BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF024F01

Length=728
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009619283.1|  PREDICTED: CSC1-like protein RXW8                  209   4e-59   Nicotiana tomentosiformis
ref|XP_006356826.1|  PREDICTED: uncharacterized protein RSN1-like       209   5e-59   
ref|XP_010320285.1|  PREDICTED: CSC1-like protein RXW8                  209   6e-59   Solanum lycopersicum
ref|XP_009776500.1|  PREDICTED: CSC1-like protein RXW8 isoform X2       209   8e-59   Nicotiana sylvestris
ref|XP_009776499.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       209   1e-58   Nicotiana sylvestris
ref|XP_009797746.1|  PREDICTED: CSC1-like protein RXW8                  207   2e-58   Nicotiana sylvestris
ref|XP_009623866.1|  PREDICTED: CSC1-like protein RXW8                  208   3e-58   Nicotiana tomentosiformis
gb|EYU34204.1|  hypothetical protein MIMGU_mgv1a001911mg                201   8e-56   Erythranthe guttata [common monkey flower]
emb|CDP00997.1|  unnamed protein product                                196   3e-54   Coffea canephora [robusta coffee]
ref|XP_010109429.1|  putative membrane protein                          196   5e-54   
gb|EYU26139.1|  hypothetical protein MIMGU_mgv1a022719mg                190   4e-52   Erythranthe guttata [common monkey flower]
ref|XP_010245651.1|  PREDICTED: CSC1-like protein RXW8                  187   5e-52   
ref|XP_006342673.1|  PREDICTED: transmembrane protein 63B-like is...    190   2e-51   Solanum tuberosum [potatoes]
ref|XP_004252733.1|  PREDICTED: CSC1-like protein RXW8                  189   6e-51   Solanum lycopersicum
ref|XP_007018410.1|  Lipases,hydrolases, acting on ester bonds is...    186   1e-50   Theobroma cacao [chocolate]
gb|KDP41570.1|  hypothetical protein JCGZ_15977                         186   2e-50   Jatropha curcas
ref|XP_002302379.1|  early-responsive to dehydration family protein     184   8e-50   Populus trichocarpa [western balsam poplar]
ref|XP_011017061.1|  PREDICTED: CSC1-like protein RXW8                  183   1e-49   Populus euphratica
ref|XP_011078463.1|  PREDICTED: CSC1-like protein RXW8                  183   1e-49   
ref|XP_002510037.1|  conserved hypothetical protein                     183   2e-49   Ricinus communis
ref|NP_001050880.2|  Os03g0673800                                       180   2e-49   
gb|ABF98146.1|  early-responsive to dehydration protein, putative...    179   3e-49   Oryza sativa Japonica Group [Japonica rice]
gb|KDO53821.1|  hypothetical protein CISIN_1g010742mg                   179   6e-49   Citrus sinensis [apfelsine]
ref|XP_007225157.1|  hypothetical protein PRUPE_ppa002376mg             180   9e-49   
ref|XP_010247468.1|  PREDICTED: CSC1-like protein RXW8 isoform X3       176   9e-49   
ref|XP_004498938.1|  PREDICTED: uncharacterized membrane protein ...    181   1e-48   
ref|XP_009397320.1|  PREDICTED: CSC1-like protein RXW8                  181   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008220418.1|  PREDICTED: uncharacterized membrane protein ...    180   1e-48   Prunus mume [ume]
gb|KJB14676.1|  hypothetical protein B456_002G137000                    179   2e-48   Gossypium raimondii
ref|XP_006432542.1|  hypothetical protein CICLE_v10000536mg             179   2e-48   
gb|KJB14682.1|  hypothetical protein B456_002G137000                    179   2e-48   Gossypium raimondii
ref|XP_006471294.1|  PREDICTED: uncharacterized membrane protein ...    179   2e-48   
gb|KJB14680.1|  hypothetical protein B456_002G137000                    179   3e-48   Gossypium raimondii
gb|KJB14674.1|  hypothetical protein B456_002G137000                    179   3e-48   Gossypium raimondii
ref|XP_006650401.1|  PREDICTED: uncharacterized membrane protein ...    179   3e-48   Oryza brachyantha
gb|AAR87202.1|  expressed protein (with alternative splicing)           179   3e-48   Oryza sativa Japonica Group [Japonica rice]
gb|KHG29773.1|  Membrane protein                                        179   3e-48   Gossypium arboreum [tree cotton]
ref|XP_006650400.1|  PREDICTED: uncharacterized membrane protein ...    179   4e-48   Oryza brachyantha
gb|KJB14675.1|  hypothetical protein B456_002G137000                    179   4e-48   Gossypium raimondii
gb|EEC75908.1|  hypothetical protein OsI_12978                          179   4e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_006650399.1|  PREDICTED: uncharacterized membrane protein ...    179   4e-48   Oryza brachyantha
ref|XP_010247466.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       177   4e-48   Nelumbo nucifera [Indian lotus]
ref|XP_010247467.1|  PREDICTED: CSC1-like protein RXW8 isoform X2       176   5e-48   Nelumbo nucifera [Indian lotus]
ref|XP_009337130.1|  PREDICTED: CSC1-like protein RXW8 isoform X2       178   7e-48   Pyrus x bretschneideri [bai li]
ref|XP_009337128.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       178   1e-47   Pyrus x bretschneideri [bai li]
ref|XP_011458884.1|  PREDICTED: CSC1-like protein RXW8                  177   1e-47   Fragaria vesca subsp. vesca
ref|NP_001067352.1|  Os12g0633600                                       177   1e-47   
ref|XP_010664475.1|  PREDICTED: CSC1-like protein RXW8 isoform X3       175   2e-47   
ref|XP_006433681.1|  hypothetical protein CICLE_v10000392mg             176   5e-47   Citrus clementina [clementine]
emb|CBI19350.3|  unnamed protein product                                175   8e-47   Vitis vinifera
ref|XP_010664474.1|  PREDICTED: CSC1-like protein RXW8 isoform X2       174   9e-47   Vitis vinifera
ref|XP_010061607.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       175   1e-46   Eucalyptus grandis [rose gum]
ref|XP_002283520.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       175   1e-46   Vitis vinifera
ref|XP_010670325.1|  PREDICTED: CSC1-like protein RXW8                  175   1e-46   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN36998.1|  Putative membrane protein                               174   2e-46   Glycine soja [wild soybean]
ref|XP_008790275.1|  PREDICTED: CSC1-like protein RXW8                  174   2e-46   
ref|XP_003575997.1|  PREDICTED: CSC1-like protein RXW8                  174   2e-46   Brachypodium distachyon [annual false brome]
ref|XP_010061609.1|  PREDICTED: CSC1-like protein RXW8 isoform X2       174   2e-46   Eucalyptus grandis [rose gum]
ref|XP_008377944.1|  PREDICTED: uncharacterized protein LOC103441021    175   2e-46   
gb|KDO81403.1|  hypothetical protein CISIN_1g039780mg                   174   2e-46   Citrus sinensis [apfelsine]
ref|XP_006664233.1|  PREDICTED: uncharacterized protein RSN1-like       174   2e-46   Oryza brachyantha
ref|XP_006472346.1|  PREDICTED: uncharacterized membrane protein ...    174   3e-46   Citrus sinensis [apfelsine]
ref|XP_003556958.1|  PREDICTED: uncharacterized membrane protein ...    174   3e-46   Glycine max [soybeans]
ref|XP_004963302.1|  PREDICTED: uncharacterized protein RSN1-like...    174   3e-46   Setaria italica
ref|XP_008444514.1|  PREDICTED: uncharacterized membrane protein ...    173   4e-46   Cucumis melo [Oriental melon]
gb|KHN17195.1|  Putative membrane protein                               172   5e-46   Glycine soja [wild soybean]
ref|XP_008444513.1|  PREDICTED: uncharacterized membrane protein ...    172   6e-46   Cucumis melo [Oriental melon]
ref|XP_003545361.2|  PREDICTED: uncharacterized membrane protein ...    172   6e-46   Glycine max [soybeans]
ref|XP_010943516.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       172   1e-45   Elaeis guineensis
ref|XP_008674130.1|  PREDICTED: calcium permeable stress-gated ca...    171   1e-45   
ref|XP_008798903.1|  PREDICTED: CSC1-like protein RXW8 isoform X2       171   2e-45   
ref|XP_008798900.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       171   3e-45   Phoenix dactylifera
ref|XP_008674128.1|  PREDICTED: uncharacterized protein LOC103650...    171   3e-45   Zea mays [maize]
gb|KHN29744.1|  Putative membrane protein C2G11.09                      170   3e-45   Glycine soja [wild soybean]
ref|XP_010231660.1|  PREDICTED: CSC1-like protein RXW8 isoform X3       170   4e-45   Brachypodium distachyon [annual false brome]
ref|XP_008337022.1|  PREDICTED: uncharacterized membrane protein ...    170   4e-45   
ref|XP_003523635.1|  PREDICTED: uncharacterized membrane protein ...    170   5e-45   
ref|XP_010936200.1|  PREDICTED: CSC1-like protein RXW8                  170   5e-45   Elaeis guineensis
ref|XP_003561325.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       170   7e-45   Brachypodium distachyon [annual false brome]
ref|XP_004982191.1|  PREDICTED: uncharacterized membrane protein ...    169   1e-44   Setaria italica
ref|XP_009361350.1|  PREDICTED: CSC1-like protein RXW8 isoform X2       169   2e-44   Pyrus x bretschneideri [bai li]
ref|XP_007136794.1|  hypothetical protein PHAVU_009G074900g             168   2e-44   Phaseolus vulgaris [French bean]
gb|EMT19397.1|  Putative membrane protein                               169   2e-44   
ref|XP_006855764.1|  hypothetical protein AMTR_s00044p00184510          168   2e-44   Amborella trichopoda
ref|XP_002443649.1|  hypothetical protein SORBIDRAFT_08g022840          168   3e-44   Sorghum bicolor [broomcorn]
ref|XP_009361345.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       168   3e-44   Pyrus x bretschneideri [bai li]
ref|XP_004142910.1|  PREDICTED: uncharacterized membrane protein ...    167   5e-44   
ref|XP_004501797.1|  PREDICTED: uncharacterized membrane protein ...    166   9e-44   
ref|XP_004159572.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    165   2e-43   
gb|KEH39976.1|  ERD (early-responsive to dehydration stress) fami...    166   2e-43   Medicago truncatula
ref|XP_002892546.1|  hypothetical protein ARALYDRAFT_471124             166   3e-43   
dbj|BAJ92039.1|  predicted protein                                      166   3e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT10348.1|  Putative membrane protein                               164   2e-42   
gb|KEH35861.1|  ERD (early-responsive to dehydration stress) fami...    163   2e-42   Medicago truncatula
ref|XP_002464091.1|  hypothetical protein SORBIDRAFT_01g012190          162   4e-42   
ref|XP_006392283.1|  hypothetical protein EUTSA_v10023298mg             161   5e-42   
ref|XP_010553667.1|  PREDICTED: CSC1-like protein RXW8 isoform X2       161   5e-42   Tarenaya hassleriana [spider flower]
ref|XP_009396675.1|  PREDICTED: CSC1-like protein RXW8                  160   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010553666.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       161   1e-41   Tarenaya hassleriana [spider flower]
gb|KHF99101.1|  Membrane protein                                        160   1e-41   Gossypium arboreum [tree cotton]
ref|XP_006392284.1|  hypothetical protein EUTSA_v10023298mg             160   2e-41   Eutrema salsugineum [saltwater cress]
ref|XP_008643732.1|  PREDICTED: uncharacterized protein LOC100382...    159   2e-41   Zea mays [maize]
gb|KJB58719.1|  hypothetical protein B456_009G222800                    159   3e-41   Gossypium raimondii
dbj|BAB84010.1|  hypothetical protein                                   157   4e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KJB58718.1|  hypothetical protein B456_009G222800                    159   4e-41   Gossypium raimondii
ref|XP_008643723.1|  PREDICTED: uncharacterized protein LOC100382...    159   7e-41   Zea mays [maize]
ref|XP_006300402.1|  hypothetical protein CARUB_v10019848mg             159   8e-41   Capsella rubella
ref|XP_007160961.1|  hypothetical protein PHAVU_001G031900g             157   1e-40   Phaseolus vulgaris [French bean]
dbj|BAG68911.1|  hypothetical protein                                   157   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007160962.1|  hypothetical protein PHAVU_001G031900g             157   2e-40   Phaseolus vulgaris [French bean]
emb|CDY04434.1|  BnaA03g59260D                                          157   2e-40   
dbj|BAA88270.1|  RXW8                                                   157   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|NP_683440.2|  protein RXW8                                          157   4e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CDY44554.1|  BnaA01g21850D                                          156   4e-40   Brassica napus [oilseed rape]
