifera]
Length=395

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKE FDVARNS+ELLTTVLSSSPQQDAL+DDLTTTLVQQC QSQ TVQRIIETAGD+E
Sbjct  225  EQTKETFDVARNSIELLTTVLSSSPQQDALKDDLTTTLVQQCHQSQFTVQRIIETAGDDE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI K LSKYEE++KP+ VP  PEPAMIPVAVEP+ES    KEDSLIRKP
Sbjct  285  ALLFEALNVNDEIQKVLSKYEELMKPSEVPHEPEPAMIPVAVEPEESPRYAKEDSLIRKP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AGSR G+  G +DEMMDDLDEMIFGKK GG+SE  HD KKQQ PKDDLISF
Sbjct  345  AGSRGGSQGGHHDEMMDDLDEMIFGKKVGGTSEGTHDAKKQQSPKDDLISF  395



>ref|XP_011075789.1| PREDICTED: target of Myb protein 1 [Sesamum indicum]
Length=395

 Score =   258 bits (658),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNSVELL+TVLSSSPQQDAL+DDLT TL QQCR+SQ TVQRIIETAGDNE
Sbjct  225  EQTKEAFDVARNSVELLSTVLSSSPQQDALQDDLTITLFQQCRESQYTVQRIIETAGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI K +SKYE++ KP VVP  PEPA+IPVAVEPD+S   GKE+SLIRKP
Sbjct  285  ALLFEALNVNDEIQKVISKYEDMRKPTVVPQQPEPALIPVAVEPDDSPRAGKEESLIRKP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            +G R  +H G NDEMMDDLDEMIFGKK GG+SESG D KKQQP KDDLISF
Sbjct  345  SGGRSRSHGGNNDEMMDDLDEMIFGKKGGGTSESGQDAKKQQPTKDDLISF  395



>emb|CDP04931.1| unnamed protein product [Coffea canephora]
Length=395

 Score =   255 bits (652),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNSVELL TVLSSSPQQDAL+DDLT TLVQQCR+SQ TVQRIIE AGDNE
Sbjct  225  EQTKEAFDVARNSVELLATVLSSSPQQDALKDDLTVTLVQQCRESQYTVQRIIERAGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI K LSKY+++ KP  V   PEPAMIPVAVEPD+S  VGKED+LIRKP
Sbjct  285  ALLFEALNVNDEIQKVLSKYDDMKKPLEVKPEPEPAMIPVAVEPDDSPRVGKEDALIRKP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AGSR GA  G NDEMMDDLDEMIFGKK GG+SE GH+ KKQQ PKDDLISF
Sbjct  345  AGSRTGAQGGNNDEMMDDLDEMIFGKKPGGTSEGGHNAKKQQGPKDDLISF  395



>ref|XP_009608733.1| PREDICTED: TOM1-like protein 2 [Nicotiana tomentosiformis]
Length=395

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 155/171 (91%), Gaps = 1/171 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNSVELLTTVLSSSPQQDAL+DDLTTTLVQQCRQS NTVQRIIETAGDNE
Sbjct  226  EQTKEAFDVARNSVELLTTVLSSSPQQDALQDDLTTTLVQQCRQSLNTVQRIIETAGDNE  285

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALN+NDE+ KALSKY+E+ KP VV S PEPAMIPVAVEPDES   GKED+LIRKP
Sbjct  286  ALLFEALNINDEVQKALSKYDELKKPMVVSSEPEPAMIPVAVEPDESPRAGKEDALIRKP  345

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AGSR   H G ND+MMDDLDEMIFGKKAGG+SESGHD KKQQ PKDDLISF
Sbjct  346  AGSRSAVHGG-NDDMMDDLDEMIFGKKAGGTSESGHDTKKQQSPKDDLISF  395



>ref|XP_002275091.1| PREDICTED: TOM1-like protein 2 [Vitis vinifera]
 ref|XP_010662111.1| PREDICTED: TOM1-like protein 2 [Vitis vinifera]
 emb|CAN66798.1| hypothetical protein VITISV_044233 [Vitis vinifera]
Length=395

 Score =   244 bits (623),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELLT+VLSSSPQQDAL+DDLTTTLVQQC QSQ TVQ IIETAGDNE
Sbjct  225  EQTKEAFDVARNSIELLTSVLSSSPQQDALKDDLTTTLVQQCHQSQFTVQSIIETAGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI K LS Y+E+ KP+VVP  PEPAMIPVA+EPDES    KEDSLIRKP
Sbjct  285  ALLFEALNVNDEIQKVLSNYDELKKPSVVPPEPEPAMIPVAIEPDESPRCAKEDSLIRKP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AGSR GA  G NDEMMDDLDEMIFGKK GG+SE GHD KKQQ PKDDLI+F
Sbjct  345  AGSRGGAQGGNNDEMMDDLDEMIFGKKVGGTSEGGHDAKKQQSPKDDLITF  395



>ref|XP_007029586.1| Target of Myb protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007029587.1| Target of Myb protein 1 isoform 1 [Theobroma cacao]
 gb|EOY10088.1| Target of Myb protein 1 isoform 1 [Theobroma cacao]
 gb|EOY10089.1| Target of Myb protein 1 isoform 1 [Theobroma cacao]
Length=401

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELL+TVLSSSPQQDALEDDLTTTLVQQCRQSQ+TV RIIETAGDNE
Sbjct  231  EQTKEAFDVARNSIELLSTVLSSSPQQDALEDDLTTTLVQQCRQSQSTVLRIIETAGDNE  290

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            A+LFEALNVNDEI KALSKYEE+ KP++V   PEPAMIPVAVEPD+S +  KED+LIRKP
Sbjct  291  AMLFEALNVNDEIQKALSKYEELKKPSLVAHEPEPAMIPVAVEPDDSPHHAKEDALIRKP  350

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AG+R G H G ND+MMDDLDEMIFGKK GGSSESG D KKQQ PKDDLI+F
Sbjct  351  AGTRHGTHGGSNDDMMDDLDEMIFGKKGGGSSESGQDSKKQQAPKDDLITF  401



>ref|XP_010267653.1| PREDICTED: TOM1-like protein 2 [Nelumbo nucifera]
 ref|XP_010267655.1| PREDICTED: TOM1-like protein 2 [Nelumbo nucifera]
 ref|XP_010267656.1| PREDICTED: TOM1-like protein 2 [Nelumbo nucifera]
 ref|XP_010267657.1| PREDICTED: TOM1-like protein 2 [Nelumbo nucifera]
Length=393

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 146/171 (85%), Gaps = 1/171 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELL+TVLSSSPQQD L+DDLTTTLVQQCRQSQ TVQRIIETAGDNE
Sbjct  224  EQTKEAFDVARNSIELLSTVLSSSPQQDVLKDDLTTTLVQQCRQSQFTVQRIIETAGDNE  283

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI K LSKYEE+ KP+  P   +PAMIPV+ EPDES  VGKE++LIRK 
Sbjct  284  ALLFEALNVNDEIQKVLSKYEELKKPSAAPLETQPAMIPVSTEPDESPSVGKEEALIRKS  343

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AGSR G+  G    ++DDLDEMIFGKKAGG+SE G D KKQQ PKDDLI+F
Sbjct  344  AGSRGGSQGG-EQAILDDLDEMIFGKKAGGTSEGGQDPKKQQSPKDDLITF  393



>emb|CAN70382.1| hypothetical protein VITISV_020135 [Vitis vinifera]
Length=431

 Score =   240 bits (612),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 150/207 (72%), Gaps = 36/207 (17%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALE-----------------------------  637
            EQTKE FDVARNS+ELLTTVLSSSPQQDAL+                             
Sbjct  225  EQTKETFDVARNSIELLTTVLSSSPQQDALKLAGLDCIDIYETAMRDEEDEDEDAKTYYF  284

Query  636  -------DDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEII  478
                   DDLTTTLVQQC QSQ TVQRIIETAGD+EALLFEALNVNDEI K LSKYEE++
Sbjct  285  YMYRSIADDLTTTLVQQCHQSQFTVQRIIETAGDDEALLFEALNVNDEIQKVLSKYEELM  344

Query  477  KPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKPAGSRPGAHNGPNDEMMDDLDEMIF  298
            KP+ VP  PEPAMIPVAVEP+ES    KEDSLIRKPAGSR G+  G +DEMMDDLDEMIF
Sbjct  345  KPSEVPHEPEPAMIPVAVEPEESPRYAKEDSLIRKPAGSRGGSQGGHHDEMMDDLDEMIF  404

Query  297  GKKAGGSSESGHDQKKQQPPKDDLISF  217
            GKK GG+SE  HD KKQQ PKDDLISF
Sbjct  405  GKKVGGTSEGTHDAKKQQSPKDDLISF  431



>ref|XP_006347578.1| PREDICTED: TOM1-like protein 2-like isoform X1 [Solanum tuberosum]
 ref|XP_006347579.1| PREDICTED: TOM1-like protein 2-like isoform X2 [Solanum tuberosum]
Length=396

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E TKE FDVARNS+ELLTTVLSSSPQQDAL+DDLT TLVQQCRQS N VQRIIETAGDNE
Sbjct  226  ENTKEVFDVARNSIELLTTVLSSSPQQDALQDDLTVTLVQQCRQSLNIVQRIIETAGDNE  285

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDE+ KALSKY+E+ KP VV S PEPAMIPVAVEP+ES   GKED+LIRK 
Sbjct  286  ALLFEALNVNDEVQKALSKYDELKKPTVVSSEPEPAMIPVAVEPEESPRAGKEDALIRKS  345

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AGSR     G ND+MMDDLDEMIFGKKAGG+SESGHD KKQQ PKDDLISF
Sbjct  346  AGSRSAVQGGSNDDMMDDLDEMIFGKKAGGTSESGHDSKKQQSPKDDLISF  396



>ref|XP_002520034.1| protein transporter, putative [Ricinus communis]
 gb|EEF42358.1| protein transporter, putative [Ricinus communis]
Length=395

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 152/171 (89%), Gaps = 0/171 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELLTTVLSSSP+QDAL+DDLT TLVQQCRQSQ+TVQRIIETAGDNE
Sbjct  225  EQTKEAFDVARNSIELLTTVLSSSPEQDALKDDLTITLVQQCRQSQSTVQRIIETAGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI K L+KYE++ KP+VV S PEPAMIPVAVEPDES    KED+LIRKP
Sbjct  285  ALLFEALNVNDEIQKVLTKYEDLKKPSVVSSEPEPAMIPVAVEPDESPIHAKEDALIRKP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AGSR GAH G ND+MMDDLDEMIFGKK+GG+SE   D KKQQ  KDDLISF
Sbjct  345  AGSRGGAHGGSNDDMMDDLDEMIFGKKSGGTSEGTRDPKKQQSSKDDLISF  395



>ref|XP_004235312.1| PREDICTED: TOM1-like protein 2 [Solanum lycopersicum]
 ref|XP_010318281.1| PREDICTED: TOM1-like protein 2 [Solanum lycopersicum]
Length=396

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E TKE FDVARNS+ELLTTVLSSSPQQDAL+DDLT TLVQQCRQS N VQRIIETAGDNE
Sbjct  226  ENTKEVFDVARNSIELLTTVLSSSPQQDALQDDLTVTLVQQCRQSLNIVQRIIETAGDNE  285

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDE+ KALSKY+++ KP VV S PEPAMIPVAVEP+ES   GKED+LIRK 
Sbjct  286  ALLFEALNVNDEVQKALSKYDDLKKPTVVLSEPEPAMIPVAVEPEESPRAGKEDALIRKS  345

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AGSR     G ND+MMDDLDEMIFGKKAGG+SESGHD KKQQ PKDDLISF
Sbjct  346  AGSRSAVQGGSNDDMMDDLDEMIFGKKAGGTSESGHDSKKQQSPKDDLISF  396



>ref|XP_009788191.1| PREDICTED: TOM1-like protein 2 [Nicotiana sylvestris]
Length=395

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 151/171 (88%), Gaps = 1/171 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNSVELLTTVLSSSPQQDAL+DDL+ TLVQQCRQS NTVQRIIETAGDNE
Sbjct  226  EQTKEAFDVARNSVELLTTVLSSSPQQDALQDDLSATLVQQCRQSLNTVQRIIETAGDNE  285

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALN+NDE+ KALSKY+E+ KP VV S PEPAMIPVAVEPDES   GKED+LIRKP
Sbjct  286  ALLFEALNINDEVQKALSKYDELKKPMVVSSEPEPAMIPVAVEPDESPRAGKEDALIRKP  345

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            +GSR   H G ND+MMDDLDEMIFGKK  G+SES HD KKQQ PKDDLISF
Sbjct  346  SGSRSAVHGG-NDDMMDDLDEMIFGKKVDGTSESRHDTKKQQSPKDDLISF  395



>gb|EYU45379.1| hypothetical protein MIMGU_mgv1a007671mg [Erythranthe guttata]
 gb|EYU45380.1| hypothetical protein MIMGU_mgv1a007671mg [Erythranthe guttata]
Length=399

 Score =   234 bits (596),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 147/175 (84%), Gaps = 5/175 (3%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELL+TVL+SSPQQDAL+DDLT TL QQC +SQ TVQRIIETAGDNE
Sbjct  226  EQTKEAFDVARNSIELLSTVLTSSPQQDALQDDLTITLFQQCHESQYTVQRIIETAGDNE  285

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI K LSKYE++ KP VVP  PEPAMIPVAVEPD+S  VG E +L+RKP
Sbjct  286  ALLFEALNVNDEIQKVLSKYEDMKKPLVVPQEPEPAMIPVAVEPDDSPRVGTEHALVRKP  345

Query  369  A--GSRPGAHNGPNDEMMDDLDEMIFGKKAGGS--SESGHDQKKQQPPKDDLISF  217
            +   +R G +N  NDEMMDDLDEMIFGKK G +  S SG D KKQQPPKDDLISF
Sbjct  346  SSGATRQGGNNN-NDEMMDDLDEMIFGKKGGATSSSSSGQDAKKQQPPKDDLISF  399



>ref|XP_006376006.1| hypothetical protein POPTR_0013s07880g [Populus trichocarpa]
 gb|ERP53803.1| hypothetical protein POPTR_0013s07880g [Populus trichocarpa]
Length=394

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELLTTVLSSSPQQDAL+D L TTLVQQC QSQ TVQRIIETAGDNE
Sbjct  225  EQTKEAFDVARNSIELLTTVLSSSPQQDALQDGLATTLVQQCHQSQLTVQRIIETAGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFE LNVNDEI K LSKYEE+  P+VVP+ PEPA+IPVAVEPD S    KED LIRKP
Sbjct  285  ALLFEGLNVNDEIQKVLSKYEELKTPSVVPAVPEPALIPVAVEPD-SPIHAKEDVLIRKP  343

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AG + G H G +D+M+DDLDEMIFGKK G +SE   D KKQQ  KDDLISF
Sbjct  344  AGPQDGTHGGSSDDMIDDLDEMIFGKKGGNASEGAQDPKKQQFSKDDLISF  394



>ref|XP_011084615.1| PREDICTED: TOM1-like protein 2 [Sesamum indicum]
Length=389

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 144/171 (84%), Gaps = 6/171 (4%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELL+TVLSSSPQQDAL+D+LT+TL+QQCR+SQ TVQRIIETAG+NE
Sbjct  225  EQTKEAFDVARNSIELLSTVLSSSPQQDALQDELTSTLLQQCRESQYTVQRIIETAGENE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI K LSKYE++ +P VVP  PEPAMIPVAVEP          +LIRKP
Sbjct  285  ALLFEALNVNDEIQKVLSKYEDMKQPLVVPREPEPAMIPVAVEPXXXX------ALIRKP  338

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            + +R G   G NDEMMDDLDEMIFGKK+G +SE+ HD KK+QP KDDLI+F
Sbjct  339  SNARTGGQGGNNDEMMDDLDEMIFGKKSGSTSEAAHDTKKKQPNKDDLITF  389



>ref|XP_009351819.1| PREDICTED: TOM1-like protein 2 [Pyrus x bretschneideri]
 ref|XP_009351820.1| PREDICTED: TOM1-like protein 2 [Pyrus x bretschneideri]
 ref|XP_009351821.1| PREDICTED: TOM1-like protein 2 [Pyrus x bretschneideri]
 ref|XP_009351822.1| PREDICTED: TOM1-like protein 2 [Pyrus x bretschneideri]
 ref|XP_009351823.1| PREDICTED: TOM1-like protein 2 [Pyrus x bretschneideri]
Length=396

 Score =   231 bits (590),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 149/172 (87%), Gaps = 1/172 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQ KEAFDVARNS+ELL TV SSSPQQDAL+DDLTTTLVQQCRQS +TVQRIIETAG+NE
Sbjct  225  EQPKEAFDVARNSIELLNTVFSSSPQQDALQDDLTTTLVQQCRQSLSTVQRIIETAGENE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI KALSKYEE+I+P+VVP+APEPAMIPVAVEPDES    KEDSLIRKP
Sbjct  285  ALLFEALNVNDEIHKALSKYEELIRPSVVPTAPEPAMIPVAVEPDESPSHAKEDSLIRKP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQ-PPKDDLISF  217
            A SR   H G ND+MMDDLDEMIFGKK G SSE   D KKQQ P KDDLISF
Sbjct  345  AASRGLVHAGSNDDMMDDLDEMIFGKKGGSSSEGSQDPKKQQTPAKDDLISF  396



>ref|XP_008382040.1| PREDICTED: TOM1-like protein 2 [Malus domestica]
 ref|XP_008382046.1| PREDICTED: TOM1-like protein 2 [Malus domestica]
 ref|XP_008382053.1| PREDICTED: TOM1-like protein 2 [Malus domestica]
 ref|XP_008382062.1| PREDICTED: TOM1-like protein 2 [Malus domestica]
 ref|XP_008382070.1| PREDICTED: TOM1-like protein 2 [Malus domestica]
Length=396

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 150/172 (87%), Gaps = 1/172 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQ KEAFDVARNS+ELL +VLSSSPQQDAL+D+LTTTLVQQCRQS +TVQRIIETAG+NE
Sbjct  225  EQPKEAFDVARNSIELLNSVLSSSPQQDALQDELTTTLVQQCRQSLSTVQRIIETAGENE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI KALSKYEE+I+P+VVP+APEPAMIPVAVEPDES    KEDSLIR+P
Sbjct  285  ALLFEALNVNDEIHKALSKYEELIRPSVVPTAPEPAMIPVAVEPDESPSHAKEDSLIRRP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQ-PPKDDLISF  217
            A SR   H G ND+MMDDLDEMIFGKK G SSE   D KKQQ P KDDLISF
Sbjct  345  AASRGLVHAGSNDDMMDDLDEMIFGKKGGSSSEGSQDPKKQQTPAKDDLISF  396



>ref|XP_004511421.1| PREDICTED: TOM1-like protein 2-like [Cicer arietinum]
Length=399

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 137/173 (79%), Positives = 148/173 (86%), Gaps = 2/173 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKE FDVARNS+ELL+TVLSSSPQQD L+DDLTTTLV QCR+SQ TVQRI+ETAGDNE
Sbjct  227  EQTKEVFDVARNSIELLSTVLSSSPQQDVLQDDLTTTLVHQCRRSQTTVQRIVETAGDNE  286

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDES--SYVGKEDSLIR  376
            ALLFEALNVNDEI K L+KYEE+  P V P  PEPAMIPVAVEPDES      KEDSLIR
Sbjct  287  ALLFEALNVNDEIQKVLTKYEELKPPPVAPLHPEPAMIPVAVEPDESPRHLDTKEDSLIR  346

Query  375  KPAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            KPAGSRPG   G ND+MMDDLDEMIFGKK+G +S+ GHD KKQQPPKDDLISF
Sbjct  347  KPAGSRPGVQGGSNDDMMDDLDEMIFGKKSGDASDGGHDTKKQQPPKDDLISF  399



>gb|KDP21763.1| hypothetical protein JCGZ_00550 [Jatropha curcas]
Length=395

 Score =   228 bits (582),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAF+VARNS+ELLTTVLSSSP+QDAL+DDLTTTLVQQCR+SQ TVQRIIETAGDNE
Sbjct  225  EQTKEAFNVARNSIELLTTVLSSSPKQDALQDDLTTTLVQQCRRSQTTVQRIIETAGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI K LSKYEE+ KP+ + S  EPAMIPVAVEPD+S   GKED+LIRKP
Sbjct  285  ALLFEALNVNDEIQKVLSKYEELKKPSTLSSESEPAMIPVAVEPDDSPVHGKEDALIRKP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AGSR G H G ND+MMDDLDEMIFGKK+GG+SE  H+ K QQ  K+DLISF
Sbjct  345  AGSRGGTHGGSNDDMMDDLDEMIFGKKSGGTSEGAHEPKTQQSSKNDLISF  395



>ref|XP_009361163.1| PREDICTED: TOM1-like protein 2 isoform X2 [Pyrus x bretschneideri]
Length=396

 Score =   228 bits (582),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 148/172 (86%), Gaps = 1/172 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELL TV SSSPQQDAL+DDLT TLVQQCRQS +TVQRIIETAG+NE
Sbjct  225  EQTKEAFDVARNSIELLNTVFSSSPQQDALQDDLTATLVQQCRQSLSTVQRIIETAGENE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI KALSKYEE+I+P+VVP+APEPAMIPVAVEPDES    +ED LIRKP
Sbjct  285  ALLFEALNVNDEIHKALSKYEELIRPSVVPTAPEPAMIPVAVEPDESPSRVREDYLIRKP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQ-PPKDDLISF  217
            A SR   H G ND+MMDDLDEMIFGKK G SSE   D KKQQ P KDDLISF
Sbjct  345  AASRGLVHAGSNDDMMDDLDEMIFGKKGGSSSEGSQDPKKQQTPAKDDLISF  396



>ref|XP_010276808.1| PREDICTED: TOM1-like protein 2 [Nelumbo nucifera]
 ref|XP_010276809.1| PREDICTED: TOM1-like protein 2 [Nelumbo nucifera]
Length=396

 Score =   228 bits (582),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 145/174 (83%), Gaps = 4/174 (2%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELL+TVLSSSPQQD L+DDLTTTLVQQCRQSQ T+QRIIETAGDNE
Sbjct  224  EQTKEAFDVARNSIELLSTVLSSSPQQDVLKDDLTTTLVQQCRQSQFTIQRIIETAGDNE  283

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAP---EPAMIPVAVEPDESSYVGKEDSLI  379
            ALLFEALNVNDEI K LSK EE+ KP+V   AP   + AM   A+EPDES  VGKE++LI
Sbjct  284  ALLFEALNVNDEIQKVLSKCEELKKPSVASVAPPETQAAMSSFAIEPDESPSVGKEEALI  343

Query  378  RKPAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            RK +GSR GA  G  D++MDDLDEMIFGKKAGG+SE   D KKQQ PKDDLI+F
Sbjct  344  RKSSGSRGGARAG-EDDIMDDLDEMIFGKKAGGTSEGSQDPKKQQSPKDDLITF  396