emb|CDY45880.1|  BnaC01g28160D                                          156   5e-40   Brassica napus [oilseed rape]
ref|XP_009124465.1|  PREDICTED: CSC1-like protein RXW8                  156   5e-40   
emb|CDY27274.1|  BnaC04g18540D                                          155   7e-40   Brassica napus [oilseed rape]
ref|XP_010470242.1|  PREDICTED: CSC1-like protein RXW8 isoform X2       156   8e-40   Camelina sativa [gold-of-pleasure]
ref|XP_002888209.1|  hypothetical protein ARALYDRAFT_893642             156   9e-40   Arabidopsis lyrata subsp. lyrata
gb|AEM36349.1|  At1g58520                                               156   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001154436.1|  protein RXW8                                       156   2e-39   
gb|EMS66677.1|  Uncharacterized membrane protein C2G11.09               155   2e-39   Triticum urartu
ref|XP_009102869.1|  PREDICTED: CSC1-like protein RXW8                  155   2e-39   Brassica rapa
ref|XP_010414723.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       156   2e-39   
ref|XP_010943525.1|  PREDICTED: CSC1-like protein RXW8 isoform X2       153   3e-39   Elaeis guineensis
ref|XP_010470241.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       156   3e-39   
ref|XP_010548636.1|  PREDICTED: CSC1-like protein RXW8 isoform X2       153   7e-39   Tarenaya hassleriana [spider flower]
ref|XP_010548610.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       153   7e-39   Tarenaya hassleriana [spider flower]
emb|CDY20660.1|  BnaC08g13980D                                          152   2e-38   Brassica napus [oilseed rape]
dbj|BAK06091.1|  predicted protein                                      151   5e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90247.1|  predicted protein                                      150   6e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS66678.1|  Uncharacterized membrane protein C2G11.09               150   7e-38   Triticum urartu
ref|XP_009144475.1|  PREDICTED: CSC1-like protein At1g10090             150   7e-38   Brassica rapa
gb|AAC34338.1|  Hypothetical protein                                    148   9e-38   Arabidopsis thaliana [mouse-ear cress]
gb|KCW68598.1|  hypothetical protein EUGRSUZ_F02209                     149   1e-37   Eucalyptus grandis [rose gum]
ref|XP_003559478.1|  PREDICTED: CSC1-like protein RXW8                  149   1e-37   Brachypodium distachyon [annual false brome]
ref|XP_006303157.1|  hypothetical protein CARUB_v10008381mg             149   2e-37   Capsella rubella
ref|NP_172480.2|  Early-responsive to dehydration stress protein ...    148   4e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63909.1|  unknown                                                 148   4e-37   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43330.1|  unnamed protein product                                148   4e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010490656.1|  PREDICTED: CSC1-like protein At1g10090             148   5e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006417497.1|  hypothetical protein EUTSA_v10006880mg             148   5e-37   Eutrema salsugineum [saltwater cress]
ref|XP_003621301.1|  Membrane protein, putative                         148   8e-37   
ref|XP_010458341.1|  PREDICTED: CSC1-like protein At1g10090             147   1e-36   Camelina sativa [gold-of-pleasure]
gb|KJB64004.1|  hypothetical protein B456_010G028700                    146   2e-36   Gossypium raimondii
ref|XP_007018412.1|  Lipases,hydrolases, acting on ester bonds is...    144   2e-36   
gb|KDO72652.1|  hypothetical protein CISIN_1g014468mg                   143   2e-36   Citrus sinensis [apfelsine]
gb|KJB64002.1|  hypothetical protein B456_010G028700                    146   2e-36   Gossypium raimondii
ref|XP_010661094.1|  PREDICTED: CSC1-like protein HYP1 isoform X3       145   4e-36   Vitis vinifera
gb|KHG12367.1|  Membrane protein                                        145   5e-36   Gossypium arboreum [tree cotton]
ref|XP_010661092.1|  PREDICTED: CSC1-like protein HYP1 isoform X1       145   6e-36   Vitis vinifera
ref|XP_007018411.1|  Lipases,hydrolases, acting on ester bonds is...    144   7e-36   
ref|XP_007032618.1|  Early-responsive to dehydration stress prote...    143   8e-36   
ref|XP_002463956.1|  hypothetical protein SORBIDRAFT_01g009540          143   1e-35   
ref|XP_008644541.1|  PREDICTED: calcium permeable stress-gated ca...    144   1e-35   Zea mays [maize]
ref|XP_002530016.1|  conserved hypothetical protein                     143   2e-35   Ricinus communis
ref|XP_008230811.1|  PREDICTED: phosphate metabolism protein 7 is...    142   2e-35   
emb|CBI22257.3|  unnamed protein product                                144   2e-35   Vitis vinifera
ref|XP_009147396.1|  PREDICTED: CSC1-like protein HYP1                  143   3e-35   Brassica rapa
ref|XP_007032617.1|  Early-responsive to dehydration stress prote...    143   3e-35   
ref|XP_009360589.1|  PREDICTED: CSC1-like protein HYP1                  143   3e-35   
ref|XP_006482641.1|  PREDICTED: uncharacterized membrane protein ...    143   3e-35   Citrus sinensis [apfelsine]
gb|KDP27183.1|  hypothetical protein JCGZ_19882                         143   3e-35   Jatropha curcas
emb|CDY37544.1|  BnaA05g34090D                                          143   3e-35   Brassica napus [oilseed rape]
ref|XP_008379386.1|  PREDICTED: phosphate metabolism protein 7-like     142   3e-35   
gb|EEC76105.1|  hypothetical protein OsI_13363                          142   4e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_006650526.1|  PREDICTED: uncharacterized membrane protein ...    142   4e-35   Oryza brachyantha
ref|NP_001051134.1|  Os03g0726300                                       142   5e-35   
gb|EEE59847.1|  hypothetical protein OsJ_12422                          142   6e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008230810.1|  PREDICTED: uncharacterized membrane protein ...    142   7e-35   Prunus mume [ume]
ref|XP_006431218.1|  hypothetical protein CICLE_v10011183mg             142   8e-35   Citrus clementina [clementine]
ref|XP_007216321.1|  hypothetical protein PRUPE_ppa019884mg             142   1e-34   
ref|XP_002305383.1|  HYPOTHETICAL protein 1                             141   2e-34   Populus trichocarpa [western balsam poplar]
ref|XP_010670228.1|  PREDICTED: CSC1-like protein HYP1 isoform X1       140   2e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004981918.1|  PREDICTED: uncharacterized membrane protein ...    140   2e-34   Setaria italica
ref|XP_008341608.1|  PREDICTED: phosphate metabolism protein 7-like     140   2e-34   Malus domestica [apple tree]
emb|CAA56145.1|  HYP1                                                   138   2e-34   Arabidopsis thaliana [mouse-ear cress]
emb|CDY43268.1|  BnaC05g48610D                                          140   2e-34   Brassica napus [oilseed rape]
ref|XP_010670229.1|  PREDICTED: CSC1-like protein HYP1 isoform X2       140   2e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004304272.1|  PREDICTED: CSC1-like protein HYP1                  140   3e-34   Fragaria vesca subsp. vesca
gb|AAF26164.1|AC008261_21  unknown protein                              138   3e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KJB80261.1|  hypothetical protein B456_013G089300                    139   3e-34   Gossypium raimondii
gb|KJB75683.1|  hypothetical protein B456_012G051600                    139   4e-34   Gossypium raimondii
ref|XP_009407408.1|  PREDICTED: CSC1-like protein HYP1                  139   4e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011098667.1|  PREDICTED: CSC1-like protein HYP1 isoform X1       139   6e-34   Sesamum indicum [beniseed]
gb|KJB75678.1|  hypothetical protein B456_012G051600                    139   6e-34   Gossypium raimondii
gb|KJB80259.1|  hypothetical protein B456_013G089300                    139   6e-34   Gossypium raimondii
ref|XP_010029368.1|  PREDICTED: CSC1-like protein HYP1                  139   8e-34   Eucalyptus grandis [rose gum]
ref|XP_010258582.1|  PREDICTED: CSC1-like protein HYP1 isoform X1       139   9e-34   Nelumbo nucifera [Indian lotus]
ref|XP_006408462.1|  hypothetical protein EUTSA_v10020163mg             138   1e-33   Eutrema salsugineum [saltwater cress]
ref|XP_006844825.1|  hypothetical protein AMTR_s00058p00059520          138   1e-33   Amborella trichopoda
dbj|BAD94293.1|  hypothetical protein                                   138   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_186759.2|  uncharacterized protein                               138   2e-33   Arabidopsis thaliana [mouse-ear cress]
gb|KHG30396.1|  putative membrane C2G11.09                              137   2e-33   Gossypium arboreum [tree cotton]
ref|XP_002882200.1|  hypothetical protein ARALYDRAFT_477418             137   2e-33   
ref|XP_007045993.1|  Early-responsive to dehydration stress prote...    137   2e-33   Theobroma cacao [chocolate]
ref|XP_011010302.1|  PREDICTED: CSC1-like protein HYP1                  137   3e-33   Populus euphratica
ref|XP_004490117.1|  PREDICTED: uncharacterized membrane protein ...    137   4e-33   Cicer arietinum [garbanzo]
gb|EYU44140.1|  hypothetical protein MIMGU_mgv1a002119mg                137   4e-33   Erythranthe guttata [common monkey flower]
ref|XP_002888719.1|  hypothetical protein ARALYDRAFT_339179             137   5e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_010470930.1|  PREDICTED: CSC1-like protein At1g69450             136   6e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010511974.1|  PREDICTED: CSC1-like protein At1g69450             136   7e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010415590.1|  PREDICTED: CSC1-like protein At1g69450             136   7e-33   Camelina sativa [gold-of-pleasure]
dbj|BAJ86319.1|  predicted protein                                      135   1e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010525100.1|  PREDICTED: CSC1-like protein HYP1                  135   1e-32   Tarenaya hassleriana [spider flower]
ref|XP_006300796.1|  hypothetical protein CARUB_v10019875mg             135   2e-32   Capsella rubella
ref|XP_007157718.1|  hypothetical protein PHAVU_002G092500g             135   2e-32   Phaseolus vulgaris [French bean]
ref|XP_008230809.1|  PREDICTED: phosphate metabolism protein 7-li...    133   2e-32   Prunus mume [ume]
ref|XP_003618549.1|  Membrane protein, putative                         132   2e-32   
ref|XP_009134634.1|  PREDICTED: CSC1-like protein HYP1                  134   2e-32   Brassica rapa
emb|CDX74284.1|  BnaA03g27630D                                          134   3e-32   
ref|XP_009105488.1|  PREDICTED: CSC1-like protein At1g69450             134   3e-32   Brassica rapa
ref|XP_010485425.1|  PREDICTED: CSC1-like protein HYP1                  134   4e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010430647.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...    134   4e-32   Camelina sativa [gold-of-pleasure]
emb|CDY40924.1|  BnaC06g30620D                                          134   4e-32   Brassica napus [oilseed rape]
ref|XP_010939466.1|  PREDICTED: CSC1-like protein HYP1                  134   5e-32   
ref|XP_006573974.1|  PREDICTED: uncharacterized membrane protein ...    133   5e-32   
emb|CDX91963.1|  BnaC03g32650D                                          135   5e-32   
ref|XP_006299849.1|  hypothetical protein CARUB_v10016052mg             134   5e-32   Capsella rubella
ref|XP_010108715.1|  Uncharacterized membrane protein                   134   6e-32   Morus notabilis
ref|XP_008230808.1|  PREDICTED: phosphate metabolism protein 7-li...    133   7e-32   Prunus mume [ume]
ref|XP_007217011.1|  hypothetical protein PRUPE_ppa002110mg             133   8e-32   Prunus persica
gb|AAG60099.1|AC073178_10  unknown protein                              132   8e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006391015.1|  hypothetical protein EUTSA_v10018196mg             133   1e-31   Eutrema salsugineum [saltwater cress]
gb|EMT18535.1|  Putative membrane protein                               133   1e-31   
ref|XP_002522488.1|  conserved hypothetical protein                     132   2e-31   Ricinus communis
ref|XP_003551746.1|  PREDICTED: uncharacterized membrane protein ...    132   2e-31   Glycine max [soybeans]