>ref|XP_004307860.1| PREDICTED: target of Myb protein 1 [Fragaria vesca subsp. vesca]
 ref|XP_011470127.1| PREDICTED: target of Myb protein 1 [Fragaria vesca subsp. vesca]
Length=395

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 151/172 (88%), Gaps = 2/172 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQ+KEAFDVA+NS+ELL+TVLSSSPQQDAL+DDLTTTLV QCRQSQ TVQRIIE+AG+NE
Sbjct  225  EQSKEAFDVAKNSIELLSTVLSSSPQQDALQDDLTTTLVYQCRQSQATVQRIIESAGENE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI KALSKYEE+ KP+V    PEPAMIPVAVEPDES   GKEDSLIRKP
Sbjct  285  ALLFEALNVNDEIHKALSKYEEMTKPSVAHQQPEPAMIPVAVEPDESPIHGKEDSLIRKP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPP-KDDLISF  217
            A SR GAH G ND+MMDDLDEMIFGKK G S+E G D KKQQPP KDDLISF
Sbjct  345  AASR-GAHGGINDDMMDDLDEMIFGKKGGSSTEGGQDPKKQQPPSKDDLISF  395



>ref|XP_010063284.1| PREDICTED: TOM1-like protein 2 [Eucalyptus grandis]
 ref|XP_010063292.1| PREDICTED: TOM1-like protein 2 [Eucalyptus grandis]
 ref|XP_010063301.1| PREDICTED: TOM1-like protein 2 [Eucalyptus grandis]
 gb|KCW90948.1| hypothetical protein EUGRSUZ_A02971 [Eucalyptus grandis]
 gb|KCW90949.1| hypothetical protein EUGRSUZ_A02971 [Eucalyptus grandis]
Length=395

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELL TVLSSSP+QDAL+DDLT TLVQQCR+SQ+TVQRIIETAGDNE
Sbjct  225  EQTKEAFDVARNSIELLMTVLSSSPEQDALKDDLTITLVQQCRRSQSTVQRIIETAGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            A+LFEALNVNDEI K L KYEE+ KPA  P+ P+PAMIPV+VEP+ES  + KED+LIRKP
Sbjct  285  AVLFEALNVNDEIQKVLLKYEELQKPAFAPAEPQPAMIPVSVEPEESPALAKEDALIRKP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AG R GAH G ND+MMDDLDEMIFGKK GGSSE G D KK Q  KDDLI+F
Sbjct  345  AGFRGGAHGGSNDDMMDDLDEMIFGKKTGGSSEGGQDSKKSQSKKDDLITF  395



>ref|XP_006443227.1| hypothetical protein CICLE_v10020497mg [Citrus clementina]
 ref|XP_006478931.1| PREDICTED: TOM1-like protein 2-like isoform X1 [Citrus sinensis]
 ref|XP_006478932.1| PREDICTED: TOM1-like protein 2-like isoform X2 [Citrus sinensis]
 gb|ESR56467.1| hypothetical protein CICLE_v10020497mg [Citrus clementina]
Length=395

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELL+TVLSSSPQQDAL+DDLTTTLVQQCRQSQ TVQRIIETAGDNE
Sbjct  225  EQTKEAFDVARNSIELLSTVLSSSPQQDALQDDLTTTLVQQCRQSQITVQRIIETAGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI K L+KYEE+ KP+  P+ PEPAMIPVAVEPD+S    KED+LIRKP
Sbjct  285  ALLFEALNVNDEIQKVLTKYEELKKPSGAPAEPEPAMIPVAVEPDDSPRHAKEDALIRKP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AGSR G+H   ND+MMDDLDEMIFGKK GG+SE GHD KKQQPPKDDLISF
Sbjct  345  AGSRGGSHGSSNDDMMDDLDEMIFGKKGGGTSEGGHDSKKQQPPKDDLISF  395



>ref|XP_008376923.1| PREDICTED: TOM1-like protein 2 isoform X2 [Malus domestica]
Length=396

 Score =   226 bits (577),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 147/172 (85%), Gaps = 1/172 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELL TV SSSPQQDAL+DDLT TLVQQCRQS +TVQRIIETAG+NE
Sbjct  225  EQTKEAFDVARNSIELLNTVFSSSPQQDALQDDLTATLVQQCRQSLSTVQRIIETAGENE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI KALSKYEE+I+P+VVP+APEPAMIPVAVEPDES    KED LIRKP
Sbjct  285  ALLFEALNVNDEIHKALSKYEELIRPSVVPTAPEPAMIPVAVEPDESPSHVKEDYLIRKP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQ-PPKDDLISF  217
            A SR   H G ND+MMDDLDEMIFGKK G  SE   D KKQQ P KDDLISF
Sbjct  345  AASRGLVHAGSNDDMMDDLDEMIFGKKGGSPSEGSQDPKKQQTPAKDDLISF  396



>ref|NP_001239879.1| uncharacterized protein LOC100793134 [Glycine max]
 gb|ACU21048.1| unknown [Glycine max]
 gb|KHN34144.1| TOM1-like protein 2 [Glycine soja]
Length=405

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEA DVARNS+ELL+TVLSSSPQQDAL+DDLTTTLVQQCR+SQ TVQRI+ETAGDNE
Sbjct  235  EQTKEALDVARNSIELLSTVLSSSPQQDALQDDLTTTLVQQCRRSQTTVQRIVETAGDNE  294

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            A+LFEALNVNDEI K L+KYEE+ +PA  P  PEPAMIPVAVEPDES Y  KED+LIRKP
Sbjct  295  AVLFEALNVNDEIQKVLTKYEELKQPATTPLHPEPAMIPVAVEPDESPYHSKEDALIRKP  354

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AGSR G   G ND+MMDDLDEMIFGKK G +S+ GH+ KKQ   KDDLISF
Sbjct  355  AGSRTGVEGGSNDDMMDDLDEMIFGKKGGEASDGGHETKKQPSSKDDLISF  405



>ref|XP_009361159.1| PREDICTED: TOM1-like protein 2 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009361160.1| PREDICTED: TOM1-like protein 2 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009361161.1| PREDICTED: TOM1-like protein 2 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009361162.1| PREDICTED: TOM1-like protein 2 isoform X1 [Pyrus x bretschneideri]
Length=397

 Score =   224 bits (570),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 138/173 (80%), Positives = 148/173 (86%), Gaps = 2/173 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALE-DDLTTTLVQQCRQSQNTVQRIIETAGDN  553
            EQTKEAFDVARNS+ELL TV SSSPQQDAL+ DDLT TLVQQCRQS +TVQRIIETAG+N
Sbjct  225  EQTKEAFDVARNSIELLNTVFSSSPQQDALQQDDLTATLVQQCRQSLSTVQRIIETAGEN  284

Query  552  EALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRK  373
            EALLFEALNVNDEI KALSKYEE+I+P+VVP+APEPAMIPVAVEPDES    +ED LIRK
Sbjct  285  EALLFEALNVNDEIHKALSKYEELIRPSVVPTAPEPAMIPVAVEPDESPSRVREDYLIRK  344

Query  372  PAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQ-PPKDDLISF  217
            PA SR   H G ND+MMDDLDEMIFGKK G SSE   D KKQQ P KDDLISF
Sbjct  345  PAASRGLVHAGSNDDMMDDLDEMIFGKKGGSSSEGSQDPKKQQTPAKDDLISF  397



>gb|AGS41185.1| MYB transcription factor 9 [Tamarix hispida]
Length=392

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E TKEAFDVARNS+ELL+TVLSSSPQQD L+DDLTTTLV QCRQSQ+T+ RIIET+GDNE
Sbjct  222  EDTKEAFDVARNSIELLSTVLSSSPQQDVLKDDLTTTLVLQCRQSQSTILRIIETSGDNE  281

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI K LSKYEE+ KP+V    PEPAMIPV VEP+ES   G+ED+L+RK 
Sbjct  282  ALLFEALNVNDEIQKVLSKYEELKKPSVAQEEPEPAMIPVVVEPEESPRAGREDALVRKS  341

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AGSR  +H G ND+MMDDLDEMIFGKK GG+SE+GH+ KKQ  PKDDLISF
Sbjct  342  AGSRGTSHGGQNDDMMDDLDEMIFGKKTGGTSEAGHEPKKQPAPKDDLISF  392



>ref|XP_008376920.1| PREDICTED: TOM1-like protein 2 isoform X1 [Malus domestica]
 ref|XP_008376921.1| PREDICTED: TOM1-like protein 2 isoform X1 [Malus domestica]
 ref|XP_008376922.1| PREDICTED: TOM1-like protein 2 isoform X1 [Malus domestica]
Length=397

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 138/173 (80%), Positives = 147/173 (85%), Gaps = 2/173 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALE-DDLTTTLVQQCRQSQNTVQRIIETAGDN  553
            EQTKEAFDVARNS+ELL TV SSSPQQDAL+ DDLT TLVQQCRQS +TVQRIIETAG+N
Sbjct  225  EQTKEAFDVARNSIELLNTVFSSSPQQDALQQDDLTATLVQQCRQSLSTVQRIIETAGEN  284

Query  552  EALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRK  373
            EALLFEALNVNDEI KALSKYEE+I+P+VVP+APEPAMIPVAVEPDES    KED LIRK
Sbjct  285  EALLFEALNVNDEIHKALSKYEELIRPSVVPTAPEPAMIPVAVEPDESPSHVKEDYLIRK  344

Query  372  PAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQ-PPKDDLISF  217
            PA SR   H G ND+MMDDLDEMIFGKK G  SE   D KKQQ P KDDLISF
Sbjct  345  PAASRGLVHAGSNDDMMDDLDEMIFGKKGGSPSEGSQDPKKQQTPAKDDLISF  397



>ref|XP_011006026.1| PREDICTED: TOM1-like protein 2 [Populus euphratica]
 ref|XP_011006027.1| PREDICTED: TOM1-like protein 2 [Populus euphratica]
 ref|XP_011006029.1| PREDICTED: TOM1-like protein 2 [Populus euphratica]
Length=394

 Score =   221 bits (563),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 144/171 (84%), Gaps = 1/171 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELL TVLSSSPQQDAL+DDLTTTLV QCRQSQ TVQRIIETAGDNE
Sbjct  225  EQTKEAFDVARNSIELLATVLSSSPQQDALQDDLTTTLVHQCRQSQLTVQRIIETAGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI K LSKYEE+  P+VVP   EPAMIPVAVEPD   +  KED L+RKP
Sbjct  285  ALLFEALNVNDEIQKVLSKYEELKTPSVVPVKREPAMIPVAVEPDSPVH-AKEDVLVRKP  343

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            A SR G H G ND+MMDDLDEMIFGKK GG+S+  HD KKQQ  KDDLI+F
Sbjct  344  ARSRGGTHGGSNDDMMDDLDEMIFGKKGGGTSQVVHDPKKQQSSKDDLITF  394



>ref|XP_010919989.1| PREDICTED: TOM1-like protein 2 [Elaeis guineensis]
 ref|XP_010919990.1| PREDICTED: TOM1-like protein 2 [Elaeis guineensis]
 ref|XP_010919991.1| PREDICTED: TOM1-like protein 2 [Elaeis guineensis]
Length=387

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 145/171 (85%), Gaps = 3/171 (2%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELL+TVLSSSPQQ+AL+DDL TTL+QQCRQ QNT+QRIIETAGDNE
Sbjct  220  EQTKEAFDVARNSIELLSTVLSSSPQQEALKDDLATTLLQQCRQCQNTIQRIIETAGDNE  279

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDE+ K +SKYEE+ KP VV S PEPAMIPVAVEP+ES  V KED+LIRKP
Sbjct  280  ALLFEALNVNDELQKVISKYEELRKPPVVHSEPEPAMIPVAVEPEESPRVSKEDALIRKP  339

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            A SR  A +G +D+++ DLDEMIFG K G +SE    +KKQ+  KDDLI+F
Sbjct  340  ASSR--ARSGGDDDILHDLDEMIFG-KGGSTSEDQDPKKKQEQQKDDLITF  387



>ref|XP_007218111.1| hypothetical protein PRUPE_ppa006768mg [Prunus persica]
 gb|EMJ19310.1| hypothetical protein PRUPE_ppa006768mg [Prunus persica]
Length=396

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 145/172 (84%), Gaps = 1/172 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELL+TV SSS QQDAL+DDLT TLVQQCRQSQ+ VQRIIETAG+NE
Sbjct  225  EQTKEAFDVARNSIELLSTVFSSSTQQDALQDDLTATLVQQCRQSQSAVQRIIETAGENE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI K LSKYEE++KP VVP+ PEPAMIPVAVE DES    KEDSLIRKP
Sbjct  285  ALLFEALNVNDEIHKVLSKYEELMKPLVVPTEPEPAMIPVAVEADESPSHAKEDSLIRKP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQP-PKDDLISF  217
            A SR   H G +D+MMDDLDEMIFGKK G SSE   D KKQQP  KDDLISF
Sbjct  345  AASRGLVHAGSHDDMMDDLDEMIFGKKGGSSSEGNQDPKKQQPAAKDDLISF  396



>gb|KJB18441.1| hypothetical protein B456_003G052900 [Gossypium raimondii]
Length=364

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS++LL+TVLSSSPQ+DAL+DDLTTTLVQQCRQSQ+TV RIIETAG+NE
Sbjct  194  EQTKEAFDVARNSIQLLSTVLSSSPQRDALKDDLTTTLVQQCRQSQSTVLRIIETAGNNE  253

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVND++ KALS YEE+ KP+VVP  PEP MIPVAVEPD+S    K D+LIRKP
Sbjct  254  ALLFEALNVNDDLQKALSMYEELRKPSVVPHEPEPTMIPVAVEPDDSPLNTKHDALIRKP  313

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AG+R G+H G +D+MMDDLDEMIFGKK G SSE G D K QQ P DDLI+ 
Sbjct  314  AGTRHGSHGGSSDDMMDDLDEMIFGKKGGDSSEGGQDSKNQQAPIDDLITL  364



>gb|KJB18439.1| hypothetical protein B456_003G052900 [Gossypium raimondii]
 gb|KJB18440.1| hypothetical protein B456_003G052900 [Gossypium raimondii]
 gb|KJB18442.1| hypothetical protein B456_003G052900 [Gossypium raimondii]
Length=401

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS++LL+TVLSSSPQ+DAL+DDLTTTLVQQCRQSQ+TV RIIETAG+NE
Sbjct  231  EQTKEAFDVARNSIQLLSTVLSSSPQRDALKDDLTTTLVQQCRQSQSTVLRIIETAGNNE  290

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVND++ KALS YEE+ KP+VVP  PEP MIPVAVEPD+S    K D+LIRKP
Sbjct  291  ALLFEALNVNDDLQKALSMYEELRKPSVVPHEPEPTMIPVAVEPDDSPLNTKHDALIRKP  350

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AG+R G+H G +D+MMDDLDEMIFGKK G SSE G D K QQ P DDLI+ 
Sbjct  351  AGTRHGSHGGSSDDMMDDLDEMIFGKKGGDSSEGGQDSKNQQAPIDDLITL  401



>gb|ABR28337.1| MYB transcription factor MYB49 [Medicago truncatula]
Length=399

 Score =   219 bits (557),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 147/174 (84%), Gaps = 4/174 (2%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFD+ARNS+ELL+TVLSSSPQQD L+DDLT TLVQQCR+SQ TVQRI+ETAGDNE
Sbjct  227  EQTKEAFDIARNSIELLSTVLSSSPQQDVLQDDLTATLVQQCRRSQITVQRIVETAGDNE  286

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYV---GKEDSLI  379
            A+LFEALNVNDEILK L+KYEE+  P V P  PEPAMIPVAVEPDES       KEDSLI
Sbjct  287  AILFEALNVNDEILKVLTKYEELKPPPVAPLQPEPAMIPVAVEPDESPRHLDDAKEDSLI  346

Query  378  RKPAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            RKPAGSRPG   G ND+MMDDLDEMIFG K GG+S+ GHD+KKQ   KDDLISF
Sbjct  347  RKPAGSRPGVQGGNNDDMMDDLDEMIFGSKVGGASDGGHDKKKQS-SKDDLISF  399



>gb|AFK35545.1| unknown [Medicago truncatula]
Length=399

 Score =   218 bits (555),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 146/174 (84%), Gaps = 4/174 (2%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFD+ARNS+ELL+TVLSSSPQQD L+DDLT TLVQQCR+SQ TVQRI+ETAGDNE
Sbjct  227  EQTKEAFDIARNSIELLSTVLSSSPQQDVLQDDLTATLVQQCRRSQITVQRIVETAGDNE  286

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYV---GKEDSLI  379
            A+LFEALNVNDEILK L+KYEE+  P V P  PEPAMIPVAVEPDES       KEDSLI
Sbjct  287  AILFEALNVNDEILKVLTKYEELKPPPVAPLQPEPAMIPVAVEPDESPRHLDDAKEDSLI  346

Query  378  RKPAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            RKPAGSRPG   G ND+MMDDLDEMIFG K GG+S+ GHD KKQ   KDDLISF
Sbjct  347  RKPAGSRPGVQGGNNDDMMDDLDEMIFGSKVGGASDGGHDTKKQS-SKDDLISF  399



>ref|XP_003610830.1| Hepatocyte growth factor-regulated tyrosine kinase substrate 
[Medicago truncatula]
 gb|AES93788.1| protein transporter [Medicago truncatula]
Length=399

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 146/174 (84%), Gaps = 4/174 (2%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFD+ARNS+ELL+TVLSSSPQQD L+DDLT TLVQQCR+SQ TVQRI+ETAGDNE
Sbjct  227  EQTKEAFDIARNSIELLSTVLSSSPQQDVLQDDLTATLVQQCRRSQITVQRIVETAGDNE  286

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYV---GKEDSLI  379
            A+LFEALNVNDEILK L+KYEE+  P V P  PEPAMIPVAVEPDES       KEDSLI
Sbjct  287  AILFEALNVNDEILKVLTKYEELKPPPVAPLQPEPAMIPVAVEPDESPRHLDDAKEDSLI  346

Query  378  RKPAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            RKPAGSRPG   G ND+MMDDLDEMIFG K GG+S+ GHD KKQ   KDDLISF
Sbjct  347  RKPAGSRPGVQGGNNDDMMDDLDEMIFGSKVGGASDGGHDTKKQS-SKDDLISF  399



>ref|XP_008234559.1| PREDICTED: target of Myb protein 1 [Prunus mume]
 ref|XP_008234560.1| PREDICTED: target of Myb protein 1 [Prunus mume]
 ref|XP_008234561.1| PREDICTED: target of Myb protein 1 [Prunus mume]
Length=396

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 144/172 (84%), Gaps = 1/172 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKE FDVARNS+ELL+TV SSS QQDAL+DDLT TLVQQCRQSQ+ VQRIIETAG+NE
Sbjct  225  EQTKEVFDVARNSIELLSTVFSSSTQQDALQDDLTATLVQQCRQSQSAVQRIIETAGENE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI K LSKYEE++KP VVP+ PEPAMIPVAVE DES   GKEDSLIRKP
Sbjct  285  ALLFEALNVNDEIHKVLSKYEELMKPLVVPTEPEPAMIPVAVEADESPSHGKEDSLIRKP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQP-PKDDLISF  217
            A SR   H G +D+MMDDLDEMIFGKK   SSE   D KKQQP  KDDLISF
Sbjct  345  AASRGLVHAGSHDDMMDDLDEMIFGKKGVSSSEGSQDPKKQQPAAKDDLISF  396



>ref|XP_010492622.1| PREDICTED: TOM1-like protein 2 [Camelina sativa]
Length=425

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 147/176 (84%), Gaps = 5/176 (3%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFD+ARNS+ELL+TVLSSSPQQDAL+DDLTTTLVQQCRQSQ TVQRIIETAG+NE
Sbjct  231  EQTKEAFDIARNSIELLSTVLSSSPQQDALQDDLTTTLVQQCRQSQTTVQRIIETAGENE  290

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDE++K LSKYE++ KP+   +A EPAMIPVA EPD+S   GKE+SL+RK 
Sbjct  291  ALLFEALNVNDELVKTLSKYEDMNKPSAPLTAHEPAMIPVAEEPDDSPVHGKEESLVRKS  350

Query  369  AGSRPGAH-NGPNDEMMDDLDEMIFGKKAGGSSESGHDQ--KKQQPP--KDDLISF  217
            +G R G H +G  D+M+DDLDEMIFGKK+GG S +  D+  KK+QP    DDLI F
Sbjct  351  SGVRGGFHGSGSGDDMIDDLDEMIFGKKSGGDSSTNADRDPKKEQPSSKNDDLIRF  406



>ref|XP_007157069.1| hypothetical protein PHAVU_002G040300g [Phaseolus vulgaris]
 gb|ESW29063.1| hypothetical protein PHAVU_002G040300g [Phaseolus vulgaris]
Length=403

 Score =   216 bits (549),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELL+TVLSSSPQQDAL+DDLT+TLV QCR SQ+TVQRI+ETAGDNE
Sbjct  233  EQTKEAFDVARNSIELLSTVLSSSPQQDALQDDLTSTLVHQCRLSQSTVQRIVETAGDNE  292

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI K L+KYEE+ +PA VP  PEPAMIPVAVEPDES    KED+LIRKP
Sbjct  293  ALLFEALNVNDEIQKVLTKYEELKQPAAVPLQPEPAMIPVAVEPDESPRHTKEDALIRKP  352

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            A SR     G +D+MMDDLDEMIFGKK G +S+ G D+KKQQ  KDDLISF
Sbjct  353  AASRTPPQGGSSDDMMDDLDEMIFGKKGGEASDGGQDKKKQQSSKDDLISF  403



>ref|XP_008813149.1| PREDICTED: TOM1-like protein 2 [Phoenix dactylifera]
 ref|XP_008813150.1| PREDICTED: TOM1-like protein 2 [Phoenix dactylifera]
Length=390

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 144/171 (84%), Gaps = 5/171 (3%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQ KEAFDVARNS+ELL+TVLSSSPQQDAL+DDLTTTLV+QCRQSQ T+Q+IIETAGDNE
Sbjct  225  EQIKEAFDVARNSIELLSTVLSSSPQQDALKDDLTTTLVRQCRQSQFTIQKIIETAGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ++LFEALNVND++ K LSKY+++  P VV S PEPAMIPVAVEP++S  + KE+ L+R+P
Sbjct  285  SILFEALNVNDDLQKGLSKYDDLKMPPVVQSEPEPAMIPVAVEPEDSPRLSKEEVLVRRP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AGSR     G +D MMDDLDEMIFGKK G SSE G D KKQQ  +DDLI+F
Sbjct  345  AGSRA---RGGDDNMMDDLDEMIFGKKGGDSSE-GQDPKKQQ-QRDDLITF  390



>gb|KJB82229.1| hypothetical protein B456_013G183000 [Gossypium raimondii]
 gb|KJB82230.1| hypothetical protein B456_013G183000 [Gossypium raimondii]
Length=401

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARN +ELL+TVLSSSPQQDALEDDLTTTLVQQCRQSQ+TV RIIETAGDNE
Sbjct  231  EQTKEAFDVARNCIELLSTVLSSSPQQDALEDDLTTTLVQQCRQSQSTVLRIIETAGDNE  290

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI KALSKYEE+ KP+VV   PEPAMIPVAVEPD+S     ED+LIRK 
Sbjct  291  ALLFEALNVNDEIQKALSKYEELKKPSVVRHEPEPAMIPVAVEPDDSPRHTNEDALIRKT  350

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            +G+R G H G ND+MMDDLDEMIFGKK GGSSE G D KKQQ PKDDLI+F
Sbjct  351  SGTRHGTHGGSNDDMMDDLDEMIFGKKGGGSSEGGQDSKKQQAPKDDLITF  401



>gb|KJB82228.1| hypothetical protein B456_013G183000 [Gossypium raimondii]
Length=416

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARN +ELL+TVLSSSPQQDALEDDLTTTLVQQCRQSQ+TV RIIETAGDNE
Sbjct  246  EQTKEAFDVARNCIELLSTVLSSSPQQDALEDDLTTTLVQQCRQSQSTVLRIIETAGDNE  305

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI KALSKYEE+ KP+VV   PEPAMIPVAVEPD+S     ED+LIRK 
Sbjct  306  ALLFEALNVNDEIQKALSKYEELKKPSVVRHEPEPAMIPVAVEPDDSPRHTNEDALIRKT  365

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            +G+R G H G ND+MMDDLDEMIFGKK GGSSE G D KKQQ PKDDLI+F
Sbjct  366  SGTRHGTHGGSNDDMMDDLDEMIFGKKGGGSSEGGQDSKKQQAPKDDLITF  416



>gb|KHG15259.1| TOM1-like protein 2 [Gossypium arboreum]
Length=401

 Score =   211 bits (536),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELL+TVLSSSPQQDALEDDLTTTLVQQCRQSQ+T+ RII+TAGDNE
Sbjct  231  EQTKEAFDVARNSIELLSTVLSSSPQQDALEDDLTTTLVQQCRQSQSTILRIIDTAGDNE  290

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI KALSKYEE+ +P+ V   PEPAMIPVAVEPD+S    KED+LIRKP
Sbjct  291  ALLFEALNVNDEIQKALSKYEELNEPSAVRREPEPAMIPVAVEPDDSPRHPKEDTLIRKP  350

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AG+R G H G ND+MMDDLDEMIFGKK GGSS  G D KKQQ PKDDLI+F
Sbjct  351  AGTRHGTHGGSNDDMMDDLDEMIFGKKGGGSSGGGQDSKKQQGPKDDLITF  401



>ref|XP_011007173.1| PREDICTED: TOM1-like protein 2 [Populus euphratica]
 ref|XP_011007174.1| PREDICTED: TOM1-like protein 2 [Populus euphratica]
Length=394

 Score =   210 bits (535),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELL TVLSSSPQQDAL+D L TTLVQQC QSQ TVQRIIETAGDNE
Sbjct  225  EQTKEAFDVARNSIELLMTVLSSSPQQDALQDGLATTLVQQCHQSQLTVQRIIETAGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFE LNVNDEI K LSKYEE+  P+VVP+ PEPA+IPVAVEPD S    KED+LIRKP
Sbjct  285  ALLFEGLNVNDEIQKVLSKYEELKTPSVVPAVPEPALIPVAVEPD-SPIHAKEDALIRKP  343

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AG + G H G +D+MMDDLDEMIFGKK G +SE   D KKQQ  KDDLISF
Sbjct  344  AGPQGGTHGGSSDDMMDDLDEMIFGKKGGSASEGPQDPKKQQFSKDDLISF  394



>gb|KJB26742.1| hypothetical protein B456_004G257100 [Gossypium raimondii]
 gb|KJB26743.1| hypothetical protein B456_004G257100 [Gossypium raimondii]
 gb|KJB26744.1| hypothetical protein B456_004G257100 [Gossypium raimondii]
Length=401

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELL+TVLSSSPQQDALEDDLTTTLVQQCRQSQ+T+ RII+TAGDNE
Sbjct  231  EQTKEAFDVARNSIELLSTVLSSSPQQDALEDDLTTTLVQQCRQSQSTILRIIDTAGDNE  290

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI KALSKYEE+ +P+ V   PEPAMIPVAVEPD+S    KED LIRKP
Sbjct  291  ALLFEALNVNDEIQKALSKYEELNEPSAVRREPEPAMIPVAVEPDDSPRHPKEDGLIRKP  350

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AG+R G H G ND+MMDDLDEMIFGKK GGSS  G D KKQQ PKDDLI+F
Sbjct  351  AGTRHGTHGGSNDDMMDDLDEMIFGKKGGGSSGGGQDSKKQQGPKDDLITF  401



>gb|KHF97708.1| TOM1-like protein 2 [Gossypium arboreum]
Length=401

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARN +ELL+TVLSSSPQQDALEDDLTTTLVQQCRQSQ+TV RIIETAGDNE
Sbjct  231  EQTKEAFDVARNCIELLSTVLSSSPQQDALEDDLTTTLVQQCRQSQSTVLRIIETAGDNE  290

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI KALSKYEE+ KP+VV   PEPAMIPVAVEPD+      ED+LIRK 
Sbjct  291  ALLFEALNVNDEIQKALSKYEELKKPSVVRHEPEPAMIPVAVEPDDPPRHTNEDALIRKT  350

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            +G+R G H G ND+MMDDLDEMIFGKK GGSSE G D KKQQ PKDDLI+F
Sbjct  351  SGTRHGTHGGSNDDMMDDLDEMIFGKKGGGSSEGGQDSKKQQAPKDDLITF  401



>ref|XP_010940789.1| PREDICTED: TOM1-like protein 2 [Elaeis guineensis]
Length=387

 Score =   207 bits (528),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 141/171 (82%), Gaps = 5/171 (3%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQ KEAFDVARNS+ELL+TVLSSSPQQDAL+DDLTTTLVQQCRQSQ T+Q+IIETAGD+E
Sbjct  222  EQIKEAFDVARNSIELLSTVLSSSPQQDALKDDLTTTLVQQCRQSQFTIQKIIETAGDSE  281

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            + LFEALNVNDE+ KAL+KY+++  P VV S PEPAMIPVAVEP++S  + KE+ L+R+ 
Sbjct  282  STLFEALNVNDELQKALTKYDDLRMPPVVQSEPEPAMIPVAVEPEDSPRLSKEEVLVRRS  341

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            A SR     G +D MMDDLDEMIFGKK G SSE    +KKQQ  KDDLI+F
Sbjct  342  AASR---AQGGDDNMMDDLDEMIFGKKGGDSSEGQDPKKKQQ--KDDLITF  387



>ref|XP_010558637.1| PREDICTED: TOM1-like protein 2 [Tarenaya hassleriana]
 ref|XP_010558638.1| PREDICTED: TOM1-like protein 2 [Tarenaya hassleriana]
Length=401

 Score =   205 bits (522),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 141/178 (79%), Gaps = 9/178 (5%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELL+TVLSSSPQ DAL+DDLT TLV QCR+SQ TVQRIIETAG+NE
Sbjct  226  EQTKEAFDVARNSIELLSTVLSSSPQLDALQDDLTITLVHQCRESQTTVQRIIETAGENE  285

Query  549  ALLFEALNVNDEILKALSKYEEIIK--PAVVPSAPEPAMIPVAVEPDESS--YVGKEDSL  382
            ALLFEALNVNDEI K ++KYEE+ K      P+APEPAMIPVAVEPD  S  +  +E SL
Sbjct  286  ALLFEALNVNDEIQKTMTKYEEMKKKPSGAAPTAPEPAMIPVAVEPDSDSPVHAKEEPSL  345

Query  381  IRKPAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHD-QKKQQPPK--DDLISF  217
            IRKP+GSR G H    D MMDDLDEMIFGK +G S  SGHD +KKQQ  K  DDLI F
Sbjct  346  IRKPSGSRGGTH-ADADGMMDDLDEMIFGKNSGVSG-SGHDPKKKQQSSKDDDDLIRF  401



>ref|XP_006854075.1| hypothetical protein AMTR_s00048p00118270 [Amborella trichopoda]
 gb|ERN15542.1| hypothetical protein AMTR_s00048p00118270 [Amborella trichopoda]
Length=400

 Score =   205 bits (521),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 141/171 (82%), Gaps = 5/171 (3%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELL+TVLSS PQQDALEDDL+TTLV+Q R+S++T+QRIIETAGDNE
Sbjct  235  EQTKEAFDVARNSIELLSTVLSSCPQQDALEDDLSTTLVEQLRRSRSTIQRIIETAGDNE  294

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALN+NDEI K  SKYE++ KP   P APEPAMIP+AVE ++S  V  ED L+RKP
Sbjct  295  ALLFEALNLNDEIQKVFSKYEDLYKPVSAPPAPEPAMIPIAVEAEDSPRVAHEDPLVRKP  354

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            A SR  + +G +D++M DLDEMIFGKK GGSS+ G D KK Q  KDDLI F
Sbjct  355  ANSR--SRSGEDDDIMHDLDEMIFGKK-GGSSD-GQDPKKNQ-NKDDLIRF  400



>ref|XP_010087473.1| TOM1-like protein 2 [Morus notabilis]
 gb|EXB29154.1| TOM1-like protein 2 [Morus notabilis]
Length=400

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 146/173 (84%), Gaps = 3/173 (2%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARN +ELL+TVLSSSPQQD LEDDL TTL+QQCRQSQ TVQRIIETAGDNE
Sbjct  229  EQTKEAFDVARNCIELLSTVLSSSPQQDVLEDDLATTLIQQCRQSQFTVQRIIETAGDNE  288

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI K LSKYEE +KP+VV + PEPAMIPVAVEP+ES    KED+LIRKP
Sbjct  289  ALLFEALNVNDEIQKVLSKYEE-LKPSVVSAEPEPAMIPVAVEPEESPRHPKEDTLIRKP  347

Query  369  AGSRPGAHNGPNDEMMDDLDEMIF--GKKAGGSSESGHDQKKQQPPKDDLISF  217
            A SR G+H G ND+MMDDLDEMIF      GG+SE G D KKQQP KDDLISF
Sbjct  348  ASSRVGSHGGSNDDMMDDLDEMIFGKKGGGGGTSEGGQDPKKQQPAKDDLISF  400



>gb|KDO47247.1| hypothetical protein CISIN_1g0161121mg, partial [Citrus sinensis]
Length=140

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  636  DDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEIIKPAVVPS  457
            DDLTTTLVQQCRQSQ TVQRIIETAGDNEALLFEALNVNDEI K L+KYEE+ KP+  P+
Sbjct  1    DDLTTTLVQQCRQSQFTVQRIIETAGDNEALLFEALNVNDEIQKVLTKYEELKKPSGAPA  60

Query  456  APEPAMIPVAVEPDESSYVGKEDSLIRKPAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGS  277
             PEPAMIPVAVEPD+S +  KED+L+RKPAGSR G+H   ND+MMDDLDEMIFGKK GG+
Sbjct  61   EPEPAMIPVAVEPDDSPHHAKEDALVRKPAGSRGGSHGSSNDDMMDDLDEMIFGKKGGGT  120

Query  276  SESGHDQKKQQPPKDDLISF  217
            SE GHD KKQQPPKDDLISF
Sbjct  121  SEGGHDSKKQQPPKDDLISF  140



>ref|XP_009388422.1| PREDICTED: TOM1-like protein 2 [Musa acuminata subsp. malaccensis]
Length=394

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 142/171 (83%), Gaps = 2/171 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQ KEAFDVARNS+ELL+TVLSSSP Q+AL+DDLT TL QQC+QSQ TVQRI+ETAGD+E
Sbjct  226  EQIKEAFDVARNSIELLSTVLSSSPHQEALQDDLTKTLFQQCQQSQYTVQRIVETAGDDE  285

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            A+LFEALNVNDE+ K LSKYEE+ KP VV S P PAMIPVAVEPDES    +ED+LIRKP
Sbjct  286  AVLFEALNVNDELQKVLSKYEELKKPPVVQSEPVPAMIPVAVEPDESPRASREDALIRKP  345

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AGSR    +G +D++++DLDEMIFGKK G +SE    +KKQQ  KDDLI+F
Sbjct  346  AGSR--TKSGGDDDILNDLDEMIFGKKGGSTSEDQDPKKKQQEKKDDLITF  394



>ref|XP_006371246.1| hypothetical protein POPTR_0019s07660g, partial [Populus trichocarpa]
 gb|ERP49043.1| hypothetical protein POPTR_0019s07660g, partial [Populus trichocarpa]
Length=153

 Score =   192 bits (489),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = -2

Query  639  EDDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEIIKPAVVP  460
            +DDLTTTLV QCRQSQ TVQRIIE AGDNEALLFEALNVNDEI K LSKYEE+  P+VVP
Sbjct  14   QDDLTTTLVHQCRQSQLTVQRIIEKAGDNEALLFEALNVNDEIQKVLSKYEELKAPSVVP  73

Query  459  SAPEPAMIPVAVEPDESSYVGKEDSLIRKPAGSRPGAHNGPNDEMMDDLDEMIFGKKAGG  280
              PEPAMIPVAVEPD S    KED+L+RKPAGSR G H G ND+MMDDLDEMIFGKK GG
Sbjct  74   VIPEPAMIPVAVEPD-SPVNAKEDALVRKPAGSRGGTHGGSNDDMMDDLDEMIFGKKGGG  132

Query  279  SSESGHDQKKQQPPKDDLISF  217
            +S+  HD KKQQ  KDDLI+F
Sbjct  133  TSQVVHDPKKQQSSKDDLITF  153



>ref|XP_010671112.1| PREDICTED: TOM1-like protein 2 [Beta vulgaris subsp. vulgaris]
Length=395

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 146/174 (84%), Gaps = 3/174 (2%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E +KEAF+VA+NS++LL+TVLSSSPQQD L+DDLTTTLVQQCRQSQ TVQRIIETAGD+E
Sbjct  222  EDSKEAFNVAKNSIDLLSTVLSSSPQQDVLQDDLTTTLVQQCRQSQFTVQRIIETAGDDE  281

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI K LSKYE++ + + VPS PE A IPVAVEP+ES   GKED+L+R+P
Sbjct  282  ALLFEALNVNDEIQKTLSKYEDMKETSTVPSVPEVATIPVAVEPEESPRAGKEDALVRRP  341

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSE---SGHDQKKQQPPKDDLISF  217
            AGSR  +H G +D+MMDDLDEMIFGKK+G S+    SG + KK +  KDDLISF
Sbjct  342  AGSRGNSHGGQHDDMMDDLDEMIFGKKSGTSTTSDVSGIEPKKPESAKDDLISF  395



>ref|XP_006387339.1| hypothetical protein POPTR_1218s00200g, partial [Populus trichocarpa]
 gb|ERP46253.1| hypothetical protein POPTR_1218s00200g, partial [Populus trichocarpa]
Length=139

 Score =   191 bits (485),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 116/140 (83%), Gaps = 1/140 (1%)
 Frame = -2

Query  636  DDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEIIKPAVVPS  457
            DDLTTTLV QCRQSQ TVQRIIE AGDNEALLFEALNVNDEI K LSKYEE+  P+VVP 
Sbjct  1    DDLTTTLVHQCRQSQLTVQRIIEKAGDNEALLFEALNVNDEIQKVLSKYEELKAPSVVPV  60

Query  456  APEPAMIPVAVEPDESSYVGKEDSLIRKPAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGS  277
             PEPAMIPVAVEPD S    KED+L+RKPAGSR G H G ND+MMDDLDEMIFGKK GG+
Sbjct  61   IPEPAMIPVAVEPD-SPVNAKEDALVRKPAGSRGGTHGGSNDDMMDDLDEMIFGKKGGGT  119

Query  276  SESGHDQKKQQPPKDDLISF  217
            S+  HD KKQQ  KDDLI+F
Sbjct  120  SQVVHDPKKQQSSKDDLITF  139



>ref|XP_010420395.1| PREDICTED: TOM1-like protein 2 [Camelina sativa]
 ref|XP_010420396.1| PREDICTED: TOM1-like protein 2 [Camelina sativa]
Length=406

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 147/176 (84%), Gaps = 5/176 (3%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFD+ARNS+ELL+TVLSSSPQQDAL+DDLTTTLVQQCRQSQ TVQRIIETAG+NE
Sbjct  231  EQTKEAFDIARNSIELLSTVLSSSPQQDALQDDLTTTLVQQCRQSQTTVQRIIETAGENE  290

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDE++K LSKYEE+ KP+   +A EPAMIPVA EPD+S   GKE+SL+RK 
Sbjct  291  ALLFEALNVNDELVKTLSKYEEMNKPSAPLTAHEPAMIPVAEEPDDSPVYGKEESLVRKS  350

Query  369  AGSRPGAH-NGPNDEMMDDLDEMIFGKKAGGSSESGHDQ--KKQQPP--KDDLISF  217
            +G R G H +G  D+MMDDLDEMIFGKK+GG S +  D+  KK+QP    DDLI F
Sbjct  351  SGVRGGFHGSGSGDDMMDDLDEMIFGKKSGGDSSTNADRDPKKEQPSSKNDDLIRF  406



>ref|XP_004144724.1| PREDICTED: TOM1-like protein 2-like [Cucumis sativus]
 gb|KGN61050.1| hypothetical protein Csa_2G035500 [Cucumis sativus]
Length=396

 Score =   195 bits (496),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 138/172 (80%), Gaps = 1/172 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFDVARN +ELL+TVLSSSP QD  EDDLT+TLV QCRQSQ T+QRIIETAGDNE
Sbjct  225  EETKEAFDVARNCIELLSTVLSSSPPQDNSEDDLTSTLVLQCRQSQLTIQRIIETAGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDE+ K L+KY+E+ KP  V   PEPAMIPVAVEPDES    KEDSL+RKP
Sbjct  285  ALLFEALNVNDEVQKVLTKYQELKKPPTVQREPEPAMIPVAVEPDESPRHAKEDSLVRKP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKD-DLISF  217
            A SR  +  G +D+MMDDLDEMIFGKK G  S+ GHD KK    KD DLISF
Sbjct  345  ATSRGRSLGGSSDDMMDDLDEMIFGKKGGSGSDRGHDPKKPDSSKDKDLISF  396



>ref|XP_004167394.1| PREDICTED: TOM1-like protein 2-like [Cucumis sativus]
Length=396

 Score =   195 bits (496),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 138/172 (80%), Gaps = 1/172 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFDVARN +ELL+TVLSSSP QD  EDDLT+TLV QCRQSQ T+QRIIETAGDNE
Sbjct  225  EETKEAFDVARNCIELLSTVLSSSPPQDNSEDDLTSTLVLQCRQSQLTIQRIIETAGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDE+ K L+KY+E+ KP  V   PEPAMIPVAVEPDES    KEDSL+RKP
Sbjct  285  ALLFEALNVNDEVQKVLTKYQELKKPPTVQREPEPAMIPVAVEPDESPRHAKEDSLVRKP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKD-DLISF  217
            A SR  +  G +D+MMDDLDEMIFGKK G  S+ GHD KK    KD DLISF
Sbjct  345  ATSRGRSLGGSSDDMMDDLDEMIFGKKGGSGSDRGHDPKKPDSSKDKDLISF  396



>ref|NP_001047818.1| Os02g0697300 [Oryza sativa Japonica Group]
 dbj|BAD07858.1| putative target of myb1 [Oryza sativa Japonica Group]
 dbj|BAD08174.1| putative target of myb1 [Oryza sativa Japonica Group]
 emb|CAD44613.1| TOM1 protein [Oryza sativa Japonica Group]
 dbj|BAF09732.1| Os02g0697300 [Oryza sativa Japonica Group]
 gb|ACF60469.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAG89776.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73834.1| hypothetical protein OsI_08568 [Oryza sativa Indica Group]
 gb|EEE57625.1| hypothetical protein OsJ_08026 [Oryza sativa Japonica Group]
Length=392

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 146/172 (85%), Gaps = 5/172 (3%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFDVARNS+ELL+TVLSSSPQQDAL+DDLT+TLVQQC QSQ+T+QR+IETAGDNE
Sbjct  225  EETKEAFDVARNSIELLSTVLSSSPQQDALQDDLTSTLVQQCYQSQHTIQRMIETAGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPE-PAMIPVAVEPDESSYVGKEDSLIRK  373
            A+LFEAL+VNDEI K LSKYE++ KPA   +A + P +IP+A E ++S+ VG ED+L+RK
Sbjct  285  AMLFEALSVNDEIQKVLSKYEQMKKPAASENAEQRPVVIPIATEHEDSATVGNEDALVRK  344

Query  372  PAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            PAGSR  A +G +D+++DDLDEMIFGKK G SS+ G   KKQ P KDDLISF
Sbjct  345  PAGSR--ARSGGDDDILDDLDEMIFGKKGGSSSQEGP--KKQDPKKDDLISF  392



>ref|XP_006400231.1| hypothetical protein EUTSA_v10013718mg [Eutrema salsugineum]
 gb|ESQ41684.1| hypothetical protein EUTSA_v10013718mg [Eutrema salsugineum]
Length=402

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 145/174 (83%), Gaps = 5/174 (3%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFD+ARNS+ELL+TVLSSSPQ DAL+DDLTTTLVQQCRQSQ TVQRIIETAG++E
Sbjct  231  EETKEAFDIARNSIELLSTVLSSSPQHDALQDDLTTTLVQQCRQSQTTVQRIIETAGEDE  290

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDE++K LSKYEE+ KP+    APEPAMIPVA EPD+S   GKE+SL+RK 
Sbjct  291  ALLFEALNVNDELVKTLSKYEEMNKPSAPLPAPEPAMIPVAEEPDDSH--GKEESLVRKS  348

Query  369  AGSRPGAH-NGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPP--KDDLISF  217
            + +R G H  G  D+MMDDLDEMIFGKK+  S+++GHD KKQQ     DDLI F
Sbjct  349  SSNRAGIHGGGSGDDMMDDLDEMIFGKKSDSSTDAGHDPKKQQSSSKNDDLIRF  402



>ref|XP_003570152.1| PREDICTED: TOM1-like protein 2 [Brachypodium distachyon]
Length=391

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 143/171 (84%), Gaps = 4/171 (2%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFDVARNS+ELL+TVLSSSPQQDAL+DDLTTTLVQQC QSQ+T+QR +ETAGDNE
Sbjct  225  EETKEAFDVARNSMELLSTVLSSSPQQDALQDDLTTTLVQQCYQSQHTIQRFVETAGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            A+LFEAL+VNDEI K LSKYEE+ KP +   A +P +IP+A E ++S+ VG ED+L+RKP
Sbjct  285  AMLFEALSVNDEIQKVLSKYEEMKKPMISEHAEQPVVIPIATEHEDSATVGNEDALVRKP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            AGSR  A +G +D+++DDLDEMIFGKK G SS+     K+Q P KDDLI+F
Sbjct  345  AGSR--AMSGGDDDILDDLDEMIFGKKGGSSSQ--EVPKRQDPKKDDLINF  391