ref|NP_177104.2|  Early-responsive to dehydration stress protein ...    132   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AES74766.2|  ERD (early-responsive to dehydration stress) fami...    132   2e-31   Medicago truncatula
ref|XP_003618548.1|  Membrane protein, putative                         132   2e-31   
ref|XP_006574920.1|  PREDICTED: uncharacterized membrane protein ...    130   3e-31   Glycine max [soybeans]
ref|XP_008780953.1|  PREDICTED: CSC1-like protein HYP1                  131   5e-31   Phoenix dactylifera
ref|XP_006574918.1|  PREDICTED: uncharacterized membrane protein ...    130   6e-31   Glycine max [soybeans]
ref|XP_006574916.1|  PREDICTED: uncharacterized membrane protein ...    130   9e-31   Glycine max [soybeans]
ref|XP_002269926.1|  PREDICTED: CSC1-like protein HYP1                  130   1e-30   Vitis vinifera
emb|CBI38238.3|  unnamed protein product                                130   2e-30   Vitis vinifera
ref|XP_007139547.1|  hypothetical protein PHAVU_008G039200g             129   2e-30   Phaseolus vulgaris [French bean]
gb|KDP41246.1|  hypothetical protein JCGZ_15653                         129   2e-30   Jatropha curcas
ref|XP_009356342.1|  PREDICTED: CSC1-like protein At1g69450             129   2e-30   Pyrus x bretschneideri [bai li]
ref|XP_003554648.1|  PREDICTED: uncharacterized membrane protein ...    129   3e-30   Glycine max [soybeans]
ref|XP_008221566.1|  PREDICTED: uncharacterized membrane protein ...    128   6e-30   Prunus mume [ume]
ref|XP_010088119.1|  Uncharacterized membrane protein                   128   6e-30   
ref|XP_004297274.1|  PREDICTED: CSC1-like protein At1g69450             127   7e-30   Fragaria vesca subsp. vesca
ref|XP_009789228.1|  PREDICTED: CSC1-like protein HYP1 isoform X2       126   1e-29   Nicotiana sylvestris
ref|XP_010316242.1|  PREDICTED: CSC1-like protein HYP1 isoform X3       126   1e-29   Solanum lycopersicum
gb|ABR16200.1|  unknown                                                 127   1e-29   Picea sitchensis
ref|XP_010316241.1|  PREDICTED: CSC1-like protein HYP1 isoform X2       126   2e-29   Solanum lycopersicum
ref|XP_009789223.1|  PREDICTED: CSC1-like protein HYP1 isoform X1       126   2e-29   Nicotiana sylvestris
ref|XP_006483099.1|  PREDICTED: uncharacterized membrane protein ...    126   2e-29   Citrus sinensis [apfelsine]
ref|XP_006338419.1|  PREDICTED: uncharacterized membrane protein ...    126   2e-29   Solanum tuberosum [potatoes]
ref|XP_004232200.1|  PREDICTED: CSC1-like protein HYP1 isoform X1       126   2e-29   Solanum lycopersicum
gb|KEH30802.1|  ERD (early-responsive to dehydration stress) fami...    124   3e-29   Medicago truncatula
gb|KEH30799.1|  ERD (early-responsive to dehydration stress) fami...    124   3e-29   Medicago truncatula
ref|XP_006483098.1|  PREDICTED: uncharacterized membrane protein ...    126   3e-29   
ref|XP_007151261.1|  hypothetical protein PHAVU_004G031700g             125   3e-29   Phaseolus vulgaris [French bean]
emb|CDP02261.1|  unnamed protein product                                125   6e-29   Coffea canephora [robusta coffee]
gb|KCW86556.1|  hypothetical protein EUGRSUZ_B03192                     124   6e-29   Eucalyptus grandis [rose gum]
ref|XP_004489423.1|  PREDICTED: uncharacterized membrane protein ...    125   7e-29   Cicer arietinum [garbanzo]
ref|XP_009625276.1|  PREDICTED: CSC1-like protein HYP1 isoform X2       124   8e-29   
gb|KEH30798.1|  ERD (early-responsive to dehydration stress) fami...    124   9e-29   Medicago truncatula
gb|KEH30800.1|  ERD (early-responsive to dehydration stress) fami...    124   9e-29   Medicago truncatula
ref|XP_010044468.1|  PREDICTED: CSC1-like protein At1g69450             124   9e-29   Eucalyptus grandis [rose gum]
gb|EAY83674.1|  hypothetical protein OsI_38898                          124   1e-28   Oryza sativa Indica Group [Indian rice]
ref|NP_001067142.1|  Os12g0582800                                       124   1e-28   
ref|XP_011012741.1|  PREDICTED: CSC1-like protein At1g69450             124   1e-28   Populus euphratica
ref|XP_010661095.1|  PREDICTED: CSC1-like protein HYP1 isoform X4       123   1e-28   Vitis vinifera
ref|XP_009625272.1|  PREDICTED: CSC1-like protein HYP1 isoform X1       124   1e-28   Nicotiana tomentosiformis
ref|XP_010661093.1|  PREDICTED: CSC1-like protein HYP1 isoform X2       123   2e-28   Vitis vinifera
ref|XP_011017887.1|  PREDICTED: CSC1-like protein At1g69450 isofo...    124   2e-28   Populus euphratica
ref|XP_011017881.1|  PREDICTED: CSC1-like protein At1g69450 isofo...    124   2e-28   Populus euphratica
ref|XP_008446400.1|  PREDICTED: uncharacterized membrane protein ...    123   2e-28   Cucumis melo [Oriental melon]
ref|XP_004516572.1|  PREDICTED: uncharacterized membrane protein ...    123   3e-28   Cicer arietinum [garbanzo]
gb|EPS67360.1|  hypothetical protein M569_07415                         115   3e-28   Genlisea aurea
ref|XP_004491850.1|  PREDICTED: uncharacterized membrane protein ...    122   5e-28   Cicer arietinum [garbanzo]
ref|XP_008339854.1|  PREDICTED: uncharacterized membrane protein ...    121   1e-27   
ref|XP_002311322.1|  hypothetical protein POPTR_0008s09070g             121   2e-27   
ref|XP_010683104.1|  PREDICTED: CSC1-like protein At1g69450             120   2e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006664683.1|  PREDICTED: transmembrane protein 63B-like          120   2e-27   
ref|XP_010258239.1|  PREDICTED: CSC1-like protein HYP1                  120   4e-27   Nelumbo nucifera [Indian lotus]
emb|CDP00377.1|  unnamed protein product                                119   6e-27   
ref|XP_010551412.1|  PREDICTED: CSC1-like protein At1g69450             118   1e-26   
ref|XP_003613914.1|  Membrane protein, putative                         116   9e-26   
gb|KJB80260.1|  hypothetical protein B456_013G089300                    114   3e-25   
ref|XP_008661355.1|  PREDICTED: calcium permeable stress-gated ca...    114   4e-25   
ref|XP_002442408.1|  hypothetical protein SORBIDRAFT_08g019525          112   4e-25   
gb|KDO83033.1|  hypothetical protein CISIN_1g0052161mg                  105   1e-24   
ref|XP_003578375.1|  PREDICTED: CSC1-like protein HYP1                  112   2e-24   
ref|XP_001765646.1|  predicted protein                                  110   7e-24   
gb|KEH30803.1|  ERD (early-responsive to dehydration stress) fami...    110   7e-24   
emb|CAN72762.1|  hypothetical protein VITISV_012826                     111   1e-23   
ref|XP_004963014.1|  PREDICTED: transmembrane protein 63B-like is...    109   2e-23   
ref|XP_004155380.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    108   3e-23   
ref|XP_004135445.1|  PREDICTED: uncharacterized membrane protein ...    108   4e-23   
ref|XP_001764420.1|  predicted protein                                  108   5e-23   
ref|NP_191015.2|  Early-responsive to dehydration stress protein ...    103   1e-21   
ref|XP_010427157.1|  PREDICTED: CSC1-like protein At3g54510             103   1e-21   
ref|NP_001118837.1|  Early-responsive to dehydration stress prote...    103   1e-21   
gb|KFK34689.1|  hypothetical protein AALP_AA5G178800                    103   2e-21   
dbj|BAJ87166.1|  predicted protein                                      103   2e-21   
ref|XP_002876256.1|  hypothetical protein ARALYDRAFT_485854             103   2e-21   
gb|KJB60233.1|  hypothetical protein B456_009G295700                    103   3e-21   
ref|XP_010521464.1|  PREDICTED: CSC1-like protein At3g54510             102   4e-21   
ref|XP_011088368.1|  PREDICTED: CSC1-like protein At3g54510 isofo...    102   5e-21   
ref|XP_011088351.1|  PREDICTED: CSC1-like protein At3g54510 isofo...    102   5e-21   
gb|KGN52299.1|  hypothetical protein Csa_5G623630                       102   5e-21   
ref|XP_004157550.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    102   5e-21   
ref|XP_004142485.1|  PREDICTED: uncharacterized membrane protein ...    102   5e-21   
ref|XP_011088359.1|  PREDICTED: CSC1-like protein At3g54510 isofo...    102   6e-21   
ref|XP_011088342.1|  PREDICTED: CSC1-like protein At3g54510 isofo...    102   6e-21   
ref|XP_010515983.1|  PREDICTED: CSC1-like protein At3g54510             102   7e-21   
ref|XP_010089233.1|  Uncharacterized membrane protein                   101   1e-20   
ref|XP_010504259.1|  PREDICTED: CSC1-like protein At3g54510             101   1e-20   
ref|XP_007220369.1|  hypothetical protein PRUPE_ppa017744mg             101   1e-20   
ref|XP_006591166.1|  PREDICTED: uncharacterized membrane protein ...    100   2e-20   
ref|XP_006292418.1|  hypothetical protein CARUB_v10018632mg             100   2e-20   
gb|KHN18831.1|  Putative membrane protein C2G11.09                    99.8    3e-20   
ref|XP_011469389.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  99.8    3e-20   
ref|XP_011042157.1|  PREDICTED: CSC1-like protein At3g54510             100   3e-20   
ref|XP_006591163.1|  PREDICTED: uncharacterized membrane protein ...    100   3e-20   
ref|XP_007011167.1|  Early-responsive to dehydration stress prote...    100   3e-20   
ref|XP_006591165.1|  PREDICTED: uncharacterized membrane protein ...  99.8    3e-20   
ref|XP_006591164.1|  PREDICTED: uncharacterized membrane protein ...    100   3e-20   
emb|CAB77571.1|  putative protein                                       100   3e-20   
ref|XP_006403564.1|  hypothetical protein EUTSA_v10010925mg           99.8    4e-20   
ref|XP_008446927.1|  PREDICTED: uncharacterized membrane protein ...  99.4    4e-20   
ref|XP_004308611.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  99.8    4e-20   
ref|XP_008446926.1|  PREDICTED: uncharacterized membrane protein ...  99.8    4e-20   
gb|EPS65452.1|  hypothetical protein M569_09324                       99.8    4e-20   
emb|CDX73475.1|  BnaC08g25280D                                        99.8    4e-20   
emb|CDX78241.1|  BnaA09g34360D                                        99.4    5e-20   
ref|XP_009354442.1|  PREDICTED: CSC1-like protein At3g54510           99.8    5e-20   
ref|XP_002303914.1|  early-responsive to dehydration family protein   99.4    6e-20   
ref|XP_009336442.1|  PREDICTED: CSC1-like protein At3g54510           98.6    1e-19   
ref|XP_002265197.1|  PREDICTED: CSC1-like protein At3g54510           98.2    1e-19   
ref|XP_004515571.1|  PREDICTED: uncharacterized membrane protein ...  98.6    1e-19   
gb|KCW65937.1|  hypothetical protein EUGRSUZ_G03247                   98.6    1e-19   
ref|XP_010068951.1|  PREDICTED: CSC1-like protein At3g54510           98.6    1e-19   
gb|KDP42833.1|  hypothetical protein JCGZ_23775                       92.4    2e-19   
gb|EYU38264.1|  hypothetical protein MIMGU_mgv1a020907mg              97.4    2e-19   
ref|XP_009602132.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  97.1    3e-19   
ref|XP_009602131.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  97.1    3e-19   
ref|XP_009116132.1|  PREDICTED: CSC1-like protein At3g54510           97.1    4e-19   
ref|XP_009764505.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  96.7    5e-19   
ref|XP_009764506.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  96.3    5e-19   
ref|XP_010273235.1|  PREDICTED: CSC1-like protein At3g54510           96.3    6e-19   
ref|XP_006365456.1|  PREDICTED: uncharacterized membrane protein ...  96.3    7e-19   
ref|XP_002960116.1|  hypothetical protein SELMODRAFT_450821           95.9    8e-19   
ref|XP_002984025.1|  hypothetical protein SELMODRAFT_156268           95.9    9e-19   
ref|XP_003598670.1|  Membrane protein, putative                       95.5    1e-18   
gb|AES68921.2|  ERD (early-responsive to dehydration stress) fami...  95.1    1e-18   
ref|XP_007148980.1|  hypothetical protein PHAVU_005G030600g           95.1    1e-18   
ref|XP_004229157.2|  PREDICTED: CSC1-like protein At3g54510           95.1    2e-18   
emb|CBI17725.3|  unnamed protein product                              95.1    2e-18   
gb|KDO83034.1|  hypothetical protein CISIN_1g0052161mg                87.8    2e-18   
ref|XP_006645386.1|  PREDICTED: uncharacterized membrane protein ...  94.0    3e-18   
gb|AFW83960.1|  hypothetical protein ZEAMMB73_809898                  94.0    4e-18   
gb|KHG15757.1|  putative membrane C2G11.09                            93.6    4e-18   
emb|CDP16438.1|  unnamed protein product                              92.4    1e-17   