>gb|EMS45324.1| TOM1-like protein 2 [Triticum urartu]
Length=391

 Score =   192 bits (487),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 140/171 (82%), Gaps = 4/171 (2%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFDVARNS+ELL+TVLSSSPQQDAL+DDLTTTLVQQC QSQ+T+QR IETAGDNE
Sbjct  225  EETKEAFDVARNSMELLSTVLSSSPQQDALQDDLTTTLVQQCYQSQHTIQRFIETAGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEAL+VNDE+LK LSKYEE+ KP       +P +IP+A E ++S  VG ED+L+RKP
Sbjct  285  ALLFEALSVNDEVLKVLSKYEEMKKPMASARTEQPVVIPIATEHEDSVTVGNEDALVRKP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            A +R  A +G +D+++DDLDEMIFGKK G SS+     K+Q P KDDLI+F
Sbjct  345  AAAR--AMSGGDDDILDDLDEMIFGKKGGSSSQDV--SKRQDPKKDDLINF  391



>emb|CBI20131.3| unnamed protein product [Vitis vinifera]
Length=222

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKE FDVARNS+ELLTTVLSSSPQQDAL+DDLTTTLVQQC QSQ TVQRIIETAGD+E
Sbjct  95   EQTKETFDVARNSIELLTTVLSSSPQQDALKDDLTTTLVQQCHQSQFTVQRIIETAGDDE  154

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI K LSKYEE++KP+ VP  PEPAMIPVAVEP+ES    KEDSLIRKP
Sbjct  155  ALLFEALNVNDEIQKVLSKYEELMKPSEVPHEPEPAMIPVAVEPEESPRYAKEDSLIRKP  214

Query  369  AGSRPG  352
            AGSR G
Sbjct  215  AGSRGG  220



>ref|XP_003580255.1| PREDICTED: TOM1-like protein 2 [Brachypodium distachyon]
Length=392

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 143/172 (83%), Gaps = 5/172 (3%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFDVARNS+ELL+TVLSSSPQQDAL+DDLTTTLVQQC QSQ+T+QR +ETAGDNE
Sbjct  225  EETKEAFDVARNSIELLSTVLSSSPQQDALQDDLTTTLVQQCYQSQHTIQRFVETAGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAP-EPAMIPVAVEPDESSYVGKEDSLIRK  373
            A+LFEAL+VNDEI K LS+YEE+ KP    +A  EP +IP+A E ++S+ VG ED+L+RK
Sbjct  285  AMLFEALSVNDEIQKVLSRYEEMKKPLASANAEHEPVVIPIATEHEDSATVGSEDALVRK  344

Query  372  PAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            PAGSR  A  G +D+++DDLDEMIFGKK G SS+ G   +KQ P KDDLI+F
Sbjct  345  PAGSR--ARPGADDDILDDLDEMIFGKKGGSSSQEG--PQKQDPKKDDLINF  392



>ref|XP_006647730.1| PREDICTED: TOM1-like protein 2-like [Oryza brachyantha]
Length=392

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 143/172 (83%), Gaps = 5/172 (3%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFDVARNS+ELL+TVLSSSPQQDAL+DDLT TLVQQC QSQ+T+QR+IETAGDNE
Sbjct  225  EETKEAFDVARNSIELLSTVLSSSPQQDALQDDLTATLVQQCYQSQHTIQRMIETAGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPE-PAMIPVAVEPDESSYVGKEDSLIRK  373
            A+LFEAL+VNDEI K LSKYEE+ KP    +A + P +IP+A E ++S+ VG ED+L+RK
Sbjct  285  AMLFEALSVNDEIQKVLSKYEEMKKPEASENAEQRPVVIPIATEHEDSATVGNEDALVRK  344

Query  372  PAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            PAGSR  A +G +D+++DDLDEMIFGKK G SS+ G   KKQ   KDDLISF
Sbjct  345  PAGSR--ARSGGDDDILDDLDEMIFGKKGGSSSQEG--PKKQDAKKDDLISF  392



>ref|XP_010525051.1| PREDICTED: TOM1-like protein 2 [Tarenaya hassleriana]
Length=404

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 142/180 (79%), Gaps = 10/180 (6%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELL+TVLSSSPQ DAL+DDLT TLVQQC QSQ TVQRIIETAGDNE
Sbjct  226  EQTKEAFDVARNSIELLSTVLSSSPQHDALQDDLTMTLVQQCHQSQTTVQRIIETAGDNE  285

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDE+ K LSKYEE+ KP+   +APEPAMIPV VEPD S    KE+SL+RKP
Sbjct  286  ALLFEALNVNDELQKTLSKYEEMKKPSAPLTAPEPAMIPVVVEPD-SPIQAKEESLVRKP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKK--AGGS----SESGHDQKKQQPPK---DDLISF  217
            +GSR G      D+MMDDLDEMIFGKK  +GGS    +  G D+KKQQ  K   DDLI F
Sbjct  345  SGSRGGTRESNADDMMDDLDEMIFGKKGSSGGSPFDAASFGQDRKKQQSSKDHDDDLIRF  404



>emb|CDX70725.1| BnaC03g08090D [Brassica napus]
Length=405

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 142/173 (82%), Gaps = 2/173 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFD+ARNS+ELL+TVLSSSPQ DAL+DDLTTTLVQQCRQSQ TVQRIIETAG++E
Sbjct  233  EQTKEAFDIARNSIELLSTVLSSSPQHDALQDDLTTTLVQQCRQSQTTVQRIIETAGEDE  292

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDE++K LSKYEE+ +P+   +APEPAMIPV+ EPD+S   GKE+SL+RK 
Sbjct  293  ALLFEALNVNDELVKTLSKYEEMNRPSAPLTAPEPAMIPVSEEPDDSPLHGKEESLVRKS  352

Query  369  AGSRPGAH--NGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            + +R   H   G  D+MMDDLDEMIFGKK+GG  +S  D+++     DDLI F
Sbjct  353  SSTRASTHGGGGSGDDMMDDLDEMIFGKKSGGHGDSSTDKQQSSSKNDDLIRF  405



>ref|XP_008452808.1| PREDICTED: TOM1-like protein 2 [Cucumis melo]
 ref|XP_008452814.1| PREDICTED: TOM1-like protein 2 [Cucumis melo]
Length=396

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 138/172 (80%), Gaps = 1/172 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFDVARN +ELL+TVLSSSP QD  EDDLT+TLV QCRQSQ T+QRIIETAGDNE
Sbjct  225  EETKEAFDVARNCIELLSTVLSSSPPQDNSEDDLTSTLVLQCRQSQLTIQRIIETAGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
             LLFEALNVNDE+ K L+KY+++ KP  V   PEPAMIPVAVEPDES    KED+L+RKP
Sbjct  285  PLLFEALNVNDEVQKVLTKYQDLKKPPTVQREPEPAMIPVAVEPDESPRHAKEDALVRKP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKD-DLISF  217
            A SR  +  G +D+MMDDLDEMIFGKKAG  S+ GH+ KK    KD DLISF
Sbjct  345  ATSRGRSLGGSSDDMMDDLDEMIFGKKAGSGSDRGHNPKKPDSSKDNDLISF  396



>ref|XP_009131569.1| PREDICTED: TOM1-like protein 2 [Brassica rapa]
Length=406

 Score =   187 bits (475),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 143/174 (82%), Gaps = 3/174 (2%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFD+ARNS+ELL+TVLSSSPQQDAL+DDLTTTLVQQCRQSQ TVQRIIETAG++E
Sbjct  233  EQTKEAFDIARNSIELLSTVLSSSPQQDALQDDLTTTLVQQCRQSQTTVQRIIETAGEDE  292

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDE++K LSKYEE+ +P+   +APEPAMIPV+ EPD+S   GKE+SL+RK 
Sbjct  293  ALLFEALNVNDELVKTLSKYEEMNRPSAPLTAPEPAMIPVSEEPDDSPLHGKEESLVRKS  352

Query  369  AGSRPGAH--NGPNDEMMDDLDEMIFGKKAGG-SSESGHDQKKQQPPKDDLISF  217
            + +R   H   G  D+MMDDLDEMIFGKK+GG   +S  D+++     DDLI F
Sbjct  353  SSTRASIHGGGGSGDDMMDDLDEMIFGKKSGGHGGDSSTDKQQSSSKNDDLIRF  406



>emb|CDX78717.1| BnaA03g06290D [Brassica napus]
Length=406

 Score =   187 bits (475),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 143/174 (82%), Gaps = 3/174 (2%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFD+ARNS+ELL+TVLSSSPQQDAL+DDLTTTLVQQCRQSQ TVQRIIETAG++E
Sbjct  233  EQTKEAFDIARNSIELLSTVLSSSPQQDALQDDLTTTLVQQCRQSQTTVQRIIETAGEDE  292

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDE++K LSKYEE+ +P+   +APEPAMIPV+ EPD+S   GKE+SL+RK 
Sbjct  293  ALLFEALNVNDELVKTLSKYEEMNRPSAPLTAPEPAMIPVSEEPDDSPLHGKEESLVRKS  352

Query  369  AGSRPGAH--NGPNDEMMDDLDEMIFGKKAGG-SSESGHDQKKQQPPKDDLISF  217
            + +R   H   G  D+MMDDLDEMIFGKK+GG   +S  D+++     DDLI F
Sbjct  353  SSTRASIHGGGGSGDDMMDDLDEMIFGKKSGGHGGDSSTDKQQSSSKNDDLIRF  406



>ref|XP_007131520.1| hypothetical protein PHAVU_011G019800g [Phaseolus vulgaris]
 gb|ESW03514.1| hypothetical protein PHAVU_011G019800g [Phaseolus vulgaris]
Length=424

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 128/174 (74%), Gaps = 7/174 (4%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            +Q KEAFDVARNS ELL+TVLSSS QQD L+DDL TTLV+QCR+SQ TV RIIET+ DNE
Sbjct  255  QQAKEAFDVARNSFELLSTVLSSSMQQDVLKDDLITTLVKQCRESQATVHRIIETSWDNE  314

Query  549  ALLFEALNVNDEILKALSKYEEIIKPA---VVPSAPEPAMIPVAVEPDESSYVGKEDSLI  379
            ALL EALN+NDEI K +S+YEE+ K     VVP  PE  M P+A+E DES +  +E++L+
Sbjct  315  ALLCEALNINDEIQKVVSRYEEMKKKKKHRVVPPEPEVGMAPIAIEADESPHFKEEEALV  374

Query  378  RKPAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            RK  GSR G   G  DEM+DDLDEMIFGKK       G D KKQQ  +D LISF
Sbjct  375  RKSGGSRTGVQGGSQDEMLDDLDEMIFGKKV----RDGFDPKKQQSSEDHLISF  424



>ref|XP_009399424.1| PREDICTED: TOM1-like protein 2 [Musa acuminata subsp. malaccensis]
Length=394

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 139/171 (81%), Gaps = 2/171 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFDVARNS+ELL+T+LSSSP Q+AL+DDLTTTL QQC++SQ TVQRIIETAGDNE
Sbjct  226  EETKEAFDVARNSIELLSTILSSSPHQEALQDDLTTTLFQQCQRSQRTVQRIIETAGDNE  285

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            A+LFEALNVNDE+ K LSKYEE+ KP VV S PEPA+IPVAVEP+ES    +ED+LIRKP
Sbjct  286  AVLFEALNVNDELQKILSKYEELRKPPVVNSEPEPAVIPVAVEPEESPRATREDALIRKP  345

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
              S     +G +D ++DDLDEMIFGK  G +SE  + +K+ +  K +LI+F
Sbjct  346  PSSE--TRSGGDDGILDDLDEMIFGKIGGSTSEDQNPEKQHKQQKSNLITF  394



>emb|CDY16971.1| BnaC09g40980D [Brassica napus]
Length=409

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 145/179 (81%), Gaps = 8/179 (4%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFD+ARNS+ELL+TVLSSSPQ DAL+DDLTTTLVQQCRQSQ TVQRIIETAG++E
Sbjct  231  EETKEAFDIARNSIELLSTVLSSSPQHDALQDDLTTTLVQQCRQSQTTVQRIIETAGEDE  290

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDE++K LSKYEE+ KP+  P+APEPAMIPVA EPD++S  GKE+SL+RK 
Sbjct  291  ALLFEALNVNDELVKTLSKYEEMNKPSAPPTAPEPAMIPVAEEPDDASDHGKEESLVRKS  350

Query  369  A----GSRPGAHNGPNDEMMDDLDEMIFGKKAGG--SSESGHDQKKQQPP--KDDLISF  217
            +    GS  G      D+MMDDLDEMIFGKK+GG     S  D+KKQQ P   DDLI F
Sbjct  351  SIARAGSHGGGGGRSGDDMMDDLDEMIFGKKSGGDEGDSSTDDKKKQQSPCKSDDLIRF  409



>ref|XP_010549833.1| PREDICTED: TOM1-like protein 2 [Tarenaya hassleriana]
 ref|XP_010549834.1| PREDICTED: TOM1-like protein 2 [Tarenaya hassleriana]
Length=393

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 137/172 (80%), Gaps = 5/172 (3%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELL+TVLSSSPQQDAL+D LT TLVQQCR+S+ T+QRIIE AGDNE
Sbjct  226  EQTKEAFDVARNSIELLSTVLSSSPQQDALQDGLTMTLVQQCRRSRTTIQRIIEAAGDNE  285

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVP-SAPEPAMIPVAVEPDESSYVGKEDSLIRK  373
            ALLFEALN+NDE+ K LS YEE  K A  P +APEPAMIPVAVEP  S     ++S +RK
Sbjct  286  ALLFEALNMNDELQKTLSNYEETKKEASAPLTAPEPAMIPVAVEP-HSPVHAMDESFLRK  344

Query  372  PAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            P+GSR G+  G  D+MMDDLDEMIF KK+ G S SGHD+KKQ    DDLI F
Sbjct  345  PSGSRAGSRGGNADDMMDDLDEMIFDKKSSGGSPSGHDRKKQD---DDLIRF  393



>ref|XP_009121426.1| PREDICTED: TOM1-like protein 2 [Brassica rapa]
Length=409

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 144/179 (80%), Gaps = 8/179 (4%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFD+ARNS+ELL+TVLSSSPQ DAL+DDLTTTLVQQCRQSQ TVQRIIETAG++E
Sbjct  231  EETKEAFDIARNSIELLSTVLSSSPQHDALQDDLTTTLVQQCRQSQTTVQRIIETAGEDE  290

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDE++K LSKYEE+ KP+   + PEPAMIPVA EPD++S  GKE+SL+RK 
Sbjct  291  ALLFEALNVNDELVKTLSKYEEMNKPSAPLTTPEPAMIPVAEEPDDASDHGKEESLVRKS  350

Query  369  AGSR----PGAHNGPNDEMMDDLDEMIFGKKAG--GSSESGHDQKKQQPP--KDDLISF  217
            + +R     G   G  D+MMDDLDEMIFGKK+G  G S S  D KKQQ P   DDLI F
Sbjct  351  SIARGGSHGGGGGGSGDDMMDDLDEMIFGKKSGGDGDSSSTDDTKKQQSPSKSDDLIRF  409



>emb|CDX69412.1| BnaA10g17610D [Brassica napus]
Length=409

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 144/179 (80%), Gaps = 8/179 (4%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFD+ARNS+ELL+TVLSSSPQ DAL+DDLTTTLVQQCRQSQ TVQRIIETAG++E
Sbjct  231  EETKEAFDIARNSIELLSTVLSSSPQHDALQDDLTTTLVQQCRQSQTTVQRIIETAGEDE  290

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDE++K LSKYEE+ KP+   + PEPAMIPVA EPD++S  GKE+SL+RK 
Sbjct  291  ALLFEALNVNDELVKTLSKYEEMNKPSAPLTTPEPAMIPVAEEPDDASDHGKEESLVRKS  350

Query  369  AGSR----PGAHNGPNDEMMDDLDEMIFGKKAG--GSSESGHDQKKQQPP--KDDLISF  217
            + +R     G   G  D+MMDDLDEMIFGKK+G  G S S  D KKQQ P   DDLI F
Sbjct  351  SIARGGSHGGGGGGSGDDMMDDLDEMIFGKKSGGDGDSSSTDDTKKQQSPSKSDDLIRF  409



>gb|EMT04498.1| TOM1-like protein 2 [Aegilops tauschii]
Length=411

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 141/191 (74%), Gaps = 24/191 (13%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALE--------------------DDLTTTLVQ  610
            E+TKEAFDVARNS+ELL+TVLSSSPQQDAL+                    DDLTTTLVQ
Sbjct  225  EETKEAFDVARNSMELLSTVLSSSPQQDALQVFCSFYYNRCSFYSVVLMEWDDLTTTLVQ  284

Query  609  QCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPV  430
            QC QSQ+T+QR IETAGDNEALLFEAL+VNDE+LK LSKYEE+ KP     A +P +IP+
Sbjct  285  QCYQSQHTIQRFIETAGDNEALLFEALSVNDEVLKVLSKYEEMKKPMASARAEQPVVIPI  344

Query  429  AVEPDESSYVGKEDSLIRKPAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKK  250
            A E ++S  VG ED+L+RKPA +R  A +G +D+++DDLDEMIFGKK G SS+     K+
Sbjct  345  ATEHEDSVTVGNEDALVRKPAAAR--AMSGGDDDILDDLDEMIFGKKGGSSSQDV--SKR  400

Query  249  QQPPKDDLISF  217
            Q P KDDLI+F
Sbjct  401  QDPKKDDLINF  411



>ref|XP_010453865.1| PREDICTED: TOM1-like protein 2 [Camelina sativa]
Length=406

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 141/176 (80%), Gaps = 5/176 (3%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFD+ARNS+ELL+TVLSSSPQQDAL+DDLTTTLVQQCRQSQ TVQRIIETAG+NE
Sbjct  231  EQTKEAFDIARNSIELLSTVLSSSPQQDALQDDLTTTLVQQCRQSQTTVQRIIETAGENE  290

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDE++K LSKYE++ KP+   +A EPAMIPVA EPD+S   GKE+SL+RK 
Sbjct  291  ALLFEALNVNDELVKTLSKYEDMNKPSAPLTAHEPAMIPVAEEPDDSPVHGKEESLVRKS  350

Query  369  A-GSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQ--KKQQPP--KDDLISF  217
            +         G  D+MMDDLDEMIFGKK+GG S +  D+   K+QP    DDLI F
Sbjct  351  SGVRGGFHGGGSGDDMMDDLDEMIFGKKSGGDSSTNADRDPNKEQPSSKNDDLIRF  406



>ref|XP_002882268.1| VHS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58527.1| VHS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=416

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 138/185 (75%), Gaps = 14/185 (8%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFDVARNS+ELLTTVLSSSP QD L DDLT TLVQQCRQSQ TVQRIIET G++E
Sbjct  232  EETKEAFDVARNSIELLTTVLSSSPHQDVLHDDLTRTLVQQCRQSQTTVQRIIETCGEDE  291

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESS-YVGKEDSLIRK  373
            ALLFEALNVNDE++K LSKYEE+ KP+    APEPAMIPVA E D+S  Y  +E+SL+RK
Sbjct  292  ALLFEALNVNDELVKTLSKYEELKKPSAPLVAPEPAMIPVATESDDSHIYAKEEESLVRK  351

Query  372  PAGSRPGAHNG-----PNDEMMDDLDEMIFGKKAGG-------SSESGHDQKKQQPPK-D  232
             +GS  G          +D MMDDLDEMIFGKK  G       ++ SG+D KKQQ  K +
Sbjct  352  YSGSAQGGTTHGSGSSSDDMMMDDLDEMIFGKKGLGHSSSSDATTASGNDPKKQQSSKNN  411

Query  231  DLISF  217
            DLI F
Sbjct  412  DLIRF  416



>ref|XP_002871740.1| VHS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47999.1| VHS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=406

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 140/176 (80%), Gaps = 5/176 (3%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFD+ARNS+ELL+TVLSSSPQ DAL+DDLTTTLVQQCRQSQ TVQRIIETAG+NE
Sbjct  231  EQTKEAFDIARNSIELLSTVLSSSPQHDALQDDLTTTLVQQCRQSQTTVQRIIETAGENE  290

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDE++K LSKYE++ KP+   +A EPAMIPVA EPD+S   GKE++L+RK 
Sbjct  291  ALLFEALNVNDELVKTLSKYEDMNKPSAPLTAHEPAMIPVAEEPDDSPVHGKEETLVRKS  350

Query  369  A-GSRPGAHNGPNDEMMDDLDEMIFGKKAGG--SSESGHDQKKQQPP--KDDLISF  217
            +         G  D+MMDDLDEMIFGKK+GG  S+ + HD KK Q     DDLI F
Sbjct  351  SGVRGGFHGGGSGDDMMDDLDEMIFGKKSGGDSSTNADHDLKKDQSSSKNDDLIRF  406



>dbj|BAJ86080.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=380

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 128/153 (84%), Gaps = 2/153 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFDVARNS+ELL+TVLSSSPQQDAL+DDLTTTLVQQC QSQ+T+QR IETAGDNE
Sbjct  225  EETKEAFDVARNSMELLSTVLSSSPQQDALQDDLTTTLVQQCYQSQHTIQRFIETAGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEAL+VNDE+ K LSKYEE+ KP       +P +IP+A E ++S  VG ED+L+RKP
Sbjct  285  ALLFEALSVNDEVQKVLSKYEEMKKPMASARTEQPVVIPIATEHEDSVTVGNEDALVRKP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSE  271
            A +R  A +G +D+++DDLDEMIFGKK G SS+
Sbjct  345  AAAR--AMSGGDDDILDDLDEMIFGKKGGSSSQ  375



>ref|XP_006287873.1| hypothetical protein CARUB_v10001100mg [Capsella rubella]
 gb|EOA20771.1| hypothetical protein CARUB_v10001100mg [Capsella rubella]
Length=406

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 141/176 (80%), Gaps = 5/176 (3%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFD+ARNS+ELL+TVLSSSPQQDAL+DDLTTTLVQQCRQSQ TVQRIIETAG++E
Sbjct  231  EQTKEAFDIARNSIELLSTVLSSSPQQDALQDDLTTTLVQQCRQSQTTVQRIIETAGEDE  290

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDE++K LSKYEE+ +P+   +A EPAMIPVA EPDES    KE+SL+RK 
Sbjct  291  ALLFEALNVNDELVKTLSKYEEMNRPSAPLTAHEPAMIPVAEEPDESPVHAKEESLVRKS  350

Query  369  A-GSRPGAHNGPNDEMMDDLDEMIFGKKAGG--SSESGHDQKKQQPP--KDDLISF  217
            +         G  D+MMDDLDEMIFGKK+GG  S+ + HD KK++     DDLI F
Sbjct  351  SGVRGGFHGGGSGDDMMDDLDEMIFGKKSGGDSSTNADHDPKKEKSSSKNDDLIRF  406



>ref|XP_009384136.1| PREDICTED: TOM1-like protein 2 [Musa acuminata subsp. malaccensis]
 ref|XP_009384137.1| PREDICTED: TOM1-like protein 2 [Musa acuminata subsp. malaccensis]
 ref|XP_009384138.1| PREDICTED: TOM1-like protein 2 [Musa acuminata subsp. malaccensis]
Length=394