ref|XP_008656873.1|  PREDICTED: phosphate metabolism protein 7 is...  92.4    1e-17   
ref|XP_008656872.1|  PREDICTED: phosphate metabolism protein 7 is...  92.4    1e-17   
ref|XP_001757556.1|  predicted protein                                92.4    1e-17   
ref|XP_002513083.1|  conserved hypothetical protein                   92.0    2e-17   
emb|CDP11732.1|  unnamed protein product                              92.0    2e-17   
ref|XP_008775844.1|  PREDICTED: CSC1-like protein At3g54510           90.9    4e-17   
emb|CDP11733.1|  unnamed protein product                              90.5    6e-17   
ref|XP_009603996.1|  PREDICTED: CSC1-like protein At1g32090           90.1    9e-17   
gb|EMT04748.1|  Putative membrane protein                             89.4    1e-16   
ref|XP_006352918.1|  PREDICTED: uncharacterized protein RSN1-like     89.7    1e-16   
ref|XP_010906445.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  89.4    1e-16   
ref|XP_004245915.1|  PREDICTED: CSC1-like protein At1g32090           89.4    1e-16   
ref|XP_010906444.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  89.4    1e-16   
emb|CDM86482.1|  unnamed protein product                              89.0    2e-16   
ref|XP_009337131.1|  PREDICTED: CSC1-like protein RXW8 isoform X3     88.6    2e-16   
gb|KDP46674.1|  hypothetical protein JCGZ_12198                       88.6    2e-16   
ref|XP_004300169.1|  PREDICTED: CSC1-like protein At1g32090           88.6    2e-16   
ref|XP_009784323.1|  PREDICTED: CSC1-like protein At1g32090           88.2    3e-16   
dbj|BAJ86645.1|  predicted protein                                    87.8    4e-16   
dbj|BAJ91313.1|  predicted protein                                    87.8    4e-16   
ref|XP_008391493.1|  PREDICTED: uncharacterized membrane protein ...  84.7    4e-16   
ref|XP_001754358.1|  predicted protein                                87.4    5e-16   
ref|XP_011074804.1|  PREDICTED: CSC1-like protein At1g32090           87.4    6e-16   
gb|EMS49367.1|  Uncharacterized membrane protein C2G11.09             87.4    6e-16   
ref|XP_010110412.1|  Uncharacterized protein RSN1                     85.1    7e-16   
ref|XP_010664612.1|  PREDICTED: CSC1-like protein At1g32090 isofo...  87.0    7e-16   
ref|XP_008238126.1|  PREDICTED: uncharacterized protein RSN1          87.0    9e-16   
ref|XP_007210357.1|  hypothetical protein PRUPE_ppa001580mg           87.0    9e-16   
ref|XP_002273732.1|  PREDICTED: CSC1-like protein At1g32090 isofo...  86.7    9e-16   
ref|XP_002519965.1|  Extensin-3 precursor, putative                   86.7    1e-15   
ref|XP_010522697.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  86.3    1e-15   
ref|XP_010522695.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  86.3    1e-15   
ref|XP_010522696.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  86.3    1e-15   
dbj|BAK03622.1|  predicted protein                                    85.9    1e-15   
ref|XP_002456934.1|  hypothetical protein SORBIDRAFT_03g045900        85.9    2e-15   
ref|XP_007040777.1|  Early-responsive to dehydration stress prote...  86.3    2e-15   
ref|XP_007040776.1|  Early-responsive to dehydration stress prote...  85.9    2e-15   
ref|XP_003565073.1|  PREDICTED: CSC1-like protein At3g54510           85.9    2e-15   
ref|XP_004164564.1|  PREDICTED: uncharacterized membrane protein ...  85.9    2e-15   
gb|KHG26829.1|  putative membrane C2G11.09                            85.9    2e-15   
gb|AFI41197.1|  dehydration stress protein                            85.5    3e-15   
ref|XP_007226980.1|  hypothetical protein PRUPE_ppa002249mg           85.1    3e-15   
ref|XP_006396700.1|  hypothetical protein EUTSA_v10028449mg           85.1    3e-15   
ref|XP_004136187.1|  PREDICTED: uncharacterized membrane protein ...  85.1    3e-15   
ref|XP_003612662.1|  Membrane protein, putative                       85.1    4e-15   
ref|XP_006350470.1|  PREDICTED: uncharacterized membrane protein ...  85.1    4e-15   
ref|XP_006438758.1|  hypothetical protein CICLE_v10030873mg           84.7    4e-15   
ref|XP_002975592.1|  hypothetical protein SELMODRAFT_150725           84.3    6e-15   
dbj|BAJ87409.1|  predicted protein                                    83.6    6e-15   
ref|XP_002973564.1|  hypothetical protein SELMODRAFT_442177           84.3    6e-15   
ref|XP_008451390.1|  PREDICTED: uncharacterized membrane protein ...  84.3    7e-15   
ref|XP_008451393.1|  PREDICTED: uncharacterized membrane protein ...  84.0    7e-15   
ref|XP_010670424.1|  PREDICTED: CSC1-like protein At3g54510           84.0    7e-15   
ref|XP_008451392.1|  PREDICTED: uncharacterized membrane protein ...  84.0    7e-15   
gb|EMS50375.1|  Transmembrane protein 63B                             84.0    7e-15   
ref|XP_007158205.1|  hypothetical protein PHAVU_002G133000g           84.0    7e-15   
ref|XP_006413690.1|  hypothetical protein EUTSA_v10024476mg           84.0    8e-15   
gb|KJB51550.1|  hypothetical protein B456_008G222200                  83.6    9e-15   
gb|KHN24660.1|  hypothetical protein glysoja_038384                   77.8    9e-15   
ref|XP_006396516.1|  hypothetical protein EUTSA_v10029277mg           83.6    9e-15   
ref|XP_009357481.1|  PREDICTED: calcium permeable stress-gated ca...  83.6    1e-14   
ref|XP_004231619.1|  PREDICTED: calcium permeable stress-gated ca...  83.6    1e-14   
gb|KJB51549.1|  hypothetical protein B456_008G222200                  83.6    1e-14   
ref|XP_008384098.1|  PREDICTED: uncharacterized protein RSN1          83.6    1e-14   
ref|XP_010455942.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  83.2    1e-14   
ref|XP_010546606.1|  PREDICTED: CSC1-like protein At1g11960           83.2    1e-14   
ref|XP_010455941.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  83.2    1e-14   
gb|EYU27725.1|  hypothetical protein MIMGU_mgv1a001730mg              83.2    1e-14   
ref|XP_006283166.1|  hypothetical protein CARUB_v10004197mg           83.2    1e-14   
ref|XP_002867790.1|  hypothetical protein ARALYDRAFT_492658           83.2    2e-14   
gb|KFK30891.1|  hypothetical protein AALP_AA6G039600                  82.8    2e-14   
emb|CDX82907.1|  BnaC01g13570D                                        82.8    2e-14   
ref|XP_009108550.1|  PREDICTED: calcium permeable stress-gated ca...  82.8    2e-14   
ref|XP_009135761.1|  PREDICTED: CSC1-like protein At3g21620           82.8    2e-14   
emb|CDY48898.1|  BnaA03g36370D                                        82.8    2e-14   
emb|CDX78243.1|  BnaA09g34380D                                        76.6    2e-14   
ref|NP_193943.2|  early-responsive to dehydration stress-related ...  82.8    2e-14   
ref|XP_009135587.1|  PREDICTED: calcium permeable stress-gated ca...  82.8    2e-14   
gb|KFK30892.1|  hypothetical protein AALP_AA6G039600                  82.4    2e-14   
ref|XP_010434078.1|  PREDICTED: calcium permeable stress-gated ca...  82.8    2e-14   
emb|CAA18115.1|  putative protein                                     82.4    2e-14   
emb|CDY32438.1|  BnaC03g42220D                                        82.4    2e-14   
ref|XP_010439363.1|  PREDICTED: calcium permeable stress-gated ca...  82.8    2e-14   
ref|XP_010686787.1|  PREDICTED: calcium permeable stress-gated ca...  82.4    3e-14   
ref|XP_004293316.1|  PREDICTED: calcium permeable stress-gated ca...  82.0    3e-14   
ref|XP_003549667.1|  PREDICTED: uncharacterized membrane protein ...  82.0    3e-14   
ref|NP_192343.1|  early-responsive to dehydration stress-related ...  82.0    3e-14   
dbj|BAD93792.1|  hypothetical protein                                 82.0    3e-14   
emb|CDY27443.1|  BnaC03g64830D                                        82.0    3e-14   
ref|XP_010448929.1|  PREDICTED: calcium permeable stress-gated ca...  81.6    4e-14   
ref|XP_006406250.1|  hypothetical protein EUTSA_v10020132mg           81.6    4e-14   
ref|XP_010430503.1|  PREDICTED: CSC1-like protein At4g02900           81.6    4e-14   
ref|XP_010089460.1|  Uncharacterized membrane protein                 81.6    4e-14   
ref|XP_010422520.1|  PREDICTED: CSC1-like protein At4g02900           81.6    4e-14   
ref|XP_006363038.1|  PREDICTED: uncharacterized protein RSN1-like...  81.6    4e-14   
ref|XP_009357605.1|  PREDICTED: calcium permeable stress-gated ca...  81.6    5e-14   
gb|EMT13890.1|  Putative membrane protein                             81.6    5e-14   
ref|XP_006854105.1|  hypothetical protein AMTR_s00048p00143150        81.3    5e-14   
ref|XP_010488177.1|  PREDICTED: CSC1-like protein At3g21620 isofo...  81.3    6e-14   
gb|EMS63833.1|  Uncharacterized membrane protein C2G11.09             81.3    6e-14   
ref|XP_010466416.1|  PREDICTED: CSC1-like protein At3g21620 isofo...  81.3    6e-14   
gb|EPS61105.1|  hypothetical protein M569_13694                       80.9    6e-14   
ref|XP_010466415.1|  PREDICTED: CSC1-like protein At3g21620 isofo...  81.3    7e-14   
ref|XP_010488175.1|  PREDICTED: CSC1-like protein At3g21620 isofo...  80.9    7e-14   
gb|AAL07154.1|  unknown protein                                       80.9    7e-14   
ref|XP_008373502.1|  PREDICTED: uncharacterized protein RSN1          80.9    7e-14   
ref|XP_009373514.1|  PREDICTED: CSC1-like protein At1g32090           80.9    8e-14   
dbj|BAD94445.1|  hypothetical protein                                 80.9    9e-14   
emb|CDX79125.1|  BnaA01g11920D                                        80.5    9e-14   
ref|XP_007153987.1|  hypothetical protein PHAVU_003G081500g           80.9    9e-14   
ref|XP_006299035.1|  hypothetical protein CARUB_v10015172mg           80.5    9e-14   
ref|NP_188799.1|  early-responsive to dehydration stress-related ...  80.5    9e-14   
ref|XP_003529649.1|  PREDICTED: uncharacterized membrane protein ...  80.5    1e-13   
ref|XP_011095994.1|  PREDICTED: calcium permeable stress-gated ca...  80.5    1e-13   
ref|XP_001782141.1|  predicted protein                                80.1    1e-13   
ref|XP_003555683.1|  PREDICTED: uncharacterized membrane protein ...  80.1    1e-13   
ref|XP_003610472.1|  Membrane protein, putative                       80.1    1e-13   
gb|KHN28986.1|  Putative membrane protein C2G11.09                    80.1    1e-13   
ref|XP_009134294.1|  PREDICTED: CSC1-like protein At4g04340           80.1    1e-13   
ref|XP_002872689.1|  hypothetical protein ARALYDRAFT_911697           80.1    1e-13   
emb|CDX90856.1|  BnaA03g25360D                                        80.1    1e-13   
emb|CDP04437.1|  unnamed protein product                              80.1    1e-13   
ref|XP_004295293.1|  PREDICTED: calcium permeable stress-gated ca...  80.1    2e-13   
ref|XP_002870239.1|  hypothetical protein ARALYDRAFT_493346           80.1    2e-13   
ref|XP_006287199.1|  hypothetical protein CARUB_v10000374mg           79.7    2e-13   
gb|KHG01781.1|  putative membrane C2G11.09                            79.7    2e-13   
ref|XP_008371060.1|  PREDICTED: transmembrane protein 63B-like        79.7    2e-13   
ref|XP_010510410.1|  PREDICTED: CSC1-like protein At3g21620           79.7    2e-13   
ref|XP_010548889.1|  PREDICTED: CSC1-like protein At3g21620           79.7    2e-13   
ref|XP_006287117.1|  hypothetical protein CARUB_v10000278mg           79.7    2e-13   
gb|EYU29074.1|  hypothetical protein MIMGU_mgv1a021500mg              79.7    2e-13   
ref|XP_004491137.1|  PREDICTED: uncharacterized protein RSN1-like     79.3    2e-13   
ref|XP_001770572.1|  predicted protein                                79.3    2e-13   
ref|XP_010035539.1|  PREDICTED: CSC1-like protein At3g21620           79.3    2e-13   
ref|XP_002885454.1|  hypothetical protein ARALYDRAFT_342312           79.3    2e-13   
ref|XP_002264502.1|  PREDICTED: calcium permeable stress-gated ca...  79.3    2e-13   
emb|CDP03600.1|  unnamed protein product                              79.3    2e-13   
gb|AAC79116.1|  hypothetical protein                                  79.3    2e-13   
gb|EPS71959.1|  hypothetical protein M569_02795                       79.3    2e-13   
ref|XP_002874888.1|  hypothetical protein ARALYDRAFT_352535           79.3    2e-13   
ref|XP_004243535.1|  PREDICTED: CSC1-like protein At3g21620           79.3    3e-13   
gb|EYU46618.1|  hypothetical protein MIMGU_mgv1a001779mg              79.3    3e-13   



>ref|XP_009619283.1| PREDICTED: CSC1-like protein RXW8 [Nicotiana tomentosiformis]
Length=719

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 122/151 (81%), Gaps = 3/151 (2%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY +LAY++YRNQILNVYVTKYQTGG YW IVH  TIFS+VL QIIA+ VFGLKKSTVAS
Sbjct  564  VYLSLAYLVYRNQILNVYVTKYQTGGTYWPIVHNTTIFSMVLMQIIAMAVFGLKKSTVAS  623

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
             F  PLII TLLFNEYCRQRF P+ +++PAQIL++MDR+DEQ  +MK+I+QK+TSAY QF
Sbjct  624  SFVIPLIILTLLFNEYCRQRFQPLFKHIPAQILIEMDRQDEQTGKMKEIHQKLTSAYTQF  683

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDDVNPA  275
            + SS+TLG P P N      L++LE  +NP 
Sbjct  684  KSSSLTLGDPVPPN-HNNCRLEDLE--INPG  711



>ref|XP_006356826.1| PREDICTED: uncharacterized protein RSN1-like [Solanum tuberosum]
Length=719

 Score =   209 bits (533),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 120/151 (79%), Gaps = 4/151 (3%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF+LAY++YRNQILNVYVTKYQTGG YW IVH ATIFS+VL Q+IA+ VFGLKKSTVAS
Sbjct  564  VYFSLAYLVYRNQILNVYVTKYQTGGTYWPIVHNATIFSMVLMQVIAMAVFGLKKSTVAS  623

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
             F  PLII TLLFNEYCRQRF P+   +PAQIL++MDR+DEQ  +MK+I+QK+T++Y QF
Sbjct  624  SFVIPLIIMTLLFNEYCRQRFQPLFMQIPAQILIEMDRQDEQNGKMKEIHQKLTTSYTQF  683

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDDVNPA  275
            +  S TLG P P  P     L++LE  +NP 
Sbjct  684  KSKSRTLGDPMP--PNNNCRLEDLE--INPG  710



>ref|XP_010320285.1| PREDICTED: CSC1-like protein RXW8 [Solanum lycopersicum]
Length=719

 Score =   209 bits (532),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 121/153 (79%), Gaps = 4/153 (3%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF+LAY++YRNQILNVYVTKYQTGG YW IVH ATIFS+VL Q+IA+ VFGLKKSTVAS
Sbjct  564  VYFSLAYLVYRNQILNVYVTKYQTGGTYWPIVHNATIFSMVLMQVIAMAVFGLKKSTVAS  623

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
             F  PLII TLLFNEYCRQRF P+   +PAQIL++MDR+DEQ  +MK+I+QK+T++Y QF
Sbjct  624  SFVIPLIIMTLLFNEYCRQRFQPLFMQIPAQILIEMDRQDEQNGKMKEIHQKLTTSYTQF  683

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAAL  269
            +  S TLG P P  P     L++LE  +NP  +
Sbjct  684  KSKSRTLGDPMP--PNNNCRLEDLE--INPGKI  712



>ref|XP_009776500.1| PREDICTED: CSC1-like protein RXW8 isoform X2 [Nicotiana sylvestris]
Length=831

 Score =   209 bits (533),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 124/160 (78%), Gaps = 3/160 (2%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF++AY +YRNQILNVYVTKYQTGG YW IVH  TIFS+VL QIIA  VFG KKS+ AS
Sbjct  476  VYFSIAYFVYRNQILNVYVTKYQTGGTYWPIVHNTTIFSMVLMQIIASAVFGFKKSSTAS  535

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
             FT PLIICTLLFNEYCRQRF P+ +  PAQIL++MDR+DE+  R+K++YQ++TSAYCQF
Sbjct  536  SFTIPLIICTLLFNEYCRQRFEPLFKYTPAQILIEMDRRDEECGRIKEMYQQLTSAYCQF  595

Query  367  RRSSVTLGSPHPLNPKEQSMLQELED--DVNPAALKPDMP  254
            + +S TLG   P + +E   + +++D  D+NP    P +P
Sbjct  596  KSTSPTLGEAVPESDEENMSVHKVQDVEDINPGR-SPHLP  634



>ref|XP_009776499.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Nicotiana sylvestris]
Length=921

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 124/160 (78%), Gaps = 3/160 (2%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF++AY +YRNQILNVYVTKYQTGG YW IVH  TIFS+VL QIIA  VFG KKS+ AS
Sbjct  566  VYFSIAYFVYRNQILNVYVTKYQTGGTYWPIVHNTTIFSMVLMQIIASAVFGFKKSSTAS  625

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
             FT PLIICTLLFNEYCRQRF P+ +  PAQIL++MDR+DE+  R+K++YQ++TSAYCQF
Sbjct  626  SFTIPLIICTLLFNEYCRQRFEPLFKYTPAQILIEMDRRDEECGRIKEMYQQLTSAYCQF  685

Query  367  RRSSVTLGSPHPLNPKEQSMLQELED--DVNPAALKPDMP  254
            + +S TLG   P + +E   + +++D  D+NP    P +P
Sbjct  686  KSTSPTLGEAVPESDEENMSVHKVQDVEDINPGR-SPHLP  724



>ref|XP_009797746.1| PREDICTED: CSC1-like protein RXW8 [Nicotiana sylvestris]
 ref|XP_009797747.1| PREDICTED: CSC1-like protein RXW8 [Nicotiana sylvestris]
 ref|XP_009797748.1| PREDICTED: CSC1-like protein RXW8 [Nicotiana sylvestris]
Length=719

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 124/160 (78%), Gaps = 5/160 (3%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY +LAY++YRNQILNVYVTKYQTGG YW IVH  TIFS+VL QIIA+ VFGLKKSTVAS
Sbjct  564  VYLSLAYLVYRNQILNVYVTKYQTGGTYWPIVHNTTIFSMVLMQIIAMAVFGLKKSTVAS  623

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
             F  PLII TLLFNEYCRQRF P+ +++PAQIL++MDR+DEQ  +MK+I+QK+TSAY QF
Sbjct  624  SFVIPLIILTLLFNEYCRQRFQPLFKHIPAQILIEMDRQDEQNGKMKEIHQKLTSAYTQF  683

Query  367  RRSSVTLGSPHPLNPKEQSMLQELED-DVNPAALKPDMPA  251
            + SS+ LG P P  P   +    LED ++NP  +    P+
Sbjct  684  KSSSLMLGDPVP--PSHNNC--RLEDLEINPGKIPVHHPS  719



>ref|XP_009623866.1| PREDICTED: CSC1-like protein RXW8 [Nicotiana tomentosiformis]
Length=887

 Score =   208 bits (529),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 124/169 (73%), Gaps = 3/169 (2%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF++AY +YRNQILNVYVTKYQTGG YW IVH  TIFS+VL QIIAL VFG KKS+ AS
Sbjct  528  VYFSIAYFVYRNQILNVYVTKYQTGGTYWPIVHNTTIFSMVLMQIIALAVFGFKKSSTAS  587

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
             FT PLIICTLLFNEYCRQRF P+ +  PAQIL+DMDRKDE+  RM +++Q++TSAYCQF
Sbjct  588  SFTIPLIICTLLFNEYCRQRFEPLFKYTPAQILIDMDRKDEECGRMIEMHQQLTSAYCQF  647

Query  367  RRSSVTLGSPHPLNPKEQSMLQELED--DVNPAALKPDMPAGSWNGHTN  227
            + +S T G   P + +E   + ++ D  D+NP    P  P    +  +N
Sbjct  648  KSTSPTPGKAVPESDEENMSIHKVHDVEDINPGK-SPHFPRSCTSFDSN  695



>gb|EYU34204.1| hypothetical protein MIMGU_mgv1a001911mg [Erythranthe guttata]
Length=740

 Score =   201 bits (510),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LA+++YRNQILNVYVT+Y +GGLYW IVH ATIFSLV+TQIIALGVFGLK+S +AS
Sbjct  572  VYFVLAFLVYRNQILNVYVTEYDSGGLYWPIVHNATIFSLVMTQIIALGVFGLKESPIAS  631