 Score =   176 bits (447),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 124/156 (79%), Gaps = 3/156 (2%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQ KEAFDVARNSVELL+TVLSSSP Q+ L+DDL+ TL QQCRQSQ T+Q IIE AGD+E
Sbjct  224  EQIKEAFDVARNSVELLSTVLSSSPHQEVLQDDLSNTLFQQCRQSQYTIQSIIEAAGDDE  283

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            A+LFEALNVNDE+ + LSKYEE+ KP  VPS P P  IPV VEP+ES   G+ED+LIRKP
Sbjct  284  AVLFEALNVNDELQRVLSKYEELKKPPEVPSEPAPNTIPVVVEPEESPRAGREDALIRKP  343

Query  369  AGSR--PGAHNGPNDEMMDDLDEMIFGKKAGGSSES  268
            AGSR  P  +    D++++DLD+MIFG + G +SE+
Sbjct  344  AGSRTKPDRYET-YDDILNDLDKMIFGTEKGSTSEN  378



>ref|XP_006297827.1| hypothetical protein CARUB_v10013862mg [Capsella rubella]
 gb|EOA30725.1| hypothetical protein CARUB_v10013862mg [Capsella rubella]
Length=402

 Score =   176 bits (447),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 134/178 (75%), Gaps = 14/178 (8%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFDVARN +ELLTTVLSSSP QD L DDLT TLVQQC QSQ TVQRIIET+G++E
Sbjct  232  EETKEAFDVARNIIELLTTVLSSSPHQDVLHDDLTITLVQQCSQSQTTVQRIIETSGEDE  291

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDE++K LSKYEE+ KP+   +APEPAMIPVA EPD+S    KE+      
Sbjct  292  ALLFEALNVNDELVKTLSKYEELKKPSAPLAAPEPAMIPVAAEPDDSHIHAKEE------  345

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSE------SGHDQKKQQPPK-DDLISF  217
             G+  G+ +  +D MMDDLDEMIFGKK  G S       SG+D KKQQP K DDLI F
Sbjct  346  -GTTHGSGSSSDDMMMDDLDEMIFGKKGLGHSSSDANTASGNDPKKQQPSKNDDLIRF  402



>ref|NP_001148639.1| protein transporter [Zea mays]
 gb|ACG32336.1| protein transporter [Zea mays]
Length=391

 Score =   176 bits (446),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 138/172 (80%), Gaps = 6/172 (3%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFDVARNSVELL+TVLSSSP+QDAL+DDLTTTLVQQC QSQ+T+Q IIET GDNE
Sbjct  225  EETKEAFDVARNSVELLSTVLSSSPEQDALQDDLTTTLVQQCYQSQHTIQMIIETVGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPE-PAMIPVAVEPDESSYVGKEDSLIRK  373
            A+LFEAL+VNDEI K LSKYEE+ +P     A   P +IP+A E ++ + VG ED+L+RK
Sbjct  285  AVLFEALSVNDEIQKLLSKYEEMKQPRASEHAEHVPVVIPIAAEHEDLNAVGNEDALVRK  344

Query  372  PAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            PA +R  A +G +D+++DDLDEMIFGKK G SS+   D KK  P KDDLISF
Sbjct  345  PAAAR--ATSGGDDDILDDLDEMIFGKKGGSSSQ---DPKKPNPKKDDLISF  391



>ref|NP_197190.1| Target of Myb protein 1 [Arabidopsis thaliana]
 ref|NP_850833.1| Target of Myb protein 1 [Arabidopsis thaliana]
 emb|CAC01701.1| TOM (target of myb1)-like protein [Arabidopsis thaliana]
 gb|AAL10477.1| AT5g16880/F2K13_30 [Arabidopsis thaliana]
 gb|AAL32718.1| TOM (target of myb1)-like protein [Arabidopsis thaliana]
 gb|AAM61693.1| TOM (target of myb1)-like protein [Arabidopsis thaliana]
 gb|AAO00913.1| TOM (target of myb1)-like protein [Arabidopsis thaliana]
 gb|AED92353.1| Target of Myb protein 1 [Arabidopsis thaliana]
 gb|AED92354.1| Target of Myb protein 1 [Arabidopsis thaliana]
Length=407

 Score =   174 bits (441),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 138/177 (78%), Gaps = 6/177 (3%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFD+ARNS+ELL+TVLSSSPQ DAL+DDLTTTLVQQCRQSQ TVQRIIETAG+NE
Sbjct  231  EQTKEAFDIARNSIELLSTVLSSSPQHDALQDDLTTTLVQQCRQSQTTVQRIIETAGENE  290

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDE++K LSKYEE+ KP+   ++ EPAMIPVA EPD+S   G+E+SL+RK 
Sbjct  291  ALLFEALNVNDELVKTLSKYEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVRKS  350

Query  369  A--GSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESG--HDQKKQQPP--KDDLISF  217
            +          G  D+MMDDLDEMIFGKK G  S +   HD KK+Q     DDLI F
Sbjct  351  SGVRGGFHGGGGSGDDMMDDLDEMIFGKKNGCDSSTNPDHDPKKEQSSSKNDDLIRF  407



>gb|ABK24381.1| unknown [Picea sitchensis]
Length=405

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 127/174 (73%), Gaps = 11/174 (6%)
 Frame = -2

Query  726  QTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEA  547
              KE FDVARNS+ELL+TVL+SSPQQDAL+D+LTTTLV+QCRQSQ TVQR++E AGDNEA
Sbjct  239  HVKEVFDVARNSIELLSTVLTSSPQQDALKDELTTTLVEQCRQSQYTVQRMVERAGDNEA  298

Query  546  LLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIR---  376
            LLFEALNVNDEI   LSK+EE+ K     S PEPAMIPV VE +ES     ED+L+R   
Sbjct  299  LLFEALNVNDEIQHILSKFEEMTKAPTSQSVPEPAMIPVRVEEEESPRAPPEDALVRNRT  358

Query  375  -KPAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
             KP  +R    +   ++ + DLDEMIFGKK G S E  H  KKQ+   DDLISF
Sbjct  359  TKPLNAR---SSTAEEDALADLDEMIFGKKGGTSEE--HGSKKQK--DDDLISF  405



>emb|CBI26517.3| unnamed protein product [Vitis vinifera]
Length=224

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS+ELLT+VLSSSPQQDAL+DDLTTTLVQQC QSQ TVQ IIETAGDNE
Sbjct  95   EQTKEAFDVARNSIELLTSVLSSSPQQDALKDDLTTTLVQQCHQSQFTVQSIIETAGDNE  154

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDEI K LS Y+E+ KP+VVP  PEPAMIPVA+EPDES    KEDSLIRKP
Sbjct  155  ALLFEALNVNDEIQKVLSNYDELKKPSVVPPEPEPAMIPVAIEPDESPRCAKEDSLIRKP  214

Query  369  AGSR  358
            AGSR
Sbjct  215  AGSR  218



>ref|XP_004953557.1| PREDICTED: TOM1-like protein 2-like isoform X1 [Setaria italica]
 ref|XP_004953558.1| PREDICTED: TOM1-like protein 2-like isoform X2 [Setaria italica]
 ref|XP_004953559.1| PREDICTED: TOM1-like protein 2-like isoform X3 [Setaria italica]
Length=391

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 131/154 (85%), Gaps = 3/154 (2%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFDVARNS+ELL+TVLSSSP+QDAL+DDLT+TLVQQC QSQ+T+QRIIET GDNE
Sbjct  224  EETKEAFDVARNSIELLSTVLSSSPEQDALQDDLTSTLVQQCHQSQHTIQRIIETVGDNE  283

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPE-PAMIPVAVEPDESSYVGKEDSLIRK  373
            A+LFEAL+VNDEI K LSKYEE+ +P    +A + P +IP+A E ++S+ VG ED+L+RK
Sbjct  284  AVLFEALSVNDEIQKVLSKYEEMKQPRASENAEQRPVVIPIATEHEDSAAVGNEDALVRK  343

Query  372  PAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSE  271
            PA +R  A +G +D+++DDLDEMIFGKK G SS+
Sbjct  344  PAAAR--ARSGGDDDILDDLDEMIFGKKGGSSSQ  375



>gb|EMS61071.1| TOM1-like protein 2 [Triticum urartu]
Length=400

 Score =   168 bits (426),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 137/178 (77%), Gaps = 10/178 (6%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFDVARNS+ELL+TVLSSSPQQDAL+DDLT TLVQQC QSQ+T+QR +ETAGDNE
Sbjct  226  EETKEAFDVARNSIELLSTVLSSSPQQDALQDDLTNTLVQQCYQSQHTIQRFVETAGDNE  285

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAP--EPAMIPVAVEP--DESSYVGKEDSL  382
            A+LFEAL VNDEI K LS+YEE+ KP V P+    EP  IP+A E   ++++ VG E++L
Sbjct  286  AMLFEALTVNDEIQKVLSRYEEMKKP-VAPAHAEQEPLAIPIAAEAEHEDATAVGSEEAL  344

Query  381  IRKPAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHD---QKKQQPPKDDLISF  217
            +RKPAG+R  A    +D M+DDLDEMIFGKK G SS S  D    +KQ   KDDLI+ 
Sbjct  345  VRKPAGAR--AKPDGDDGMLDDLDEMIFGKKGGDSSSSQEDADGAQKQDTKKDDLINL  400



>gb|EMT21212.1| TOM1-like protein 2 [Aegilops tauschii]
Length=399

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 134/178 (75%), Gaps = 10/178 (6%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFDVARNS+ELL+TV SS PQQDAL+DDLT TLVQQC QSQ+T+QR +ETAGDNE
Sbjct  225  EETKEAFDVARNSIELLSTVFSSFPQQDALQDDLTNTLVQQCYQSQHTIQRFVETAGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAP--EPAMIPVAVEP--DESSYVGKEDSL  382
            A+L EAL VNDEI K LS+YEE+ KP V P+    EP  IP+A E   ++++ VG E++L
Sbjct  285  AMLLEALTVNDEIQKVLSRYEEMKKP-VAPAHAEQEPLAIPIAAEAEHEDATAVGSEEAL  343

Query  381  IRKPAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHD---QKKQQPPKDDLISF  217
            +RKPAGSR  A    +D M+DDLDEMIFGKK G SS S  D    +KQ   KDDLI+ 
Sbjct  344  VRKPAGSR--AKPDGDDGMLDDLDEMIFGKKGGDSSSSQEDADGAQKQDMKKDDLINL  399



>ref|XP_008643658.1| PREDICTED: protein transporter isoform X1 [Zea mays]
 gb|ACF87126.1| unknown [Zea mays]
 gb|ACN35180.1| unknown [Zea mays]
 gb|AFW72916.1| putative VHS/GAT domain containing family protein isoform 1 [Zea 
mays]
 gb|AFW72917.1| putative VHS/GAT domain containing family protein isoform 2 [Zea 
mays]
 gb|AFW72918.1| putative VHS/GAT domain containing family protein isoform 3 [Zea 
mays]
Length=392

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 128/156 (82%), Gaps = 3/156 (2%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFDVARNSVELL+TVLSSSP+QDAL+DDLTTTLVQQC QSQ+T+Q IIET GDNE
Sbjct  225  EETKEAFDVARNSVELLSTVLSSSPEQDALQDDLTTTLVQQCYQSQHTIQMIIETVGDNE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPE-PAMIPVAVEPDESSYVGKEDSLIRK  373
            A+LFEAL+VNDEI K LSKYEE+ +P     A   P +IP+A E ++ + VG ED+L+RK
Sbjct  285  AVLFEALSVNDEIQKVLSKYEEMKQPRASEHAEHVPVVIPIAAEHEDLNAVGNEDALVRK  344

Query  372  PAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESG  265
            PA +R  A +G +D+++DDLDEMIFGKK G SS+ G
Sbjct  345  PAAAR--ATSGGDDDILDDLDEMIFGKKGGSSSQEG  378



>ref|XP_006408352.1| hypothetical protein EUTSA_v10020862mg [Eutrema salsugineum]
 gb|ESQ49805.1| hypothetical protein EUTSA_v10020862mg [Eutrema salsugineum]
Length=401

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 134/176 (76%), Gaps = 9/176 (5%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFDVARNS+ELL+TVLSSSP Q+AL D+LT TLVQQCR+S++TVQRIIE +G+NE
Sbjct  230  EETKEAFDVARNSIELLSTVLSSSPHQEALHDELTITLVQQCRRSKSTVQRIIEASGENE  289

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALLFEALNVNDE++K LSKYEE+ KP+   +APEPAMIPVA E     +   E+SL+R+ 
Sbjct  290  ALLFEALNVNDELVKTLSKYEELKKPSAPLAAPEPAMIPVAAE--SPIHAKGEESLVRRS  347

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSES----GHDQKKQQPPK-DDLISF  217
            +G      +  +D MMDDLDEMIFG K  G S S    G+D KKQQ  K DDLI F
Sbjct  348  SGG--AHGSSSDDMMMDDLDEMIFGNKGFGHSSSEAATGNDSKKQQSSKNDDLIRF  401



>gb|EPS72882.1| hypothetical protein M569_01871 [Genlisea aurea]
Length=392

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 130/182 (71%), Gaps = 27/182 (15%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQ KEAFDVARNSVELL TVLSSSP QDAL+D+LT+TL+QQCR+SQ T+  IIETAGDNE
Sbjct  227  EQKKEAFDVARNSVELLNTVLSSSPHQDALQDELTSTLLQQCRESQYTIHGIIETAGDNE  286

Query  549  ALLFEALNVNDEILKALSKYEEIIKP--AVVPSAPEPAMIPVAVEPDESSYVGKEDSLIR  376
            ALLFEALNVNDEI KALSKYEE+ +P  AV  + P+PAMIPV VE  E      EDSL+R
Sbjct  287  ALLFEALNVNDEIQKALSKYEELTRPTNAVSNAPPQPAMIPVGVESKE------EDSLVR  340

Query  375  KPAGSRPGAHNGPN-DEMM--DDLDEMIF------GKKAGGSSESGHDQKKQQPPKDDLI  223
            K       A+NG N +EMM  DDLDE+IF         +  +   G D KK+   KDDLI
Sbjct  341  K-------ANNGLNKEEMMMDDDLDELIFGKKSGSSSSSSNTQGQGVDTKKK---KDDLI  390

Query  222  SF  217
            SF
Sbjct  391  SF  392



>gb|AAL58181.1|AC027037_3 hepatocyte growth factor-regulated tyrosine kinase substrate-like 
protein [Oryza sativa Japonica Group]
 gb|AAP55166.1| VHS domain-containing protein, putative, expressed [Oryza sativa 
Japonica Group]
 emb|CAD44616.1| TOM2 protein [Oryza sativa Japonica Group]
 gb|ABB48032.2| VHS domain-containing protein, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ17090.1| hypothetical protein OsJ_32588 [Oryza sativa Japonica Group]
Length=387

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 128/170 (75%), Gaps = 14/170 (8%)
 Frame = -2

Query  726  QTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEA  547
            Q  EAF+VARNSVELL+TVLSSSPQ++AL+DDLTTTLVQQC+Q Q T+QRIIETAGDNEA
Sbjct  232  QVNEAFEVARNSVELLSTVLSSSPQKEALKDDLTTTLVQQCQQCQRTIQRIIETAGDNEA  291

Query  546  LLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKPA  367
             LFEAL+V+DE+ K LSKY+E+ +P V     EPAMIPV VEP+ S     +D  + K A
Sbjct  292  QLFEALSVHDELEKVLSKYKELKEPVVAEPEAEPAMIPVTVEPENSPRT--KDGTVGKRA  349

Query  366  GSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            GS  GA     DE++ DLD+MIFGKK G SS+   D+K+Q   KDD ISF
Sbjct  350  GS--GA-----DELLQDLDDMIFGKKGGTSSQ--QDRKEQ---KDDFISF  387



>ref|XP_008800065.1| PREDICTED: TOM1-like protein 2 [Phoenix dactylifera]
Length=392

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 130/156 (83%), Gaps = 5/156 (3%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVA NS+ELL+TVLSSSPQQ+AL+DDLTTTL+QQC+Q Q T+QRIIETAG+NE
Sbjct  225  EQTKEAFDVAHNSIELLSTVLSSSPQQEALKDDLTTTLLQQCQQCQYTIQRIIETAGENE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            ALL EALNVNDE+ K +SKYEE  KP V+ S PEPAMIPVAVEP+ES  V KED+LIRKP
Sbjct  285  ALLCEALNVNDELQKVVSKYEESRKPPVMQSEPEPAMIPVAVEPEESPRVRKEDALIRKP  344

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGH  262
            A SR  A +G  D+++ DLDEMIFGK   G S SG+
Sbjct  345  ASSR--ARSGGEDDILHDLDEMIFGK---GGSTSGN  375



>gb|ABR25582.1| protein transporter [Oryza sativa Indica Group]
Length=207

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 109/123 (89%), Gaps = 1/123 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFDVARNS+ELL+TVLSSSPQQDAL+DDLT+TLVQQC QSQ+T+QR+IETAGDNE
Sbjct  85   EETKEAFDVARNSIELLSTVLSSSPQQDALQDDLTSTLVQQCYQSQHTIQRMIETAGDNE  144

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPE-PAMIPVAVEPDESSYVGKEDSLIRK  373
            A+LFEAL+VNDEI K LSKYE++ KPA   +A + P +IP+A E ++S+ VG ED+L+RK
Sbjct  145  AMLFEALSVNDEIQKVLSKYEQMKKPAASENAEQRPVVIPIATEHEDSATVGNEDALVRK  204

Query  372  PAG  364
            PAG
Sbjct  205  PAG  207



>gb|EAY79641.1| hypothetical protein OsI_34785 [Oryza sativa Indica Group]
Length=387

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 127/170 (75%), Gaps = 14/170 (8%)
 Frame = -2

Query  726  QTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEA  547
            Q  EAF+VARNSVELL+TVLSSSPQ++AL+DDLTTTLVQQC+Q Q T+QRIIE AGDNEA
Sbjct  232  QVNEAFEVARNSVELLSTVLSSSPQKEALKDDLTTTLVQQCQQCQRTIQRIIEMAGDNEA  291

Query  546  LLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKPA  367
             LFEAL+V+DE+ K LSKY+E+ +P V     EPAMIPV VEP+ S     +D  + K A
Sbjct  292  QLFEALSVHDELEKVLSKYKELKEPVVAEPEAEPAMIPVTVEPENSPRT--KDGPVGKRA  349

Query  366  GSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            GS  GA     DE++ DLD+MIFGKK G SS+   D+K+Q   KDD ISF
Sbjct  350  GS--GA-----DELLQDLDDMIFGKKGGTSSQ--QDRKEQ---KDDFISF  387



>ref|XP_003607430.1| Class E vacuolar protein-sorting machinery protein HSE1 [Medicago 
truncatula]
 ref|XP_003607439.1| Class E vacuolar protein-sorting machinery protein HSE1 [Medicago 
truncatula]
 gb|AES89627.1| protein transporter [Medicago truncatula]
Length=414

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 124/162 (77%), Gaps = 3/162 (2%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS ELL++VLSSSPQQ+ L+ DLT TLVQQC QSQ+TV RII T G+NE
Sbjct  240  EQTKEAFDVARNSTELLSSVLSSSPQQNVLKQDLTITLVQQCHQSQSTVHRIIATVGENE  299

Query  549  ALLFEALNVNDEILKALSKYEEI-IKPAVVPSAPEP-AMIPVAVEPDESSYVGKEDSLIR  376
            ALL EALNVNDEI K LSKYEE+  KP   P  PE   MIPV +EPDES +  +E++LIR
Sbjct  300  ALLCEALNVNDEIHKVLSKYEELKKKPKASPLEPEQNMMIPVTIEPDESPHF-REEALIR  358

Query  375  KPAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKK  250
            KPA SR G     +D+MMDDLDEMIFGKK G +SE   D K+
Sbjct  359  KPACSRTGVQGLSHDDMMDDLDEMIFGKKGGDASEWRQDPKR  400



>gb|KEH30668.1| protein transporter [Medicago truncatula]
Length=441

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 124/162 (77%), Gaps = 3/162 (2%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFDVARNS ELL++VLSSSPQQ+ L+ DLT TLVQQC QSQ+TV RII T G+NE
Sbjct  267  EQTKEAFDVARNSTELLSSVLSSSPQQNVLKQDLTITLVQQCHQSQSTVHRIIATVGENE  326

Query  549  ALLFEALNVNDEILKALSKYEEI-IKPAVVPSAPEP-AMIPVAVEPDESSYVGKEDSLIR  376
            ALL EALNVNDEI K LSKYEE+  KP   P  PE   MIPV +EPDES +  +E++LIR
Sbjct  327  ALLCEALNVNDEIHKVLSKYEELKKKPKASPLEPEQNMMIPVTIEPDESPHF-REEALIR  385

Query  375  KPAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKK  250
            KPA SR G     +D+MMDDLDEMIFGKK G +SE   D K+
Sbjct  386  KPACSRTGVQGLSHDDMMDDLDEMIFGKKGGDASEWRQDPKR  427



>ref|NP_001132563.1| putative VHS/GAT domain containing family protein [Zea mays]
 ref|XP_008676614.1| PREDICTED: putative VHS/GAT domain containing family protein 
isoform X1 [Zea mays]
 gb|ACF81454.1| unknown [Zea mays]
 gb|ACG34295.1| protein transporter [Zea mays]
 gb|AFW63471.1| putative VHS/GAT domain containing family protein [Zea mays]
Length=391

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 125/156 (80%), Gaps = 3/156 (2%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFDVARNS+ELL+TVLSSSP+QDA +DDLT TLVQQC QSQ+T+QRIIET GDNE
Sbjct  224  EETKEAFDVARNSIELLSTVLSSSPEQDASQDDLTATLVQQCYQSQHTIQRIIETVGDNE  283

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPA-MIPVAVEPDESSYVGKEDSLIRK  373
            A+LFEAL+VNDEI K LSKYEE+ +P     A + A +IPVA E ++ +    ED+L+RK
Sbjct  284  AVLFEALSVNDEIQKVLSKYEEMKQPRASEHAEQRAVVIPVATEHEDLTAAVNEDALVRK  343

Query  372  PAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESG  265
            PA +R    +G +D+++DDLDEMIFGKK G SS+ G
Sbjct  344  PAAAR--TRSGGDDDILDDLDEMIFGKKGGSSSQEG  377



>gb|AFW63470.1| putative VHS/GAT domain containing family protein [Zea mays]
Length=399

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 125/156 (80%), Gaps = 3/156 (2%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+TKEAFDVARNS+ELL+TVLSSSP+QDA +DDLT TLVQQC QSQ+T+QRIIET GDNE
Sbjct  232  EETKEAFDVARNSIELLSTVLSSSPEQDASQDDLTATLVQQCYQSQHTIQRIIETVGDNE  291