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFTFPLII TLLF+EYCRQRFHPV R  PAQ +++MDRKDE   R++DI+ ++ SAYCQF
Sbjct  632  GFTFPLIIFTLLFHEYCRQRFHPVFRKTPAQTVIEMDRKDEHCGRIEDIHAQLQSAYCQF  691

Query  367  RRSSVTLGSPHPLNPKEQSMLQELE  293
            R  S+ L      N  E  +   +E
Sbjct  692  RSKSLNLHKSTEHNKIESVLADSIE  716



>emb|CDP00997.1| unnamed protein product [Coffea canephora]
Length=745

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 128/175 (73%), Gaps = 6/175 (3%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LAY++YRNQILNVYVTKYQTGGLYW  VH ATIFSLVLTQIIA GVFG+KKSTVAS
Sbjct  572  VYFFLAYLVYRNQILNVYVTKYQTGGLYWPTVHNATIFSLVLTQIIASGVFGIKKSTVAS  631

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
             FTFPLII TLLFNEYCRQRF PV +   A++L++MD +DEQ   M++ +QK+ SAYCQ 
Sbjct  632  SFTFPLIILTLLFNEYCRQRFLPVFKRNAAKVLIEMDWQDEQSGIMEETHQKLQSAYCQL  691

Query  367  RRSSVTLGSPHPLNPKE--QSMLQELEDDVNPAALKPDMPAGSWNGHTNLEIEEV  209
              +++   +    +P E   S LQ+LE+  +         +G W GH++ EI+E+
Sbjct  692  TLTTLHQDATLHEHPGETVASGLQDLENLDS----GKTQTSGLWAGHSSPEIKEL  742



>ref|XP_010109429.1| putative membrane protein [Morus notabilis]
 gb|EXC22422.1| putative membrane protein [Morus notabilis]
Length=758

 Score =   196 bits (497),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 122/169 (72%), Gaps = 7/169 (4%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LAY +YRNQILNVYV+KY++GGL+W IVH  TIFSLV  QIIALGVFGL++S V+S
Sbjct  595  VYFVLAYFVYRNQILNVYVSKYESGGLFWPIVHNTTIFSLVFMQIIALGVFGLRRSPVSS  654

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+ICTLLFNEYCRQRFHP+ +N  A++L+DMDR+DE+  +M++IYQ++ SAY QF
Sbjct  655  GFTIPLVICTLLFNEYCRQRFHPIFKNHAAEVLIDMDRRDEESGKMEEIYQQLHSAYYQF  714

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDDV-NPAALKPDMPAGSWNGHTNL  224
                 TL +PH L     S   E  D V +P  +KP       NG   +
Sbjct  715  -----TL-TPHDLFKSGSSSNHEGGDSVRDPENVKPGEEHSQVNGSIKI  757



>gb|EYU26139.1| hypothetical protein MIMGU_mgv1a022719mg, partial [Erythranthe 
guttata]
Length=700

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LA+++YRNQILNVYVT+Y +GGLYW IVH  TIFSLVLTQIIALGVFG+K+S +AS
Sbjct  572  IYFVLAFLVYRNQILNVYVTEYDSGGLYWPIVHNTTIFSLVLTQIIALGVFGIKESPIAS  631

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFTFPLII TLLF+EYCRQRFHP+    PAQI+++MDRKDE   R+ +I+ ++ SAYCQF
Sbjct  632  GFTFPLIIFTLLFHEYCRQRFHPIFVKTPAQIVIEMDRKDENCGRIDEIHMQLQSAYCQF  691

Query  367  RRSSVTL  347
            R  S  L
Sbjct  692  RSKSHNL  698



>ref|XP_010245651.1| PREDICTED: CSC1-like protein RXW8 [Nelumbo nucifera]
Length=505

 Score =   187 bits (475),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 122/182 (67%), Gaps = 26/182 (14%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LAY++YRNQI+NVYV+KY+TGG  W IVH  TIF+LVLTQIIALGVFG+K+S +AS
Sbjct  332  VYFFLAYVVYRNQIVNVYVSKYETGGQIWPIVHNTTIFALVLTQIIALGVFGMKQSPIAS  391

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+ICTLLFNEYCRQRF P+ +   A++L++MDRKDE+  RM++I+Q++ SAYCQF
Sbjct  392  GFTIPLLICTLLFNEYCRQRFGPIFKTFSAEVLIEMDRKDEKCGRMEEIHQQLLSAYCQF  451

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDD-----VNPAALKPDMPAGS--------WNGHTN  227
                        LNP +  +L + ED       N      DM  G         W   ++
Sbjct  452  S-----------LNPND--LLCKAEDSNRSGGANCVHYPEDMKTGKESTQSSKPWAASSS  498

Query  226  LE  221
            LE
Sbjct  499  LE  500



>ref|XP_006342673.1| PREDICTED: transmembrane protein 63B-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006342674.1| PREDICTED: transmembrane protein 63B-like isoform X2 [Solanum 
tuberosum]
Length=955

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 126/174 (72%), Gaps = 6/174 (3%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY+++AY++YRNQILNVYVTKYQTGG YW IVH  TIFS+VL QIIAL VFG KKS+  S
Sbjct  559  VYYSIAYLVYRNQILNVYVTKYQTGGTYWPIVHNTTIFSMVLMQIIALAVFGFKKSSSTS  618

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
             FT PLIICTLLF+EYCRQRF P+ ++ PA IL++MDR+DE   RMK+ YQ++TSAYCQF
Sbjct  619  SFTIPLIICTLLFHEYCRQRFEPLFKDPPAPILIEMDRQDEVHGRMKETYQQLTSAYCQF  678

Query  367  RRSSVTLGSPHPLNPKEQSMLQELED--DVNPAALKPDMPAGSWNGHTNLEIEE  212
            + +  +LG   P N +E   +  ++D  DVNP      +P       T++EI+ 
Sbjct  679  KSTLFSLGKAAPGNDEENMSIHTVQDIQDVNPGKSPSHLPPSC----TSVEIKS  728



>ref|XP_004252733.1| PREDICTED: CSC1-like protein RXW8 [Solanum lycopersicum]
 ref|XP_010314599.1| PREDICTED: CSC1-like protein RXW8 [Solanum lycopersicum]
Length=977

 Score =   189 bits (479),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 126/174 (72%), Gaps = 6/174 (3%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY+++AY++YRNQILNVYVTKYQTGG YW IVH  TIFS+VL QIIAL VFG KKS+  S
Sbjct  565  VYYSIAYLVYRNQILNVYVTKYQTGGTYWPIVHNTTIFSMVLMQIIALAVFGFKKSSSTS  624

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
             FT PLIICTLLF+EYCRQRF P+ ++ PA IL++MDR+DE   RMK++YQ++ SAYCQF
Sbjct  625  SFTIPLIICTLLFHEYCRQRFEPLFKDPPAPILIEMDRQDEVHGRMKEMYQQLQSAYCQF  684

Query  367  RRSSVTLGSPHPLNPKEQSMLQELED--DVNPAALKPDMPAGSWNGHTNLEIEE  212
            + +  +LG   P N +E   +  ++D  DVNP      +P       T++EI+ 
Sbjct  685  KSTLFSLGKAAPGNDEENMSIHTVQDIGDVNPGKSPSHLPPSC----TSVEIKS  734



>ref|XP_007018410.1| Lipases,hydrolases, acting on ester bonds isoform 1 [Theobroma 
cacao]
 gb|EOY15635.1| Lipases,hydrolases, acting on ester bonds isoform 1 [Theobroma 
cacao]
Length=724

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 116/158 (73%), Gaps = 12/158 (8%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LA+++YRNQIL+VYV+KY+ GG +W IVH  TIFSLVLTQIIALGVFG+K+S VAS
Sbjct  567  VYFFLAFLVYRNQILHVYVSKYECGGQFWPIVHNTTIFSLVLTQIIALGVFGIKQSPVAS  626

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI  TLLFNEYCRQRF PV ++ PAQ+L++MDR+DEQ  R ++IY ++ SAYCQF
Sbjct  627  GFTIPLIFFTLLFNEYCRQRFSPVFKSSPAQVLIEMDRQDEQWGRTEEIYSRLRSAYCQF  686

Query  367  ---RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKP  263
                    T+G+ H          ++ E   +P +LKP
Sbjct  687  PLITHDVPTVGNSHQ---------EDQESSQDPESLKP  715



>gb|KDP41570.1| hypothetical protein JCGZ_15977 [Jatropha curcas]
Length=736

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 116/165 (70%), Gaps = 12/165 (7%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF +A+++YRNQILNVY+ KY+ GG +W +VH  TIFSLVL+QIIA+GVFG+K+S +AS
Sbjct  566  VYFFMAFLVYRNQILNVYIPKYEGGGRFWPMVHNTTIFSLVLSQIIAIGVFGIKQSPIAS  625

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
             FTFPL+ICTLLFNEYCRQRF PV      Q+LV+MDR+DE   RM +IYQ++ SAYCQF
Sbjct  626  SFTFPLVICTLLFNEYCRQRFSPVFNKDAVQVLVEMDRRDELSGRMNEIYQQLHSAYCQF  685

Query  367  RRS------------SVTLGSPHPLNPKEQSMLQELEDDVNPAAL  269
              S            SV +  P P++P+  +  +E  +   P A+
Sbjct  686  PVSNHEFCQSVQAHGSVNIEDPGPMDPQGNTRGKESSEVSEPWAV  730



>ref|XP_002302379.1| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE81652.1| early-responsive to dehydration family protein [Populus trichocarpa]
Length=736

 Score =   184 bits (466),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY++YRNQI+NVY+TKY+ GG  W IVH  TIFSLVLTQ+I+LGVFG+KKS VAS
Sbjct  566  IYFLLAYLVYRNQIVNVYITKYEGGGQLWPIVHNTTIFSLVLTQMISLGVFGIKKSPVAS  625

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLIICTLLFNEYCRQRF P+ +   AQ+L++MDR+DEQ  RM++I+Q++ SAYCQ 
Sbjct  626  GFTIPLIICTLLFNEYCRQRFFPIFKKNVAQVLLEMDRRDEQSGRMEEIHQQLHSAYCQL  685

Query  367  RRSS  356
              +S
Sbjct  686  PLTS  689



>ref|XP_011017061.1| PREDICTED: CSC1-like protein RXW8 [Populus euphratica]
 ref|XP_011017062.1| PREDICTED: CSC1-like protein RXW8 [Populus euphratica]
Length=736

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY++YRNQI+NVY+TKY+ GG  W IVH  TIFSLVLTQ+I+LGVFG+KKS VAS
Sbjct  566  IYFLLAYLVYRNQIVNVYITKYEGGGQLWPIVHNTTIFSLVLTQMISLGVFGIKKSPVAS  625

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLIICTLLFNEYCRQRF P+ +   AQ+L++MDR+DEQ  RM +I+Q++ SAYCQ 
Sbjct  626  GFTIPLIICTLLFNEYCRQRFFPIFKKNVAQVLLEMDRRDEQSGRMDEIHQQLHSAYCQL  685

Query  367  RRSS  356
              +S
Sbjct  686  PLTS  689



>ref|XP_011078463.1| PREDICTED: CSC1-like protein RXW8 [Sesamum indicum]
Length=728

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 112/145 (77%), Gaps = 2/145 (1%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LAY++YRNQILNVY+T+Y TGGLYW IVH  TIFSLVLTQIIALGVFG+K+S +AS
Sbjct  571  VYFFLAYLVYRNQILNVYITEYDTGGLYWPIVHNTTIFSLVLTQIIALGVFGIKESPIAS  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
             FT PLII TLLFNEYC QRF P  + +P +I+++MDRKDE  E  ++++QK+ S+YCQF
Sbjct  631  SFTIPLIISTLLFNEYCGQRFLPTFQKIPTKIIIEMDRKDEHCE--EEMHQKLQSSYCQF  688

Query  367  RRSSVTLGSPHPLNPKEQSMLQELE  293
            R  ++ L +    + K QS+L   E
Sbjct  689  RSRNLNLHNTPECSSKPQSVLGSAE  713



>ref|XP_002510037.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52224.1| conserved hypothetical protein [Ricinus communis]
Length=731

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF+LAY++YRNQILNVY+ KY+ GG +W IVH  TIFSLVLTQIIALGVFG+K+S VAS
Sbjct  566  VYFSLAYLVYRNQILNVYIPKYEGGGHFWPIVHNTTIFSLVLTQIIALGVFGIKESPVAS  625

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFTFPL+I TLLFNEYCR RF P+    P +IL++MDR DEQ  RM  IYQ++ SAYCQF
Sbjct  626  GFTFPLVIGTLLFNEYCRLRFSPIFDKDPIKILIEMDRDDEQSGRMDQIYQQLHSAYCQF  685



>ref|NP_001050880.2| Os03g0673800 [Oryza sativa Japonica Group]
 gb|AAR87203.1| expressed protein (with alternative splicing) [Oryza sativa Japonica 
Group]
 dbj|BAF12794.2| Os03g0673800 [Oryza sativa Japonica Group]
 gb|AIU34633.1| hyperosmolality-gated Ca2+ permeable channel 2.2 [Oryza sativa]
Length=494

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQ LNVY TKY TGGLYW I H  TIFS+VLTQII LGVFGLK+S VA+
Sbjct  288  VYFFLGYVVYRNQFLNVYCTKYDTGGLYWPIAHYTTIFSIVLTQIICLGVFGLKESPVAA  347

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLII TLLFN+YC  R  P+ + LPAQ L+DMDR+DEQ  RM DI+ ++ SAYCQF
Sbjct  348  GFTVPLIILTLLFNQYCSNRLRPLFKTLPAQDLIDMDREDEQSGRMDDIHHRLHSAYCQF  407



>gb|ABF98146.1| early-responsive to dehydration protein, putative, expressed 
[Oryza sativa Japonica Group]
Length=480

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQ LNVY TKY TGGLYW I H  TIFS+VLTQII LGVFGLK+S VA+
Sbjct  274  VYFFLGYVVYRNQFLNVYCTKYDTGGLYWPIAHYTTIFSIVLTQIICLGVFGLKESPVAA  333

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLII TLLFN+YC  R  P+ + LPAQ L+DMDR+DEQ  RM DI+ ++ SAYCQF
Sbjct  334  GFTVPLIILTLLFNQYCSNRLRPLFKTLPAQDLIDMDREDEQSGRMDDIHHRLHSAYCQF  393



>gb|KDO53821.1| hypothetical protein CISIN_1g010742mg [Citrus sinensis]
Length=502

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            YF LAY++Y+NQI+NVY T Y++GG +W I H +TI SLVLTQIIALGVFG+K+STVA G
Sbjct  357  YFVLAYLVYKNQIINVYTTDYESGGKFWPIAHNSTIVSLVLTQIIALGVFGIKRSTVAFG  416

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQFR  365
            FT PLI  TLLFNEYCRQRF P    + AQ+L +MDR+DEQ  RM++IYQ++ SAYCQFR
Sbjct  417  FTIPLIFGTLLFNEYCRQRFFPTFTKMSAQVLTEMDRQDEQGGRMEEIYQQLRSAYCQFR  476



>ref|XP_007225157.1| hypothetical protein PRUPE_ppa002376mg [Prunus persica]
 gb|EMJ26356.1| hypothetical protein PRUPE_ppa002376mg [Prunus persica]
Length=679

 Score =   180 bits (457),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 123/167 (74%), Gaps = 9/167 (5%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LAY+IYRNQILNVY+ KY++GG +W ++H   I SL+L QIIALGVFGL+KS +AS
Sbjct  507  VYFVLAYLIYRNQILNVYIPKYESGGEFWPMMHNTVIVSLILMQIIALGVFGLRKSPIAS  566

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+I TLLFNEYCRQRFHP+ RN  ++IL++MD+KDEQ  RM+++Y+++ SAYCQ 
Sbjct  567  GFTIPLLIFTLLFNEYCRQRFHPIFRNHVSEILMEMDKKDEQSGRMEEVYKQLHSAYCQ-  625

Query  367  RRSSVT----LGSPHPLNPKEQSMLQELEDDVNPAALKPDMPAGSWN  239
              S VT      S H  + ++   +Q+ E +VNP   +P+    +W+
Sbjct  626  --SPVTPDDSFNSGHVNHHEDGDSMQDPE-NVNPGK-EPNQVNPTWD  668



>ref|XP_010247468.1| PREDICTED: CSC1-like protein RXW8 isoform X3 [Nelumbo nucifera]
 ref|XP_010247469.1| PREDICTED: CSC1-like protein RXW8 isoform X3 [Nelumbo nucifera]
Length=412

 Score =   176 bits (447),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQI+NVYV+KY+TGG  W IVH  TIFSLVLTQIIALGVFG+K S +AS
Sbjct  246  VYFLLGYVVYRNQIVNVYVSKYETGGQIWPIVHNTTIFSLVLTQIIALGVFGIKHSPIAS  305

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+ICTLLFNEYCR+RF P+ +   A++L++MDR+DE+  R ++I++++ SAYCQF
Sbjct  306  GFTIPLLICTLLFNEYCRKRFGPIFKMFSAEVLIEMDRQDEKCGRTEEIHRQLLSAYCQF  365



>ref|XP_004498938.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Cicer 
arietinum]
Length=775

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 118/164 (72%), Gaps = 3/164 (2%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY++YRNQILNVY+TKY +GG YW I H  T+FSL++ Q+IALGVFGLK+STVAS
Sbjct  568  IYFFLAYLVYRNQILNVYITKYDSGGQYWPIAHNTTVFSLLVAQLIALGVFGLKRSTVAS  627

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+I TLLF++YCRQRF PV R+  AQIL+DMD+KDEQ  +M+ IY+++ SAY Q 
Sbjct  628  GFTIPLLIVTLLFHQYCRQRFLPVFRSHSAQILIDMDKKDEQSGKMEGIYEQIRSAYNQP  687

Query  367  RRSSVTLGSPHPLNPKE-QSMLQELEDDVNPAAL--KPDMPAGS  245
              +          +P+E + ++  + +D+       K D PAGS
Sbjct  688  SLAPHASSQSECSSPQEDKGLVDNISEDIEKGKEIGKQDRPAGS  731



>ref|XP_009397320.1| PREDICTED: CSC1-like protein RXW8 [Musa acuminata subsp. malaccensis]
 ref|XP_009397321.1| PREDICTED: CSC1-like protein RXW8 [Musa acuminata subsp. malaccensis]
Length=753

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQI+NVY ++Y+TGG  W IVH  TIFSLVL QIIALGVFGLK+S VAS
Sbjct  570  VYFLLGYVVYRNQIMNVYCSRYETGGRMWPIVHNTTIFSLVLAQIIALGVFGLKESPVAS  629

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GF  PL+I TLLFNEYCRQRFHP+ RN PAQ L++MD+ DEQ  RM+ I++++ SAY QF
Sbjct  630  GFMIPLVILTLLFNEYCRQRFHPLFRNFPAQDLIEMDKADEQSGRMEQIHEQLLSAYSQF  689



>ref|XP_008220418.1| PREDICTED: uncharacterized membrane protein YLR241W [Prunus mume]
Length=738

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 122/167 (73%), Gaps = 9/167 (5%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LAY+IYRNQILNVY+ KY++GG +W ++H   I SL+L QIIALGVFGL++S +AS
Sbjct  566  VYFVLAYLIYRNQILNVYIPKYESGGQFWPMMHNTVIVSLILMQIIALGVFGLRRSPIAS  625

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+I TLLFNEYCRQRFHP+ RN  ++IL++MDRKDEQ  RM+++Y+++ SAYCQ 
Sbjct  626  GFTIPLLIFTLLFNEYCRQRFHPIFRNHVSEILMEMDRKDEQSGRMEEVYEQLHSAYCQ-  684

Query  367  RRSSVT----LGSPHPLNPKEQSMLQELEDDVNPAALKPDMPAGSWN  239
              S VT      S H  + ++   +Q+ E +VNP   +P     +W+
Sbjct  685  --SPVTPDDSFNSGHVNHHEDGDSIQDPE-NVNPGK-EPSQVNPTWD  727



>gb|KJB14676.1| hypothetical protein B456_002G137000 [Gossypium raimondii]
 gb|KJB14681.1| hypothetical protein B456_002G137000 [Gossypium raimondii]
Length=674

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LA+++YRNQILNVYV KY++GG +W +VH  TIFSLVLTQ+IALGVFG+K+S VAS
Sbjct  510  VYFFLAFLVYRNQILNVYVPKYESGGQFWPVVHNTTIFSLVLTQVIALGVFGIKRSPVAS  569

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI  TLLFNEYCRQRF PV +  PAQ+L++MD++DE   R ++IY+ + +AYCQF
Sbjct  570  GFTIPLIFLTLLFNEYCRQRFSPVFKRSPAQVLIEMDKQDENWGRAEEIYKLLRTAYCQF  629

Query  367  RRSSVTLGSPHPLN  326
               S+ L +   L+
Sbjct  630  PLLSLDLSTSQELS  643



>ref|XP_006432542.1| hypothetical protein CICLE_v10000536mg [Citrus clementina]
 gb|ESR45782.1| hypothetical protein CICLE_v10000536mg [Citrus clementina]
Length=653

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            YF LAY++Y+NQI+NVY T Y++GG +W I H +TI SLVLTQIIALGVFG+K+STVA G
Sbjct  508  YFVLAYLVYKNQIINVYTTDYESGGKFWPIAHNSTIVSLVLTQIIALGVFGIKRSTVAFG  567

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQFR  365
            FT PLI  TLLFNEYCRQRF P    + AQ+L +MDR+DEQ  RM++IYQ++ SAYCQFR
Sbjct  568  FTIPLIFGTLLFNEYCRQRFFPTFTKMSAQVLTEMDRQDEQGGRMEEIYQQLRSAYCQFR  627



>gb|KJB14682.1| hypothetical protein B456_002G137000 [Gossypium raimondii]
Length=690

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LA+++YRNQILNVYV KY++GG +W +VH  TIFSLVLTQ+IALGVFG+K+S VAS
Sbjct  526  VYFFLAFLVYRNQILNVYVPKYESGGQFWPVVHNTTIFSLVLTQVIALGVFGIKRSPVAS  585

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI  TLLFNEYCRQRF PV +  PAQ+L++MD++DE   R ++IY+ + +AYCQF
Sbjct  586  GFTIPLIFLTLLFNEYCRQRFSPVFKRSPAQVLIEMDKQDENWGRAEEIYKLLRTAYCQF  645

Query  367  RRSSVTLGSPHPLN  326
               S+ L +   L+
Sbjct  646  PLLSLDLSTSQELS  659



>ref|XP_006471294.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Citrus 
sinensis]
Length=712

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            YF LAY++Y+NQI+NVY T Y++GG +W I H +TI SLVLTQIIALGVFG+K+STVA G
Sbjct  567  YFVLAYLVYKNQIINVYTTDYESGGKFWPIAHNSTIVSLVLTQIIALGVFGIKRSTVAFG  626

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQFR  365
            FT PLI  TLLFNEYCRQRF P    + AQ+L +MDR+DEQ  RM++IYQ++ SAYCQFR
Sbjct  627  FTIPLIFGTLLFNEYCRQRFFPTFTKMSAQVLTEMDRQDEQGGRMEEIYQQLRSAYCQFR  686



>gb|KJB14680.1| hypothetical protein B456_002G137000 [Gossypium raimondii]
Length=700

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LA+++YRNQILNVYV KY++GG +W +VH  TIFSLVLTQ+IALGVFG+K+S VAS
Sbjct  536  VYFFLAFLVYRNQILNVYVPKYESGGQFWPVVHNTTIFSLVLTQVIALGVFGIKRSPVAS  595