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPA-MIPVAVEPDESSYVGKEDSLIRK  373
            A+LFEAL+VNDEI K LSKYEE+ +P     A + A +IPVA E ++ +    ED+L+RK
Sbjct  292  AVLFEALSVNDEIQKVLSKYEEMKQPRASEHAEQRAVVIPVATEHEDLTAAVNEDALVRK  351

Query  372  PAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESG  265
            PA +R    +G +D+++DDLDEMIFGKK G SS+ G
Sbjct  352  PAAAR--TRSGGDDDILDDLDEMIFGKKGGSSSQEG  385



>ref|XP_006592014.1| PREDICTED: TOM1-like protein 2-like [Glycine max]
Length=418

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 126/173 (73%), Gaps = 12/173 (7%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQ KE FDVARNS+ELL+TVLSS+ QQ+ L+D+LTTTLVQQCRQSQ +V RI+ETA DNE
Sbjct  256  EQIKETFDVARNSIELLSTVLSSTMQQNVLKDELTTTLVQQCRQSQTSVHRIVETAWDNE  315

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            A+L EALNVNDEI K  SKYEE+ K        EP ++P   EP     V KE++LIRKP
Sbjct  316  AVLVEALNVNDEIQKVFSKYEELKK-----EQKEPTVVPFEAEP----VVTKEEALIRKP  366

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESG--HDQKKQQPPKDDLISF  217
             GSR G H G +D+M+DDLDEMIFGKK    +  G  H +K+Q   KDDLISF
Sbjct  367  -GSRIGVHGGSHDDMLDDLDEMIFGKKGRDDAFEGGQHPKKQQSSSKDDLISF  418



>gb|KHN46460.1| TOM1-like protein 2 [Glycine soja]
Length=418

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 126/173 (73%), Gaps = 12/173 (7%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQ KE FDVARNS+ELL+TVLSS+ QQ+ L+D+LTTTLVQQCRQSQ +V RI+ETA DNE
Sbjct  256  EQIKETFDVARNSIELLSTVLSSTMQQNVLKDELTTTLVQQCRQSQTSVHRIVETAWDNE  315

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            A+L EALNVNDEI K  SKYEE+ K        EP ++P   EP     V KE++LIRKP
Sbjct  316  AVLVEALNVNDEIQKVFSKYEELKK-----EQKEPTVVPFEAEP----VVTKEEALIRKP  366

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESG--HDQKKQQPPKDDLISF  217
             GSR G H G +D+M+DDLDEMIFGKK    +  G  H +K+Q   KDDLISF
Sbjct  367  -GSRIGVHGGSHDDMLDDLDEMIFGKKGRDDAFEGGQHPKKQQSSSKDDLISF  418



>ref|XP_006662105.1| PREDICTED: TOM1-like protein 2-like [Oryza brachyantha]
Length=388

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 126/170 (74%), Gaps = 14/170 (8%)
 Frame = -2

Query  726  QTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEA  547
            Q  EAF+VARN+VELL+TVLSSSPQ++AL+DDLTTTLVQQCRQ + T+QRIIETAGDNE 
Sbjct  233  QVNEAFEVARNTVELLSTVLSSSPQKEALKDDLTTTLVQQCRQCKRTIQRIIETAGDNEV  292

Query  546  LLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKPA  367
             LFEAL+V+DE+ K L+KYEE+ +P V     EPAMIPV VEP+ S     +D  + KPA
Sbjct  293  QLFEALSVHDELEKVLTKYEELKEPVVAEPEAEPAMIPVTVEPENSPRT--KDGTVGKPA  350

Query  366  GSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            G   GA      +++ DLD+MIFGKK  GS+ S  D+K+Q   KDD I+F
Sbjct  351  GF--GAD-----DLLQDLDDMIFGKK--GSTSSPQDRKEQ---KDDFINF  388



>gb|EMS54006.1| TOM1-like protein 2 [Triticum urartu]
Length=397

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 128/170 (75%), Gaps = 4/170 (2%)
 Frame = -2

Query  726  QTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEA  547
            Q  EA +VARNSVELL+TVLSSSPQ++ALEDDLTTTLVQQC+Q Q T+QRI+ETAGDNEA
Sbjct  232  QVDEALEVARNSVELLSTVLSSSPQKEALEDDLTTTLVQQCQQCQYTIQRIVETAGDNEA  291

Query  546  LLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKPA  367
             LFEAL+++DE+ K LSKYE++ +P V    PEPAMIPV VEP+ES     +D+  RK A
Sbjct  292  QLFEALSIHDELQKVLSKYEDLKEPIVAEPEPEPAMIPVTVEPEESPRAVGKDTPSRKSA  351

Query  366  GSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            GS  G  +   D+++ DLD+MIFGKKAG +S+     +K+Q  KDD I  
Sbjct  352  GS--GGRSSGGDDLLQDLDDMIFGKKAGTASQQERTPRKEQ--KDDFIGL  397



>gb|ADE76488.1| unknown [Picea sitchensis]
Length=398

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 112/157 (71%), Gaps = 5/157 (3%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQ +E F VARNS+E+L+TVL+SSPQQ+AL+DDLTT LV+QCRQSQ TV++++E AGDNE
Sbjct  231  EQKQEVFAVARNSIEILSTVLTSSPQQEALKDDLTTMLVEQCRQSQFTVRKLVEGAGDNE  290

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSA--PEPAMIPVAVEPDESSYVGKEDSLIR  376
             LLFEALNVNDEI + LSKYEE++      SA   EPA IPV VE + S    KED+L+R
Sbjct  291  PLLFEALNVNDEIQRVLSKYEEMLTAPTSKSANISEPASIPVNVEEEASPSASKEDALVR  350

Query  375  KPAGS--RPGAHNGPNDEMMDDLDEMIFGKKAGGSSE  271
                   +P    G  D  + DLD+MIFGKK G S E
Sbjct  351  SRFSKSLKPHPRLG-EDAAILDLDDMIFGKKGGNSGE  386



>ref|XP_004983533.1| PREDICTED: TOM1-like protein 2-like [Setaria italica]
Length=396

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 125/171 (73%), Gaps = 7/171 (4%)
 Frame = -2

Query  726  QTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEA  547
            Q  EAF+VARNSVELL+TVLSSS Q++ L+DDLTTTLVQQC+Q Q+T+QRI+ETAGDNEA
Sbjct  232  QINEAFEVARNSVELLSTVLSSS-QKEVLQDDLTTTLVQQCQQCQHTIQRIVETAGDNEA  290

Query  546  LLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDES-SYVGKEDSLIRKP  370
             LFEAL++++E+ K L+KYEE+ +P  V   PEPAMIPV VEP+ES   V KED+ ++K 
Sbjct  291  QLFEALSIHEELQKVLAKYEELKEPVHVEPEPEPAMIPVTVEPEESPRAVSKEDAHVKKS  350

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
             GS   +      + +   D+MIFGKK G SS+     KK Q  KDD I+F
Sbjct  351  GGSGDRSGGDDLLQDL---DDMIFGKKGGTSSQRDTTPKKDQ--KDDFITF  396



>gb|EMT15900.1| TOM1-like protein 2 [Aegilops tauschii]
Length=434

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 129/207 (62%), Gaps = 41/207 (20%)
 Frame = -2

Query  726  QTKEAFDVARNsvellttvlssSPQQDALE------------------------------  637
            Q  EAF+VARNSVELL+TVLSSSPQ++ALE                              
Sbjct  232  QVDEAFEVARNSVELLSTVLSSSPQKEALEHFLHFNLNSKYCNNGPGQSTCYPLLPHHSL  291

Query  636  -------DDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEII  478
                   DDLTTTLVQQC+Q Q T+QRI+ETAGDNEA LFEAL+++DE+ K LSKYE++ 
Sbjct  292  GAEQYLKDDLTTTLVQQCQQCQYTIQRIVETAGDNEAQLFEALSIHDELQKVLSKYEDLK  351

Query  477  KPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKPAGSRPGAHNGPNDEMMDDLDEMIF  298
            +P V    PEPAMIPV VEP+ES     +D+  RK AGS  G  +   D+++ DLD+MIF
Sbjct  352  EPIVAEPEPEPAMIPVTVEPEESPRAVGKDTPARKSAGS--GGRSTGGDDLLQDLDDMIF  409

Query  297  GKKAGGSSESGHDQKKQQPPKDDLISF  217
            GKKAG SS+     +K++  KDD I  
Sbjct  410  GKKAGTSSQQERTPRKEK--KDDFIGL  434



>ref|XP_003574387.1| PREDICTED: TOM1-like protein 2 [Brachypodium distachyon]
 ref|XP_010235041.1| PREDICTED: TOM1-like protein 2 [Brachypodium distachyon]
Length=398

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 123/167 (74%), Gaps = 4/167 (2%)
 Frame = -2

Query  717  EAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALLF  538
            +AF+VARNSVELL+TVLSSSPQ +ALEDDLTTTLVQQC+Q Q T+QRI+ETAGD+E+ LF
Sbjct  236  DAFEVARNSVELLSTVLSSSPQNEALEDDLTTTLVQQCQQCQYTIQRIVETAGDDESQLF  295

Query  537  EALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKPAGSR  358
            EAL+++DE+ K LSKYE + +P V    PEPAMIPV VEP+ES     +D+  RK AGS 
Sbjct  296  EALSIHDELQKVLSKYEGLKEPVVAEPEPEPAMIPVTVEPEESPRAVSKDTPARKSAGS-  354

Query  357  PGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
                    D+++ DLD+MIFGKK G SS+     +K++  KDD I  
Sbjct  355  --GGRSSGDDLLQDLDDMIFGKKGGTSSQQDRTPRKEE-RKDDFIGL  398



>ref|XP_002975969.1| hypothetical protein SELMODRAFT_232686 [Selaginella moellendorffii]
 gb|EFJ22874.1| hypothetical protein SELMODRAFT_232686 [Selaginella moellendorffii]
Length=397

 Score =   136 bits (342),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 124/174 (71%), Gaps = 16/174 (9%)
 Frame = -2

Query  720  KEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALL  541
            KE FDVARNS+ELL+TVL+SSPQQ+ L+++LT  LV+QCRQSQ  +QRIIE  G+NEALL
Sbjct  234  KEVFDVARNSIELLSTVLTSSPQQEVLKEELTIALVEQCRQSQFNIQRIIERVGENEALL  293

Query  540  FEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYV------GKEDSLI  379
            FEALNVNDE+ KAL KYEE +  AV P  P P+ +P   + D+S++V        +D L+
Sbjct  294  FEALNVNDELQKALDKYEE-MSSAVAP-LPPPSELP---KSDDSAFVIVDEEPELDDPLV  348

Query  378  RKPAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            R  + S+ GA   P ++ + DLD+MIFG KA    E+ +D+KK+  P DDLI+F
Sbjct  349  RNKS-SKAGARPSPTEDPLADLDKMIFGNKA--EEEASNDKKKK--PADDLIAF  397



>ref|XP_002968515.1| hypothetical protein SELMODRAFT_89807 [Selaginella moellendorffii]
 gb|EFJ30769.1| hypothetical protein SELMODRAFT_89807 [Selaginella moellendorffii]
Length=397

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 125/174 (72%), Gaps = 16/174 (9%)
 Frame = -2

Query  720  KEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALL  541
            KE FDVARNS+ELL+TVL+SSPQQ+ L+++LT  LV+QCRQSQ  +QRIIE  G+NEALL
Sbjct  234  KEIFDVARNSIELLSTVLTSSPQQEVLKEELTIALVEQCRQSQFNIQRIIERVGENEALL  293

Query  540  FEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYV------GKEDSLI  379
            FEALNVNDE+ KAL KYEE +  AV P  P P+ +P   + D+S++V        +D L+
Sbjct  294  FEALNVNDELQKALDKYEE-MSSAVAP-LPPPSELP---KSDDSAFVIVDEEPELDDPLV  348

Query  378  RKPAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            R  + S+ GA   P+++ + DLD+MIFG KA    E+ +D+KK+  P DDLI+F
Sbjct  349  RNKS-SKAGARPSPSEDPLADLDKMIFGNKA--EEEASNDKKKK--PADDLIAF  397



>ref|XP_010034944.1| PREDICTED: TOM1-like protein 2 [Eucalyptus grandis]
Length=364

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 109/171 (64%), Gaps = 32/171 (19%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQ KEA +VARNS+ELL  VLSSSP+QD L+D+LTTTLV+QC ++Q+ VQRI ETAGD+E
Sbjct  226  EQIKEALEVARNSIELLAAVLSSSPKQDVLQDELTTTLVEQCHEAQHKVQRIAETAGDDE  285

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            A+LFEAL VND+  +  SKYEE+ +PA V  AP                      L R+P
Sbjct  286  AVLFEALKVNDDARRVFSKYEELREPATV--APT--------------------QLGREP  323

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
               R G   G +++M DDLDE+IFGKK GG SE         P +DDLIS 
Sbjct  324  LSYRRG-REGRHEDMTDDLDEIIFGKKGGGRSE---------PKQDDLISL  364



>gb|AFG59987.1| hypothetical protein 2_7619_01, partial [Pinus taeda]
Length=137

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 86/128 (67%), Gaps = 9/128 (7%)
 Frame = -2

Query  636  DDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEIIKPAVVPS  457
            DDLTTTLV+QCRQSQ TV++++E AGDNE LLFEALNVND+I + LSKYEE++K     S
Sbjct  1    DDLTTTLVEQCRQSQFTVRKLVEGAGDNEPLLFEALNVNDDIQRVLSKYEEMLKVPTSKS  60

Query  456  A--PEPAMIPVAVEPDESSYVGKEDSLIR----KPAGSRPGAHNGPNDEMMDDLDEMIFG  295
            A   EPA IPV VE + S    +ED+LIR    KP    P       D  + DLDEMIFG
Sbjct  61   ASVSEPASIPVNVEDEASPGAAQEDTLIRSRFSKPLKPHPRL---GEDVAISDLDEMIFG  117

Query  294  KKAGGSSE  271
            KK G S +
Sbjct  118  KKGGNSGQ  125



>gb|AFG59986.1| hypothetical protein 2_7619_01, partial [Pinus taeda]
 gb|AFG59989.1| hypothetical protein 2_7619_01, partial [Pinus taeda]
 gb|AFG59993.1| hypothetical protein 2_7619_01, partial [Pinus taeda]
Length=137

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 86/128 (67%), Gaps = 9/128 (7%)
 Frame = -2

Query  636  DDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEIIKPAVVPS  457
            DDLTTTLV+QCRQSQ TV++++E AGDNE LLFEALNVND+I + LSKYEE++K     S
Sbjct  1    DDLTTTLVEQCRQSQFTVRKLVEGAGDNEPLLFEALNVNDDIQRVLSKYEEMLKVPTSKS  60

Query  456  A--PEPAMIPVAVEPDESSYVGKEDSLIR----KPAGSRPGAHNGPNDEMMDDLDEMIFG  295
            A   EPA IPV VE + S    +ED+LIR    KP    P       D  + DLD+MIFG
Sbjct  61   ASVSEPASIPVNVEDEASPGAAQEDTLIRSRFSKPLKPHPRL---GEDVAISDLDDMIFG  117

Query  294  KKAGGSSE  271
            KK G S E
Sbjct  118  KKGGNSGE  125



>gb|AFG59980.1| hypothetical protein 2_7619_01, partial [Pinus taeda]
 gb|AFG59984.1| hypothetical protein 2_7619_01, partial [Pinus taeda]
Length=137

 Score =   123 bits (308),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 86/128 (67%), Gaps = 9/128 (7%)
 Frame = -2

Query  636  DDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEIIKPAVVPS  457
            DDLTTTLV+QCRQSQ TV++++E AGDNE LLFEALNVND+I + LSKYEE++K     S
Sbjct  1    DDLTTTLVEQCRQSQFTVRKLVEGAGDNEPLLFEALNVNDDIQRVLSKYEEMLKVPTFKS  60

Query  456  A--PEPAMIPVAVEPDESSYVGKEDSLIR----KPAGSRPGAHNGPNDEMMDDLDEMIFG  295
            A   EPA IPV VE + S    +ED+LIR    KP    P       D  + DLD+MIFG
Sbjct  61   ASVSEPASIPVNVEDEASPGAAQEDTLIRSRFSKPLKPHPRL---GEDVAISDLDDMIFG  117

Query  294  KKAGGSSE  271
            KK G S +
Sbjct  118  KKGGNSGQ  125



>gb|ACJ85033.1| unknown [Medicago truncatula]
Length=315

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQTKEAFD+ARNS+ELL+TVLSSSPQQD L+DDLT TLVQQCR+SQ TVQRI+ETAGDNE
Sbjct  227  EQTKEAFDIARNSIELLSTVLSSSPQQDVLQDDLTATLVQQCRRSQITVQRIVETAGDNE  286

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVV  463
            A+LFEALNVNDEILK L+KYEE+  P V+
Sbjct  287  AILFEALNVNDEILKVLTKYEELKPPPVL  315



>gb|AFG59978.1| hypothetical protein 2_7619_01, partial [Pinus taeda]
 gb|AFG59979.1| hypothetical protein 2_7619_01, partial [Pinus taeda]
 gb|AFG59981.1| hypothetical protein 2_7619_01, partial [Pinus taeda]
 gb|AFG59982.1| hypothetical protein 2_7619_01, partial [Pinus taeda]
 gb|AFG59983.1| hypothetical protein 2_7619_01, partial [Pinus taeda]
 gb|AFG59985.1| hypothetical protein 2_7619_01, partial [Pinus taeda]
 gb|AFG59988.1| hypothetical protein 2_7619_01, partial [Pinus taeda]
 gb|AFG59990.1| hypothetical protein 2_7619_01, partial [Pinus taeda]
Length=137

 Score =   122 bits (306),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 86/128 (67%), Gaps = 9/128 (7%)
 Frame = -2

Query  636  DDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEIIKPAVVPS  457
            DDLTTTLV+QCRQSQ TV++++E AGDNE LLFEALNVND+I + LSKYEE++K     S
Sbjct  1    DDLTTTLVEQCRQSQFTVRKLVEGAGDNEPLLFEALNVNDDIQRVLSKYEEMLKVPTSKS  60

Query  456  A--PEPAMIPVAVEPDESSYVGKEDSLIR----KPAGSRPGAHNGPNDEMMDDLDEMIFG  295
            A   EPA IPV VE + S    +ED+LIR    KP    P       D  + DLD+MIFG
Sbjct  61   ASVSEPASIPVNVEDEASPGAAQEDTLIRSRFSKPLKPHPRL---GEDVAISDLDDMIFG  117

Query  294  KKAGGSSE  271
            KK G S +
Sbjct  118  KKGGNSGQ  125



>ref|XP_001779411.1| predicted protein [Physcomitrella patens]
 gb|EDQ55801.1| predicted protein [Physcomitrella patens]
Length=376

 Score =   127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 116/178 (65%), Gaps = 13/178 (7%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E TKE FDVARNSVELL TVL+SSPQQ+AL+++LT TLV+QCR SQ  VQRI+E  GD +
Sbjct  205  EDTKEVFDVARNSVELLNTVLTSSPQQEALKEELTLTLVEQCRSSQFKVQRIVERTGDAD  264

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAP--EPAMIPV-AVEPDESSYVGKEDSLI  379
             +LFEALNVND++ + L+K+EE+ K     + P  E   + V A++ D++    +E SL+
Sbjct  265  PVLFEALNVNDDLQRVLTKFEEMSKGTAEQTQPAAESTFVHVQALDDDDTHGTAEEASLV  324

Query  378  R----KPAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
            R    KP+      H   +D  M DLDEMIFG +A      G +QK ++   DDLI F
Sbjct  325  RKRDLKPSAPPSSTH---DDAAMADLDEMIFGNRAAA---EGSNQKSKKQNADDLIMF  376



>gb|AFG59991.1| hypothetical protein 2_7619_01, partial [Pinus taeda]
 gb|AFG59992.1| hypothetical protein 2_7619_01, partial [Pinus taeda]
Length=137

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 86/128 (67%), Gaps = 9/128 (7%)
 Frame = -2

Query  636  DDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEIIKPAVVPS  457
            DDLTTTLV+QCRQSQ TV++++E AGDNE LLFEALNVND+I + LSKYEE++K     S
Sbjct  1    DDLTTTLVEQCRQSQFTVRKLVEGAGDNEPLLFEALNVNDDIQRVLSKYEEMLKVPTSKS  60

Query  456  A--PEPAMIPVAVEPDESSYVGKEDSLIR----KPAGSRPGAHNGPNDEMMDDLDEMIFG  295
            A   EPA IPV +E + S    +ED+LIR    KP    P       D  + DLD+MIFG
Sbjct  61   ASVSEPASIPVNMEDEASPGAAQEDTLIRSRFSKPLKPHPRL---GEDVAISDLDDMIFG  117

Query  294  KKAGGSSE  271
            KK G S +
Sbjct  118  KKGGNSGQ  125



>ref|XP_001757968.1| predicted protein [Physcomitrella patens]
 gb|EDQ77210.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 109/174 (63%), Gaps = 12/174 (7%)
 Frame = -2

Query  720  KEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALL  541
            KE FDVARNSVELL TVL+SSPQQ+ L+D+LT TLV+QCR  Q  VQRI+E   D + +L
Sbjct  235  KEVFDVARNSVELLNTVLTSSPQQEVLKDELTLTLVEQCRSCQIKVQRIVERTSDGDPVL  294

Query  540  FEALNVNDEILKALSKYEEIIK-PAVVPSAPEPAMIPV-AVEPDESSYVGKEDSLIR---  376
            FEALNV D++ + L+K+EE+ K  A  P   E   + V A++ D S    +E +L+R   
Sbjct  295  FEALNVYDDLQRVLTKFEEMSKGTAEQPQPAEATFVHVQALDDDYSCGTAEEATLVRKRD  354

Query  375  -KPAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
             KP+     AH   +D  M DLDEMIFG +   S   G  QK ++   DDLI F
Sbjct  355  SKPSIPLSSAH---DDTAMADLDEMIFGNR---SEAEGSRQKSKKQNADDLIMF  402



>gb|KCW46173.1| hypothetical protein EUGRSUZ_K00082 [Eucalyptus grandis]
Length=354

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 99/171 (58%), Gaps = 42/171 (25%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQ KEA +VARNS+ELL  VLSSSP+QD L          QC ++Q+ VQRI ETAGD+E
Sbjct  226  EQIKEALEVARNSIELLAAVLSSSPKQDVL----------QCHEAQHKVQRIAETAGDDE  275

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVGKEDSLIRKP  370
            A+LFEAL VND+  +  SKYEE+ +PA V  AP                      L R+P
Sbjct  276  AVLFEALKVNDDARRVFSKYEELREPATV--APT--------------------QLGREP  313

Query  369  AGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSESGHDQKKQQPPKDDLISF  217
               R G   G +++M DDLDE+IFGKK GG SE         P +DDLIS 
Sbjct  314  LSYRRG-REGRHEDMTDDLDEIIFGKKGGGRSE---------PKQDDLISL  354



>gb|AFK45485.1| unknown [Medicago truncatula]
Length=77

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 58/78 (74%), Gaps = 4/78 (5%)
 Frame = -2

Query  441  MIPVAVEPDESSYV---GKEDSLIRKPAGSRPGAHNGPNDEMMDDLDEMIFGKKAGGSSE  271
            MIPVAVEPDES       KEDSLIRKPAGSRPG   G ND+MMDD DEMIFG K GG+S+
Sbjct  1    MIPVAVEPDESPRHLDDAKEDSLIRKPAGSRPGVQGGNNDDMMDDFDEMIFGSKVGGASD  60

Query  270  SGHDQKKQQPPKDDLISF  217
             GHD KKQ   KDD ISF
Sbjct  61   GGHDTKKQF-FKDDFISF  77



>ref|NP_850834.1| Target of Myb protein 1 [Arabidopsis thaliana]
 gb|AED92352.1| Target of Myb protein 1 [Arabidopsis thaliana]
Length=297

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETA  562
            EQTKEAFD+ARNS+ELL+TVLSSSPQ DAL+DDLTTTLVQQCRQSQ TVQRIIETA
Sbjct  231  EQTKEAFDIARNSIELLSTVLSSSPQHDALQDDLTTTLVQQCRQSQTTVQRIIETA  286



>ref|XP_008805226.1| PREDICTED: TOM1-like protein 2 [Phoenix dactylifera]
 ref|XP_008805227.1| PREDICTED: TOM1-like protein 2 [Phoenix dactylifera]
 ref|XP_008805228.1| PREDICTED: TOM1-like protein 2 [Phoenix dactylifera]
Length=379

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+ K+   V RNS+E+L+++ +S  Q+ A +DDL  ++V +C++SQ  +QRIIE+ GD+E
Sbjct  232  EEKKQILVVTRNSIEILSSIFNSETQEKATKDDLMLSMVAKCKESQPVIQRIIESIGDDE  291

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVP  460
            ++LFEALNV+DE+ +ALSKYE+ +K AV P
Sbjct  292  SMLFEALNVHDELQQALSKYEQ-LKHAVPP  320



>ref|XP_006857283.1| hypothetical protein AMTR_s00067p00032430 [Amborella trichopoda]
 gb|ERN18750.1| hypothetical protein AMTR_s00067p00032430 [Amborella trichopoda]
Length=369

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 70/99 (71%), Gaps = 3/99 (3%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+ KE   VARNS+ELL+++ +S+ Q   + D+LT ++V++CRQS   +QRIIE++GD+E
Sbjct  227  EERKEILVVARNSIELLSSMSNSNSQNQLVMDELTLSIVEKCRQSMTQIQRIIESSGDDE  286

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAV---VPSAPEPA  442
              LFEALNV+DE+ + LS+Y    KP V    PSA EP 
Sbjct  287  GFLFEALNVHDELQQVLSRYSVADKPTVQREAPSANEPT  325



>ref|XP_010935906.1| PREDICTED: TOM1-like protein 2 [Elaeis guineensis]
Length=351

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+ KE   V RNS+E+L+++L+S  ++ A +DDL  ++V +C++SQ  +QRIIE+ GD+E
Sbjct  233  EEKKEILVVTRNSIEILSSILNSETKEKATKDDLMPSMVAKCKESQPVIQRIIESIGDDE  292

Query  549  ALLFEALNVNDEILKALSKYEEI  481
            ++LFEALNV+DE+ + LSKYE++
Sbjct  293  SMLFEALNVHDELQQVLSKYEQL  315



>ref|XP_007050288.1| ENTH/VHS/GAT family protein [Theobroma cacao]
 gb|EOX94445.1| ENTH/VHS/GAT family protein [Theobroma cacao]
Length=368

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 66/90 (73%), Gaps = 3/90 (3%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQ KE F+V RNS+E+L+++L +  +    +D+LT +++++C+QSQ  +Q IIE+  D+E
Sbjct  223  EQKKELFEVTRNSLEVLSSMLKTDTEPKPTKDELTESMLEKCKQSQPVIQMIIESTTDDE  282

Query  549  ALLFEALNVNDEILKALSKYEEI---IKPA  469
              LFEALN+NDE+ + +SK+EE+   +KP 
Sbjct  283  GTLFEALNLNDELQQVISKFEELEAGLKPG  312



>ref|XP_010679306.1| PREDICTED: TOM1-like protein 2 [Beta vulgaris subsp. vulgaris]
Length=424

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQ KE  ++ +NS+E+L+++LSS  +   +EDDLT +++ +C++SQ  +QRI+++  D+E
Sbjct  232  EQKKEFIEITKNSLEVLSSLLSSEAEPKIIEDDLTISMLDKCKESQPVLQRIVQSTNDDE  291

Query  549  ALLFEALNVNDEILKALSKYEEI  481
            +LLFEALN+NDE+ + +SK+EE+
Sbjct  292  SLLFEALNLNDELQQVISKFEEM  314



>gb|KHG16514.1| TOM1-like protein 2 [Gossypium arboreum]
Length=375

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 75/117 (64%), Gaps = 14/117 (12%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQ KE F+V RNS+E+L+++LS+  +    +D+LT +++++C+QSQ  +  IIE+  D++
Sbjct  223  EQKKELFEVTRNSLEVLSSILSTGTEPKPAKDELTESMLEKCKQSQLAIHMIIESTSDDD  282

Query  549  ALLFEALNVNDEILKALSKYE------EIIKPAVVPSAPEPAMIPVAVEPDESSYVG  397
             +LFEALN+NDE+ + +SK+E      +    A  P+AP        VE D+ S VG
Sbjct  283  GILFEALNLNDELQQVISKFEGLETGSKFDTAAANPAAP--------VETDKESTVG  331



>gb|EYU17922.1| hypothetical protein MIMGU_mgv1a008118mg [Erythranthe guttata]
Length=384

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+ KE   V RN++++L+++L+S  +   LED+LTT++V +C+QS   VQRIIET  D+E
Sbjct  232  EEKKEFLVVTRNTLDILSSILNSETEPKPLEDELTTSMVDKCKQSLPIVQRIIETTSDDE  291

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAV  466
            A+LF+ALN+++E+ + +SK+ E+   A+
Sbjct  292  AMLFDALNIHEELQQIISKHGELSAAAL  319



>gb|KDO60489.1| hypothetical protein CISIN_1g0411491mg, partial [Citrus sinensis]
Length=134

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = -2

Query  636  DDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEIIKPAVVPS  457
            +DLT +++++C++SQ  +QRIIE+  D+EA+LFEALN++DE+   +S+YEE ++ AV   
Sbjct  1    EDLTVSMLEKCKESQPVIQRIIESTTDDEAMLFEALNLHDELQLVISRYEE-LEAAVQSG  59

Query  456  APEP  445
             P P
Sbjct  60   EPAP  63



>ref|XP_006417945.1| hypothetical protein EUTSA_v10007923mg [Eutrema salsugineum]
 gb|ESQ36298.1| hypothetical protein EUTSA_v10007923mg [Eutrema salsugineum]
Length=381

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 67/92 (73%), Gaps = 3/92 (3%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            ++ KE  ++ RNS+ELL+++L++  + D  EDDLT +L+++C+QSQ  +Q IIE+  D+E
Sbjct  226  KEKKEQIEITRNSLELLSSMLNTEGKPDHTEDDLTVSLMEKCKQSQPLIQMIIESTTDDE  285

Query  549  ALLFEALNVNDEILKALSKYE---EIIKPAVV  463
             +LFEAL+VNDE+ + LS Y+   E +K A +
Sbjct  286  GVLFEALHVNDELQRVLSIYKKPGETVKNASI  317



>gb|KJB09952.1| hypothetical protein B456_001G177600 [Gossypium raimondii]
Length=302

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E  KE F V RNS+E+L+++LS   Q    +D LT ++++ C+QSQ  +  IIE+  DN+
Sbjct  180  EHKKELFKVTRNSLEVLSSMLSKETQPKPTKDKLTESMLEMCKQSQLVILMIIESTTDND  239

Query  549  ALLFEALNVNDEILKALSKYEEI  481
             +LFEALN+NDE+ + +SK+EE+
Sbjct  240  GILFEALNLNDELQQLISKFEEL  262



>ref|XP_006479538.1| PREDICTED: TOM1-like protein 1-like isoform X1 [Citrus sinensis]
 ref|XP_006479539.1| PREDICTED: TOM1-like protein 1-like isoform X2 [Citrus sinensis]
 ref|XP_006479540.1| PREDICTED: TOM1-like protein 1-like isoform X3 [Citrus sinensis]
Length=389

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            ++ KE   V RNS++LL+++L++  +   +++DLT +++++C++SQ  +QRIIE+  D+E
Sbjct  225  DEKKEFLVVTRNSLDLLSSILNTETEPKPIKEDLTVSMLEKCKESQPVIQRIIESTTDDE  284

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPA  442
            A+LFEALN++DE+   +S+YEE ++ AV    P P 
Sbjct  285  AMLFEALNLHDELQLVVSRYEE-LEAAVQSGEPAPG  319



>ref|XP_011004050.1| PREDICTED: TOM1-like protein 2 isoform X2 [Populus euphratica]
Length=437

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+  E     RNS+ELL+++L++  +   ++DDLT +LV +C+QSQ  +QRIIE+  D+E
Sbjct  226  EEKNETLVTTRNSLELLSSILNAETEPKPIKDDLTVSLVDKCKQSQPVIQRIIESTTDDE  285

Query  549  ALLFEALNVNDEILKALSKYEEI  481
            A+LFEALN++DE+ + + +Y E+
Sbjct  286  AMLFEALNLHDELQQVILRYNEL  308



>emb|CDY10185.1| BnaC05g04280D [Brassica napus]
Length=378

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 68/108 (63%), Gaps = 7/108 (6%)
 Frame = -2

Query  720  KEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALL  541
            KE  ++ RNS+ELL+++LS+  + +  ED+LT +LV++C+QSQ  +Q IIE+  D+E +L
Sbjct  232  KEQIEITRNSLELLSSMLSTEGKPNHTEDELTVSLVEKCKQSQPLIQMIIESTTDDEGVL  291

Query  540  FEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPVAVEPDESSYVG  397
            FEAL+VNDE+ + LS YE+       P   E     V  E   S Y G
Sbjct  292  FEALHVNDELQRVLSIYEK-------PDESEEKASIVGQESTGSKYAG  332



>ref|XP_004289949.1| PREDICTED: TOM1-like protein 2 [Fragaria vesca subsp. vesca]
Length=401

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+ KE   VARNS+ELL+++L+S      L+++LT  ++++C++SQ  +QRIIET  D+E
Sbjct  225  EEKKECLVVARNSLELLSSILNSETDPKPLKEELTMNMLEKCKESQPVIQRIIETTTDDE  284

Query  549  ALLFEALNVNDEILKALSKYEEI  481
            ++LFEAL +++E+ + +SKYEE+
Sbjct  285  SMLFEALYLHEELQQVISKYEEL  307



>ref|XP_002307649.2| hypothetical protein POPTR_0005s24650g [Populus trichocarpa]
 gb|EEE94645.2| hypothetical protein POPTR_0005s24650g [Populus trichocarpa]
Length=419

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+  E     RNS+ELL+++L++  +   ++DDLT +LV +C+QSQ  +QRIIE+  D+E
Sbjct  226  EEKNETLVTTRNSLELLSSILNAETEPKPVKDDLTVSLVDKCKQSQPVIQRIIESTTDDE  285

Query  549  ALLFEALNVNDEILKALSKYEEI  481
            A+LFEALN++DE+ + + +Y E+
Sbjct  286  AMLFEALNLHDELQQVILRYNEL  308



>ref|XP_002300774.2| hypothetical protein POPTR_0002s03910g [Populus trichocarpa]
 gb|EEE80047.2| hypothetical protein POPTR_0002s03910g [Populus trichocarpa]
Length=410

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  642  LEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEI  481
            +++DLT +L+ +C+QSQ  +QRIIE+  D+EA+LFEALN++DE+ + +S+YEE+
Sbjct  255  IKEDLTVSLLDKCKQSQPDIQRIIESTTDDEAMLFEALNLHDELQQVISQYEEL  308



>gb|KJB42271.1| hypothetical protein B456_007G146500 [Gossypium raimondii]
 gb|KJB42272.1| hypothetical protein B456_007G146500 [Gossypium raimondii]
Length=376

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQ K  F+V RNS+E+L+++L    +     D+LT +++++C+QSQ  +Q IIE   D++
Sbjct  219  EQKKGVFEVTRNSLEVLSSMLVKETEPKPTMDELTKSMLEKCKQSQPVIQMIIEGTTDDD  278

Query  549  ALLFEALNVNDEILKALSKYEEI  481
             +LFEALN+NDE+ + +SK+EE+
Sbjct  279  GILFEALNLNDELQQVISKFEEL  301



>gb|KHG07549.1| TOM1-like protein 2 [Gossypium arboreum]
Length=376

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQ KE F+V  NS+E+L+++L    +     D+LT +++++C+QSQ  +Q IIE   D++
Sbjct  219  EQKKEVFEVTWNSLEVLSSMLVKETEPKPTMDELTKSMLEKCKQSQPVIQMIIEGTTDDD  278

Query  549  ALLFEALNVNDEILKALSKYEEI  481
             +LFEALN+NDE+ + +SK+EE+
Sbjct  279  GILFEALNLNDELQQVISKFEEL  301



>ref|XP_002278050.1| PREDICTED: TOM1-like protein 2 [Vitis vinifera]
 ref|XP_010652371.1| PREDICTED: TOM1-like protein 2 [Vitis vinifera]
 ref|XP_010652372.1| PREDICTED: TOM1-like protein 2 [Vitis vinifera]
 ref|XP_010652373.1| PREDICTED: TOM1-like protein 2 [Vitis vinifera]
Length=359

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            ++ KE   + RNS+ELL+++L S  +   ++DDLT ++V++C+QSQ  VQRI+E+  ++E
Sbjct  225  KEKKEFLLITRNSLELLSSILDSQTEPKPIKDDLTVSMVEKCKQSQPVVQRIVESTINDE  284

Query  549  ALLFEALNVNDEILKALSKYEEI  481
             +LFEAL ++DE+ + +SKYEE+
Sbjct  285  GMLFEALYLHDELQQVISKYEEM  307



>ref|XP_011013579.1| PREDICTED: TOM1-like protein 2 [Populus euphratica]
Length=410

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  642  LEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEI  481
            +++DLT +L+ +C+QSQ  +QRIIE+  D+EA+LFEALN++DE+ + +S+YEE+
Sbjct  255  IKEDLTVSLLDKCKQSQPDIQRIIESTTDDEAMLFEALNLHDELQQVISQYEEL  308



>ref|XP_011028806.1| PREDICTED: TOM1-like protein 2 [Populus euphratica]
Length=410

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  642  LEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEI  481
            +++DLT +L+ +C+QSQ  +QRIIE+  D+EA+LFEALN++DE+ + +S+YEE+
Sbjct  255  IKEDLTVSLLDKCKQSQPDIQRIIESTTDDEAMLFEALNLHDELQQVISQYEEL  308



>emb|CBI37124.3| unnamed protein product [Vitis vinifera]
Length=503

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            ++ KE   + RNS+ELL+++L S  +   ++DDLT ++V++C+QSQ  VQRI+E+  ++E
Sbjct  369  KEKKEFLLITRNSLELLSSILDSQTEPKPIKDDLTVSMVEKCKQSQPVVQRIVESTINDE  428

Query  549  ALLFEALNVNDEILKALSKYEEI  481
             +LFEAL ++DE+ + +SKYEE+
Sbjct  429  GMLFEALYLHDELQQVISKYEEM  451



>ref|XP_011004048.1| PREDICTED: TOM1-like protein 2 isoform X1 [Populus euphratica]
 ref|XP_011004049.1| PREDICTED: TOM1-like protein 2 isoform X1 [Populus euphratica]
Length=438

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  639  EDDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEI  481
            +DDLT +LV +C+QSQ  +QRIIE+  D+EA+LFEALN++DE+ + + +Y E+
Sbjct  257  QDDLTVSLVDKCKQSQPVIQRIIESTTDDEAMLFEALNLHDELQQVILRYNEL  309



>ref|XP_002889591.1| VHS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65850.1| VHS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=383

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -2

Query  720  KEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALL  541
            KE  ++ RNS+ELL ++L++  + +  EDDLT +L+++C+QSQ  +Q IIE+  D+E +L
Sbjct  229  KEQIEITRNSLELLASMLNTEGKPNHTEDDLTVSLMEKCKQSQPLIQMIIESTTDDEGVL  288

Query  540  FEALNVNDEILKALSKY  490
            FEAL++NDE+ + LS Y
Sbjct  289  FEALHLNDELQRVLSSY  305



>gb|KJB11326.1| hypothetical protein B456_001G253900 [Gossypium raimondii]
 gb|KJB11327.1| hypothetical protein B456_001G253900 [Gossypium raimondii]
 gb|KJB11328.1| hypothetical protein B456_001G253900 [Gossypium raimondii]
 gb|KJB11329.1| hypothetical protein B456_001G253900 [Gossypium raimondii]
Length=375

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 75/117 (64%), Gaps = 14/117 (12%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQ KE F+V RNS+E+L+++LS+  +    +++LT +++++C+QSQ  +  IIE+  D++
Sbjct  223  EQKKELFEVTRNSLEVLSSILSTGTEPKPAKNELTESMLEKCKQSQLAIHMIIESTSDDD  282

Query  549  ALLFEALNVNDEILKALSKYE------EIIKPAVVPSAPEPAMIPVAVEPDESSYVG  397
             +LFEALN+NDE+ + +SK+E      +    A  P+AP        VE ++ S VG
Sbjct  283  GILFEALNLNDELQQVISKFEGLETGSKFDTAAANPAAP--------VETNKESTVG  331



>ref|XP_009796852.1| PREDICTED: TOM1-like protein 2 [Nicotiana sylvestris]
Length=381

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+ KE   V RNS+E+L+++L+S  +   ++DDL  ++++ C+QS   +QRI+E+   +E
Sbjct  212  EEKKEFLVVTRNSLEILSSILTSEVEPKPIKDDLAVSMLENCKQSLAVIQRIVESTSGDE  271

Query  549  ALLFEALNVNDEILKALSKYEEI  481
             L+FEALN++DE+ + +SKYEE+
Sbjct  272  GLMFEALNLHDELRQVISKYEEM  294



>ref|XP_006351672.1| PREDICTED: target of Myb protein 1-like [Solanum tuberosum]
Length=383

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+ KE   V RNS+E+L+++L+S  +   ++DDLT ++++ C+QS   +QRI+E+   +E
Sbjct  211  EEKKEFLVVTRNSLEILSSILNSDVEPKPIKDDLTMSMLENCKQSLAVIQRIVESTSGDE  270

Query  549  ALLFEALNVNDEILKALSKYEEI  481
             L+FEALN++DE+ + +S+YEE+
Sbjct  271  GLMFEALNLHDELRQVISRYEEM  293



>ref|NP_563762.1| ENTH/VHS/GAT family protein [Arabidopsis thaliana]
 gb|AAF80218.1|AC025290_7 Contains similarity to an ADP-ribosylation factor binding protein 
GGA1 from Homo sapiens gb|AF190862 and contains a VHS PF|00790 
domain. EST gb|BE037588 comes from this gene [Arabidopsis 
thaliana]
 gb|AAK96627.1| At1g06210/F9P14_4 [Arabidopsis thaliana]
 gb|AAN18147.1| At1g06210/F9P14_4 [Arabidopsis thaliana]
 gb|AEE27960.1| ENTH/VHS/GAT family protein [Arabidopsis thaliana]
Length=383

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = -2

Query  720  KEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALL  541
            KE  ++ RNS+ELL+++L++  + +  EDDLT +L+++C+QSQ  +Q IIE+  D+E +L
Sbjct  229  KEQIEITRNSLELLSSMLNTEGKPNHTEDDLTVSLMEKCKQSQPLIQMIIESTTDDEGVL  288

Query  540  FEALNVNDEILKALSKY  490
            FEAL++NDE+ + LS Y
Sbjct  289  FEALHLNDELQQVLSSY  305



>ref|XP_006305076.1| hypothetical protein CARUB_v10009444mg [Capsella rubella]
 gb|EOA37974.1| hypothetical protein CARUB_v10009444mg [Capsella rubella]
Length=381

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = -2

Query  720  KEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALL  541
            KE  ++ RNS+ELL+++L++  + +  EDDLT +L+++C+QSQ  +Q IIE+  D+E +L
Sbjct  229  KEKIEITRNSLELLSSMLNTEGKPNHSEDDLTVSLMEKCKQSQPMIQMIIESTTDDEGVL  288

Query  540  FEALNVNDEILKALSKY  490
            FEAL++NDE+ + LS Y
Sbjct  289  FEALHLNDELQRVLSSY  305



>ref|XP_002993154.1| hypothetical protein SELMODRAFT_136575 [Selaginella moellendorffii]
 gb|EFJ05794.1| hypothetical protein SELMODRAFT_136575 [Selaginella moellendorffii]
Length=355

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 72/111 (65%), Gaps = 16/111 (14%)
 Frame = -2

Query  711  FDVARNsvellttvlssSPQ-QDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFE  535
             DVA+NSVE+L+ VL+SS Q QD  +D+LT +LV+QC+Q+Q  VQ++ + AG+ + +LF+
Sbjct  231  LDVAKNSVEVLSNVLTSSDQHQDVSKDELTMSLVEQCKQAQRRVQQVAQRAGEGDPILFQ  290

Query  534  ALNVNDEILKALSKYEEII---------KPAVVPSAPEPAMIPVAVEPDES  409
            AL VNDE+ + L K+ E           KPA      EPA++   V+ D+S
Sbjct  291  ALAVNDELDQVLEKFSEFCVSSSSSQQSKPA------EPALVTAFVQEDQS  335



>ref|XP_002964154.1| hypothetical protein SELMODRAFT_82329 [Selaginella moellendorffii]
 gb|EFJ34487.1| hypothetical protein SELMODRAFT_82329 [Selaginella moellendorffii]
Length=355

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 72/111 (65%), Gaps = 16/111 (14%)
 Frame = -2

Query  711  FDVARNsvellttvlssSPQ-QDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFE  535
             DVA+NSVE+L+ VL+SS Q QD  +D+LT +LV+QC+Q+Q  VQ++ + AG+ + +LF+
Sbjct  231  LDVAKNSVEVLSNVLTSSNQHQDVSKDELTMSLVEQCKQAQRRVQQVAQRAGEGDPILFQ  290

Query  534  ALNVNDEILKALSKYEEII---------KPAVVPSAPEPAMIPVAVEPDES  409
            AL VNDE+ + L K+ E           KPA      EPA++   V+ D+S
Sbjct  291  ALAVNDELDQVLEKFSEFCVSSSSSQQSKPA------EPALVTAFVQEDQS  335



>ref|XP_010246780.1| PREDICTED: TOM1-like protein 2 [Nelumbo nucifera]
Length=395

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIE-TAGDN  553
            E+ KE   V RNSVELL+++L+S  ++   +DDLT +++++C+ SQ T+Q IIE T  D+
Sbjct  226  EEKKEFLVVTRNSVELLSSMLNSKEEKKPSKDDLTLSMLEKCKHSQPTLQWIIESTNDDD  285

Query  552  EALLFEALNVNDEILKALSKYEEI  481
            +A+ FEALN++DE+ +A+SKYEE+
Sbjct  286  DAMFFEALNLHDELQQAISKYEEM  309



>emb|CDY69303.1| BnaA06g39960D [Brassica napus]
Length=175

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -2

Query  711  FDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEA  532
             ++ RNS+ELL+++L++  + +  ED+LT +L+++C+QSQ  +Q IIE+  D+E++LFEA
Sbjct  35   IEITRNSLELLSSMLNTEGKPNHTEDELTVSLMEKCKQSQPLIQMIIESTIDDESVLFEA  94

Query  531  LNVNDEILKALSKYE  487
            L++NDE+ + LS YE
Sbjct  95   LHLNDELQRVLSSYE  109



>ref|XP_010485879.1| PREDICTED: TOM1-like protein 2 [Camelina sativa]
Length=381

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E  KE  ++ RNS+ELL+++L++  + +  EDDLT +L+++C+Q Q  +Q IIE+  D+E
Sbjct  226  EDKKEQIEITRNSLELLSSMLNTEGKPNHTEDDLTVSLMEKCKQCQPLIQMIIESTTDDE  285

Query  549  ALLFEALNVNDEILKALSKY  490
             +LFEAL++NDE+ + LS Y
Sbjct  286  GVLFEALHLNDELQRVLSSY  305



>ref|XP_010457748.1| PREDICTED: target of Myb protein 1-like [Camelina sativa]
Length=381

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E  KE  ++ RNS+ELL+++L++  + +  EDDLT +L+++C+Q Q  +Q IIE+  D+E
Sbjct  226  EDKKEQIEITRNSLELLSSMLNTEGKPNHTEDDLTVSLMEKCKQCQPLIQMIIESTTDDE  285

Query  549  ALLFEALNVNDEILKALSKY  490
             +LFEAL++NDE+ + LS Y
Sbjct  286  GVLFEALHLNDELQRVLSSY  305



>ref|XP_009118551.1| PREDICTED: target of Myb protein 1-like [Brassica rapa]
Length=380

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = -2

Query  720  KEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALL  541
            KE  ++ RNS+ELL+++L++  + +  ED+LT +L+++C+QSQ  +Q IIE+  D+E +L
Sbjct  230  KEQIEITRNSLELLSSMLNTEGKPNHTEDELTVSLMEKCKQSQPLIQMIIESTTDDETVL  289

Query  540  FEALNVNDEILKALSKYEE  484
            FEAL+VNDE+ + L+ YE+
Sbjct  290  FEALHVNDELQRVLAIYEK  308



>emb|CDY06201.1| BnaA09g50020D [Brassica napus]
Length=380

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = -2

Query  720  KEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALL  541
            KE  ++ RNS+ELL+++L++  + +  ED+LT +L+++C+QSQ  +Q IIE+  D+E +L
Sbjct  230  KEQIEITRNSLELLSSMLNTEGKPNHTEDELTVSLMEKCKQSQPLIQMIIESTTDDETVL  289

Query  540  FEALNVNDEILKALSKYEE  484
            FEAL+VNDE+ + L+ YE+
Sbjct  290  FEALHVNDELQRVLAIYEK  308



>ref|XP_009631518.1| PREDICTED: TOM1-like protein 2 [Nicotiana tomentosiformis]
Length=382

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+ KE   V RNS+E+L+++L+S  +   ++DDL  ++++ C+QS   +QRI+E+   +E
Sbjct  212  EEKKEFLVVTRNSLEILSSILTSEVEPKPIKDDLAVSMLENCKQSLAVIQRIVESTSGDE  271

Query  549  ALLFEALNVNDEILKALSKYEEI  481
             L+FEALN++DE+ + +S+YEE+
Sbjct  272  GLMFEALNLHDELRQVISRYEEM  294



>ref|XP_010475349.1| PREDICTED: target of Myb protein 1-like [Camelina sativa]
Length=381

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E  KE  ++ RNS+ELL+++L++  + +  EDDLT +L+++C+Q Q  +Q IIE+  D+E
Sbjct  226  EDKKEQIEITRNSLELLSSMLNTEGKPNHSEDDLTVSLMEKCKQCQPLIQMIIESTTDDE  285

Query  549  ALLFEALNVNDEILKALSKY  490
             +LFEAL++NDE+ + LS Y
Sbjct  286  GVLFEALHLNDELQRVLSSY  305



>gb|KDP26526.1| hypothetical protein JCGZ_17684 [Jatropha curcas]
Length=368

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            EQ  E    AR+S+ELL+++L++  +   +++DLT +L++ C+QSQ  +QRIIE+   +E
Sbjct  225  EQKNECLLTARSSLELLSSILNAETEPKPIKEDLTVSLLENCKQSQPVIQRIIESTTGDE  284

Query  549  ALLFEALNVNDEILKALSKYEEI  481
            A+LFEALN++DE+ + + +YEE+
Sbjct  285  AMLFEALNLHDELQQVIRRYEEL  307



>ref|XP_004246945.1| PREDICTED: TOM1-like protein 2 [Solanum lycopersicum]
Length=383

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+ KE   V RNS+E+L+++++S  +   ++DDL  ++++ C+QS   +QRI+E+   +E
Sbjct  211  EEKKELLVVTRNSLEILSSIMNSDVEPKPIKDDLAVSMLENCKQSLAVIQRIVESTSGDE  270

Query  549  ALLFEALNVNDEILKALSKYEEI  481
             L+FEALN++DE+ + +S+YEE+
Sbjct  271  GLMFEALNLHDELRQVISRYEEM  293



>emb|CDY47727.1| BnaA10g04160D [Brassica napus]
Length=115

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  639  EDDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYE  487
            ED+LT +L+ +C+Q Q+ +Q IIE+  D+E +LFEAL+VNDE+ + LS YE
Sbjct  12   EDELTVSLMDKCKQLQSLIQMIIESTTDDEGVLFEALHVNDELTRVLSIYE  62



>ref|XP_002532031.1| protein transporter, putative [Ricinus communis]
 gb|EEF30347.1| protein transporter, putative [Ricinus communis]
Length=378

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  642  LEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEI  481
            +++DLT +L++ C+QSQ  +QRII++  D+EA+LFEAL +NDE+ + +S+YE++
Sbjct  254  IKEDLTVSLLENCKQSQPVIQRIIQSTTDDEAVLFEALAINDELQQVISQYEKL  307



>emb|CDY47726.1| BnaA10g04150D [Brassica napus]
Length=330

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -2

Query  720  KEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALL  541
            KE  ++ RNS+ELL+++LS+  + +  ED+LT +L+ +C+Q Q+ +Q IIE+  D+E +L
Sbjct  183  KEQIEITRNSLELLSSMLSTEGKPNHTEDELTVSLMDKCKQLQSLIQMIIESTTDDEGVL  242

Query  540  FEALNVNDEILKALSKYE  487
            FEAL+VNDE+ + LS YE
Sbjct  243  FEALHVNDELTRVLSIYE  260



>gb|KHN10745.1| hypothetical protein glysoja_019176 [Glycine soja]
Length=299

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+ KE   VARNS+ELL+++L+S  +   L++DLT +L+ +C+QS + ++ I+E+  ++E
Sbjct  119  EERKEHLVVARNSLELLSSILNSDAEPKTLKEDLTVSLLDKCKQSLSIIKGIVESTTNDE  178

Query  549  ALLFEALNVNDEILKALSKYEEI  481
            A LFEAL +NDE+ + +SKYEE+
Sbjct  179  ATLFEALYLNDELQQIVSKYEEL  201



>emb|CDY09983.1| BnaC08g44680D [Brassica napus]
Length=380

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = -2

Query  720  KEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALL  541
            KE  ++ RNS+ELL+++L++  + +  ED+LT +L+++C+QSQ  +Q IIE+  D+E +L
Sbjct  230  KEQIEITRNSLELLSSMLNTEGKPNHPEDELTVSLMEKCKQSQPLIQMIIESTTDDETVL  289

Query  540  FEALNVNDEILKALSKYEE  484
            FEAL+VNDE+ + L+ YE+
Sbjct  290  FEALHVNDELQRILAIYEK  308



>ref|XP_002973972.1| hypothetical protein SELMODRAFT_57331, partial [Selaginella moellendorffii]
 gb|EFJ24927.1| hypothetical protein SELMODRAFT_57331, partial [Selaginella moellendorffii]
Length=252

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -2

Query  720  KEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIE  568
            KE FDVARNS ELL+TVLSSSPQ++ALEDDLTT LV+QCRQSQ +V R++E
Sbjct  198  KEVFDVARNSSELLSTVLSSSPQKEALEDDLTTALVEQCRQSQLSVHRLLE  248



>emb|CDP03748.1| unnamed protein product [Coffea canephora]
Length=388

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 72/112 (64%), Gaps = 2/112 (2%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+ +E+  V RN+++L +++L+S   Q   +++LT ++++ C+QS   +Q I+E+  D+E
Sbjct  229  EEKRESLAVTRNTLDLFSSILNSEDDQKPAKNELTDSMLENCKQSLPVIQGIVESTVDDE  288

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPAMIPV-AVEPDESSYVG  397
             LLFEAL+++DE+ + +S+Y+++  P +VP   EP        EPD S   G
Sbjct  289  GLLFEALSIHDELQQIISRYQQMEDP-LVPGGTEPKHGGAGGREPDASGVKG  339



>ref|XP_008364318.1| PREDICTED: TOM1-like protein 1 [Malus domestica]
Length=434

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E  KE   VARNS+ELL+++L++      L+++LT  ++ +C++SQ  V+RIIET  D+E
Sbjct  228  EDKKELLVVARNSLELLSSILNTETDPKPLKEELTLNMLXKCKESQPVVKRIIETTTDDE  287

Query  549  ALLFEALNVNDEILKALSKYEEI  481
             +LFEAL +++E+ + +SKYEE+
Sbjct  288  GMLFEALFLHEELQQIISKYEEL  310



>gb|EYU46453.1| hypothetical protein MIMGU_mgv1a023292mg, partial [Erythranthe 
guttata]
Length=357

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+  E   VARNS+++LT++L+S  +   L+DDLT  ++ +C++S   VQRI+ET  D+E
Sbjct  239  EEKTEHLAVARNSLDILTSILNSDIEPKPLKDDLTIGILAKCKRSLPIVQRIVETTSDDE  298

Query  549  ALLFEALNVNDEILKALSKYEEI  481
             +LF+ALN++DE+   +S+Y E+
Sbjct  299  VMLFDALNLHDELQLVISRYAEL  321



>gb|AAK27511.1|AF343969_1 ADP-ribosylation factor 60 [Coffea arabica]
Length=135

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+ +E+  V RN+++L +++L+S   Q   +++LT ++++ C+QS   +Q I+E+  D+E
Sbjct  44   EEKRESLAVTRNTLDLFSSILNSEDDQKPAKNELTDSMLENCKQSLPVIQGIVESTVDDE  103

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAV  466
             LLFEAL+++DE+ + +S+Y+++  P V
Sbjct  104  GLLFEALSIHDELQQIISRYQQMEDPLV  131



>ref|XP_007162547.1| hypothetical protein PHAVU_001G161300g [Phaseolus vulgaris]
 gb|ESW34541.1| hypothetical protein PHAVU_001G161300g [Phaseolus vulgaris]
Length=401

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 78/134 (58%), Gaps = 15/134 (11%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+ KE   VARNS+ELL+++L+S  +   L++DLT +L+ +C+QS + ++ I+E+  ++E
Sbjct  225  EEKKEHLVVARNSLELLSSILNSEAEPKPLKEDLTVSLLGKCKQSLSIIKGIVESTTNDE  284

Query  549  ALLFEALNVNDEILKALSKYEEI----IKPAVVPSAPEPAM-----------IPVAVEPD  415
            A LFEAL +NDE+ + +S YEE+    +     P   EPA            +P   E D
Sbjct  285  ATLFEALYLNDELQQVVSNYEELEAAQMSGTQQPQNAEPAKHDAEAVQNPNEVPAKFEID  344

Query  414  ESSYVGKEDSLIRK  373
            ES     + +L RK
Sbjct  345  ESEESEADQNLDRK  358



>gb|AGV54699.1| target of Myb protein 1-like protein [Phaseolus vulgaris]
Length=420

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 77/134 (57%), Gaps = 15/134 (11%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+ KE   VARNS+ELL+++L+   +   L++DLT +L+ +C+QS + ++ I+E+  ++E
Sbjct  220  EEKKEHLVVARNSLELLSSILNFEAEPKPLKEDLTVSLLGKCKQSLSIIKGIVESTTNDE  279

Query  549  ALLFEALNVNDEILKALSKYEEIIKPAVV----PSAPEPAM-----------IPVAVEPD  415
            A LFEAL +NDE+ + +S YEE+    +     P   EPA            +P   E D
Sbjct  280  ATLFEALYLNDELQQVVSNYEELEAAQMFGTQQPQNAEPAKHDAEAVQNPNEVPAKFEID  339

Query  414  ESSYVGKEDSLIRK  373
            ES     + +L RK
Sbjct  340  ESEESEADQNLDRK  353



>gb|KHN02502.1| Target of Myb protein 1 [Glycine soja]
Length=397

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+ KE   VARNS+ELL+++L+S  +   L++DLT +L+ +C+QS + ++ I E+  ++E
Sbjct  226  EERKENLVVARNSLELLSSILNSEAEPKPLKEDLTMSLLDKCKQSLSIIKGIAESTTNDE  285

Query  549  ALLFEALNVNDEILKALSKYEEI  481
            A LFEAL +NDE+ + +SKYEE+
Sbjct  286  ATLFEALYLNDELQQVVSKYEEL  308



>ref|XP_002969092.1| hypothetical protein SELMODRAFT_67275, partial [Selaginella moellendorffii]
 gb|EFJ30208.1| hypothetical protein SELMODRAFT_67275, partial [Selaginella moellendorffii]
Length=252

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  720  KEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIE  568
            KE FDVARNS ELL+TVLSSSPQ++ALEDDLT  LV+QCRQSQ +V R++E
Sbjct  198  KEVFDVARNSSELLSTVLSSSPQKEALEDDLTRALVEQCRQSQLSVHRLLE  248



>ref|XP_008235674.1| PREDICTED: uncharacterized protein LOC103334474 [Prunus mume]
Length=399

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+ KE   VARNS+ELL+++L++      L+++LT  ++ +C++SQ  ++RIIET  D+E
Sbjct  224  EEKKEVLVVARNSLELLSSILNTETDPKPLKEELTLNMLDKCKESQPVIKRIIETTTDDE  283

Query  549  ALLFEALNVNDEILKALSKYEEI  481
             +LFEAL +++E+ + +S+YE++
Sbjct  284  GMLFEALFLHEELQQVISRYEDL  306



>ref|XP_011080045.1| PREDICTED: TOM1-like protein 2 [Sesamum indicum]
Length=377

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+ KE    ARN++++L+++L+S  +   L+DDLT +++++C+QS   VQRIIE+  D+E
Sbjct  232  EENKEFLVTARNTLDILSSILNSDTEPKPLKDDLTLSMLEKCKQSLPVVQRIIESTSDDE  291

Query  549  ALLFEALNVNDEILKALSKYEEI  481
             +LF+AL+++DE+   +S++ E+
Sbjct  292  VMLFDALSLHDELQLIISRHGEL  314



>gb|KEH23932.1| ENTH/VHS/GAT family protein [Medicago truncatula]
Length=422

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+ KE   VARNS+ELL+++L+S  +   L++DLT +L+ +C+QS   ++ I+E+  ++E
Sbjct  228  EEKKEHLVVARNSLELLSSILNSEAEPKPLKEDLTLSLLDKCKQSLFLIKEIVESTANDE  287

Query  549  ALLFEALNVNDEILKALSKYEEI  481
              LFEAL +NDE+ + +SKYEE+
Sbjct  288  ETLFEALYLNDELQQLVSKYEEL  310



>ref|XP_007199901.1| hypothetical protein PRUPE_ppa006710mg [Prunus persica]
 gb|EMJ01100.1| hypothetical protein PRUPE_ppa006710mg [Prunus persica]
Length=399

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+ KE   VARNS+ELL+++L++      L+++LT  ++ +C++SQ  ++RIIET  D+E
Sbjct  224  EEKKEFLVVARNSLELLSSILNTETDPKPLKEELTLNMLDKCKESQPVIKRIIETTTDDE  283

Query  549  ALLFEALNVNDEILKALSKYEEI  481
             +LFEAL +++E+ + +S+YE++
Sbjct  284  GMLFEALFLHEELQQVISRYEDL  306



>ref|XP_010522149.1| PREDICTED: target of Myb protein 1 [Tarenaya hassleriana]
Length=377

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -2

Query  720  KEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALL  541
            KE  ++ RNS+ELL+++L++  + +  +D+LT +L+++C+QSQ  +Q IIE+  D+E LL
Sbjct  236  KEQIEITRNSLELLSSMLNTEGEPNNGKDELTESLIEKCKQSQPAIQMIIESTTDDEGLL  295

Query  540  FEALNVNDEILKALS  496
            FEAL++NDE+ + LS
Sbjct  296  FEALHLNDELQRVLS  310



>ref|XP_004493778.1| PREDICTED: target of Myb protein 1-like [Cicer arietinum]
Length=402

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -2

Query  729  EQTKEAFDVARNsvellttvlssSPQQDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNE  550
            E+ KE   VARNS+ELL+++LSS  +   L++D+T +L+ +C+QS + ++ I+E+  ++E
Sbjct  228  EEKKEHLVVARNSLELLSSILSSEAEPKPLKEDITLSLLDKCKQSLSVIKEIVESTTNDE  287

Query  549  ALLFEALNVNDEILKALSKYEEI  481
              LFEAL +NDE+ + +SKYEE+
Sbjct  288  ETLFEALYLNDELQQLVSKYEEL  310



>ref|XP_002990208.1| hypothetical protein SELMODRAFT_44205, partial [Selaginella moellendorffii]
 gb|EFJ08768.1| hypothetical protein SELMODRAFT_44205, partial [Selaginella moellendorffii]
Length=373

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 46/78 (59%), Gaps = 1/78 (1%)
 Frame = -2

Query  651  QDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEIIKP  472
            + AL ++L   LV+QC+++Q  V  ++ T  D E LLF+AL++ND++ K L+K + +   
Sbjct  195  KSALREELIVELVEQCQRTQKQVMHLVSTTSD-ETLLFQALSLNDDLQKVLAKRDAMASG  253

Query  471  AVVPSAPEPAMIPVAVEP  418
            A   +  +P   P  V P
Sbjct  254  ATPAAGKQPEAPPAPVFP  271



>gb|AAX96738.1| seed protein B32E [Oryza sativa Japonica Group]
Length=381

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = -2

Query  648  DALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEIIKPA  469
            + + +++   LV QCR  Q  V  ++   GD E+LLF+AL +NDE+ + L ++++I K  
Sbjct  11   EGVREEVIVDLVGQCRSYQGRVMDLVSNTGD-ESLLFQALGLNDELQRVLQRHDDIAKGV  69

Query  468  VVPSAPEPA  442
               S P PA
Sbjct  70   PPGSGPAPA  78



>ref|XP_009400790.1| PREDICTED: TOM1-like protein 1 [Musa acuminata subsp. malaccensis]
Length=543

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 9/83 (11%)
 Frame = -2

Query  651  QDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEII--  478
            Q A++D+L   LV QCR +Q  + +++ + GD E LL EAL +ND +   L+K+E I   
Sbjct  223  QGAIKDELIVDLVNQCRTNQKKLMQLVSSTGD-EKLLGEALELNDNLQSVLAKHEAIASG  281

Query  477  ------KPAVVPSAPEPAMIPVA  427
                  +P  +  A EP   PVA
Sbjct  282  SPLLHEQPKSLSQAKEPIKHPVA  304



>gb|EEE51810.1| hypothetical protein OsJ_33283 [Oryza sativa Japonica Group]
Length=465

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = -2

Query  648  DALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEIIKPA  469
            + + +++   LV QCR  Q  V  ++   GD E+LLF+AL +NDE+ + L ++++I K  
Sbjct  95   EGVREEVIVDLVGQCRSYQGRVMDLVSNTGD-ESLLFQALGLNDELQRVLQRHDDIAKGV  153

Query  468  VVPSAPEPA  442
               S P PA
Sbjct  154  PPGSGPAPA  162



>ref|NP_001067438.1| Os11g0199700 [Oryza sativa Japonica Group]
 gb|ABA91945.2| VHS domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27801.1| Os11g0199700 [Oryza sativa Japonica Group]
 dbj|BAG93654.1| unnamed protein product [Oryza sativa Japonica Group]
Length=588

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = -2

Query  648  DALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEIIKPA  469
            + + +++   LV QCR  Q  V  ++   GD E+LLF+AL +NDE+ + L ++++I K  
Sbjct  218  EGVREEVIVDLVGQCRSYQGRVMDLVSNTGD-ESLLFQALGLNDELQRVLQRHDDIAKGV  276

Query  468  VVPSAPEPA  442
               S P PA
Sbjct  277  PPGSGPAPA  285



>gb|AAL65395.1| seed protein B32E [Oryza sativa Japonica Group]
Length=287

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = -2

Query  618  LVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEIIKPAVVPSAPEPA  442
            LV QCR  Q  V  ++   GD E+LLF+AL +NDE+ + L ++++I K     S P PA
Sbjct  7    LVGQCRSYQGRVMDLVSNTGD-ESLLFQALGLNDELQRVLQRHDDIAKGVPPGSGPAPA  64



>ref|XP_002992483.1| hypothetical protein SELMODRAFT_269934 [Selaginella moellendorffii]
 gb|EFJ06421.1| hypothetical protein SELMODRAFT_269934 [Selaginella moellendorffii]
Length=411

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = -2

Query  651  QDALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEIIKP  472
            + AL ++L   LV+QC+++Q  V  ++ T  D E LLF+AL++ND++ K L+K + I   
Sbjct  126  KSALREELIVELVEQCQRTQKQVMHLVSTTSD-ETLLFQALSLNDDLQKVLAKRDAIASG  184

Query  471  AVVPSAPEPAMIPVAVEPDE  412
            A   +A +P   P +V P E
Sbjct  185  AAPAAAKQPEAPPASVFPRE  204



>gb|EEC67842.1| hypothetical protein OsI_35454 [Oryza sativa Indica Group]
Length=627

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = -2

Query  648  DALEDDLTTTLVQQCRQSQNTVQRIIETAGDNEALLFEALNVNDEILKALSKYEEIIKPA  469
            + + +++   LV QCR  Q  V  ++   GD E+LLF+AL +NDE+ + L ++++I K  
Sbjct  264  EGVREEVIVDLVGQCRSYQGRVMDLVSNTGD-ESLLFQALGLNDELQRVLQRHDDIAKGV  322

Query  468  VVPSAPEPA  442
               S P PA
Sbjct  323  PPGSGPAPA  331



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1313813971470