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI  TLLFNEYCRQRF PV +  PAQ+L++MD++DE   R ++IY+ + +AYCQF
Sbjct  596  GFTIPLIFLTLLFNEYCRQRFSPVFKRSPAQVLIEMDKQDENWGRAEEIYKLLRTAYCQF  655

Query  367  RRSSVTLGSPHPLN  326
               S+ L +   L+
Sbjct  656  PLLSLDLSTSQELS  669



>gb|KJB14674.1| hypothetical protein B456_002G137000 [Gossypium raimondii]
 gb|KJB14677.1| hypothetical protein B456_002G137000 [Gossypium raimondii]
 gb|KJB14678.1| hypothetical protein B456_002G137000 [Gossypium raimondii]
 gb|KJB14679.1| hypothetical protein B456_002G137000 [Gossypium raimondii]
Length=792

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LA+++YRNQILNVYV KY++GG +W +VH  TIFSLVLTQ+IALGVFG+K+S VAS
Sbjct  628  VYFFLAFLVYRNQILNVYVPKYESGGQFWPVVHNTTIFSLVLTQVIALGVFGIKRSPVAS  687

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI  TLLFNEYCRQRF PV +  PAQ+L++MD++DE   R ++IY+ + +AYCQF
Sbjct  688  GFTIPLIFLTLLFNEYCRQRFSPVFKRSPAQVLIEMDKQDENWGRAEEIYKLLRTAYCQF  747

Query  367  RRSSVTLGSPHPLN  326
               S+ L +   L+
Sbjct  748  PLLSLDLSTSQELS  761



>ref|XP_006650401.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X3 [Oryza brachyantha]
Length=709

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQ LNVY TKY TGGLYW I H  TIFS+VLTQII LGVFGLKKS VA+
Sbjct  501  VYFFLGYVVYRNQFLNVYCTKYDTGGLYWPIAHNTTIFSIVLTQIICLGVFGLKKSPVAA  560

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLII TLLFN+YC  R  P+ + LPAQ L+DMDR+DEQ  RM+DI+  + SAYCQF
Sbjct  561  GFTVPLIILTLLFNQYCSNRLLPLFKTLPAQDLIDMDREDEQSGRMEDIHHCLHSAYCQF  620



>gb|AAR87202.1| expressed protein (with alternative splicing) [Oryza sativa Japonica 
Group]
 gb|EEE59670.1| hypothetical protein OsJ_12072 [Oryza sativa Japonica Group]
Length=777

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQ LNVY TKY TGGLYW I H  TIFS+VLTQII LGVFGLK+S VA+
Sbjct  571  VYFFLGYVVYRNQFLNVYCTKYDTGGLYWPIAHYTTIFSIVLTQIICLGVFGLKESPVAA  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLII TLLFN+YC  R  P+ + LPAQ L+DMDR+DEQ  RM DI+ ++ SAYCQF
Sbjct  631  GFTVPLIILTLLFNQYCSNRLRPLFKTLPAQDLIDMDREDEQSGRMDDIHHRLHSAYCQF  690



>gb|KHG29773.1| Membrane protein [Gossypium arboreum]
Length=792

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LA+++YRNQILNVYV KY++GG +W +VH  TIFSLVLTQ+IALGVFG+K+S VAS
Sbjct  628  VYFFLAFLVYRNQILNVYVPKYESGGQFWPVVHNTTIFSLVLTQVIALGVFGIKRSPVAS  687

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI  TLLFNEYCRQRF PV +  PAQ+L++MD++DE   R ++IY+ + +AYCQF
Sbjct  688  GFTIPLIFLTLLFNEYCRQRFSPVFKRSPAQVLIEMDKQDENWGRAEEIYKLLRTAYCQF  747

Query  367  RRSSVTLGSPHPLN  326
               S+ L +   L+
Sbjct  748  PLLSLDLSTSQELS  761



>ref|XP_006650400.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X2 [Oryza brachyantha]
Length=730

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQ LNVY TKY TGGLYW I H  TIFS+VLTQII LGVFGLKKS VA+
Sbjct  522  VYFFLGYVVYRNQFLNVYCTKYDTGGLYWPIAHNTTIFSIVLTQIICLGVFGLKKSPVAA  581

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLII TLLFN+YC  R  P+ + LPAQ L+DMDR+DEQ  RM+DI+  + SAYCQF
Sbjct  582  GFTVPLIILTLLFNQYCSNRLLPLFKTLPAQDLIDMDREDEQSGRMEDIHHCLHSAYCQF  641



>gb|KJB14675.1| hypothetical protein B456_002G137000 [Gossypium raimondii]
Length=808

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LA+++YRNQILNVYV KY++GG +W +VH  TIFSLVLTQ+IALGVFG+K+S VAS
Sbjct  628  VYFFLAFLVYRNQILNVYVPKYESGGQFWPVVHNTTIFSLVLTQVIALGVFGIKRSPVAS  687

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI  TLLFNEYCRQRF PV +  PAQ+L++MD++DE   R ++IY+ + +AYCQF
Sbjct  688  GFTIPLIFLTLLFNEYCRQRFSPVFKRSPAQVLIEMDKQDENWGRAEEIYKLLRTAYCQF  747

Query  367  RRSSVTLGSPHPLN  326
               S+ L +   L+
Sbjct  748  PLLSLDLSTSQELS  761



>gb|EEC75908.1| hypothetical protein OsI_12978 [Oryza sativa Indica Group]
Length=777

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQ LNVY TKY TGGLYW I H  TIFS+VLTQII LGVFGLK+S VA+
Sbjct  571  VYFFLGYVVYRNQFLNVYCTKYDTGGLYWPIAHYTTIFSIVLTQIICLGVFGLKESPVAA  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLII TLLFN+YC  R  P+ + LPAQ L+DMDR+DEQ  RM DI+ ++ SAYCQF
Sbjct  631  GFTVPLIILTLLFNQYCSNRLRPLFKTLPAQDLIDMDREDEQSGRMDDIHHRLHSAYCQF  690



>ref|XP_006650399.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X1 [Oryza brachyantha]
Length=779

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQ LNVY TKY TGGLYW I H  TIFS+VLTQII LGVFGLKKS VA+
Sbjct  571  VYFFLGYVVYRNQFLNVYCTKYDTGGLYWPIAHNTTIFSIVLTQIICLGVFGLKKSPVAA  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLII TLLFN+YC  R  P+ + LPAQ L+DMDR+DEQ  RM+DI+  + SAYCQF
Sbjct  631  GFTVPLIILTLLFNQYCSNRLLPLFKTLPAQDLIDMDREDEQSGRMEDIHHCLHSAYCQF  690



>ref|XP_010247466.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Nelumbo nucifera]
Length=516

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQI+NVYV+KY+TGG  W IVH  TIFSLVLTQIIALGVFG+K S +AS
Sbjct  350  VYFLLGYVVYRNQIVNVYVSKYETGGQIWPIVHNTTIFSLVLTQIIALGVFGIKHSPIAS  409

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+ICTLLFNEYCR+RF P+ +   A++L++MDR+DE+  R ++I++++ SAYCQF
Sbjct  410  GFTIPLLICTLLFNEYCRKRFGPIFKMFSAEVLIEMDRQDEKCGRTEEIHRQLLSAYCQF  469



>ref|XP_010247467.1| PREDICTED: CSC1-like protein RXW8 isoform X2 [Nelumbo nucifera]
Length=507

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQI+NVYV+KY+TGG  W IVH  TIFSLVLTQIIALGVFG+K S +AS
Sbjct  350  VYFLLGYVVYRNQIVNVYVSKYETGGQIWPIVHNTTIFSLVLTQIIALGVFGIKHSPIAS  409

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+ICTLLFNEYCR+RF P+ +   A++L++MDR+DE+  R ++I++++ SAYCQF
Sbjct  410  GFTIPLLICTLLFNEYCRKRFGPIFKMFSAEVLIEMDRQDEKCGRTEEIHRQLLSAYCQF  469



>ref|XP_009337130.1| PREDICTED: CSC1-like protein RXW8 isoform X2 [Pyrus x bretschneideri]
Length=737

 Score =   178 bits (451),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 114/173 (66%), Gaps = 21/173 (12%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LAY IYRNQILNVY+ +Y++GG YW ++H   I SLV+ QIIALGVFGL+KS +AS
Sbjct  566  VYFVLAYFIYRNQILNVYIAEYESGGQYWPMIHNTVIISLVIMQIIALGVFGLRKSPIAS  625

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+I T+LFNEYCRQ+FHP+ +N  A+IL+DMD+KDE+  RM+++YQ++ +AYCQ 
Sbjct  626  GFTIPLLIFTILFNEYCRQQFHPLFKNQVAEILIDMDQKDEEAGRMEEVYQQLHTAYCQ-  684

Query  367  RRSSVTLGSPHPLNPKEQSML---QELEDDVN-------PAALKPDMPAGSWN  239
                       PL P           +E D+N       P   +P     SWN
Sbjct  685  ----------SPLTPDVSCSFGCSTRIEGDINPDPENVKPPGEEPSQTNPSWN  727



>ref|XP_009337128.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009337129.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Pyrus x bretschneideri]
Length=764

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 109/153 (71%), Gaps = 14/153 (9%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LAY IYRNQILNVY+ +Y++GG YW ++H   I SLV+ QIIALGVFGL+KS +AS
Sbjct  566  VYFVLAYFIYRNQILNVYIAEYESGGQYWPMIHNTVIISLVIMQIIALGVFGLRKSPIAS  625

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+I T+LFNEYCRQ+FHP+ +N  A+IL+DMD+KDE+  RM+++YQ++ +AYCQ 
Sbjct  626  GFTIPLLIFTILFNEYCRQQFHPLFKNQVAEILIDMDQKDEEAGRMEEVYQQLHTAYCQ-  684

Query  367  RRSSVTLGSPHPLNPKEQSML---QELEDDVNP  278
                       PL P           +E D+NP
Sbjct  685  ----------SPLTPDVSCSFGCSTRIEGDINP  707



>ref|XP_011458884.1| PREDICTED: CSC1-like protein RXW8 [Fragaria vesca subsp. vesca]
Length=742

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 119/163 (73%), Gaps = 2/163 (1%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY IYRNQI+NVY+TKYQ+GG  W  VH   IFSL++ QIIALGVFGL+KS V+S
Sbjct  571  IYFTLAYFIYRNQIINVYITKYQSGGHLWPTVHNTVIFSLIMMQIIALGVFGLRKSPVSS  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFTFPL+I TLLFN+YC+QRFHPV +N  A+IL++MDR+DE+  R ++I+Q++ +AYCQ 
Sbjct  631  GFTFPLVIFTLLFNQYCQQRFHPVFKNHVAEILIEMDREDEKYGRTEEIHQQLHAAYCQS  690

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPDMPAGSWN  239
              +S         + +E+  +Q+ E +V P   +P   + +W+
Sbjct  691  PSTSPDTSMAGSYHHQEEESIQDPE-NVTPGK-EPSQVSLNWS  731



>ref|NP_001067352.1| Os12g0633600 [Oryza sativa Japonica Group]
 gb|ABA99948.1| early-responsive to dehydration protein, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF30371.1| Os12g0633600 [Oryza sativa Japonica Group]
 dbj|BAG96127.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70433.1| hypothetical protein OsI_01443 [Oryza sativa Indica Group]
 gb|EEE65270.1| hypothetical protein OsJ_20480 [Oryza sativa Japonica Group]
 gb|AIU34632.1| hyperosmolality-gated Ca2+ permeable channel 2.1 [Oryza sativa]
Length=763

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L YI+YRNQ+LNVY T+Y TGGLYW I H A IFSLVLTQII LGVFGLK+S VA+
Sbjct  571  VYFFLGYIVYRNQLLNVYRTRYDTGGLYWPIAHNAVIFSLVLTQIICLGVFGLKESPVAA  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLII TLLFN+YCR R  P+ R  PAQ L+DMDR+DE+  RM +I+ ++ SAYCQF
Sbjct  631  GFTIPLIILTLLFNQYCRNRLLPLFRTTPAQDLIDMDREDERSGRMDEIHHRLHSAYCQF  690



>ref|XP_010664475.1| PREDICTED: CSC1-like protein RXW8 isoform X3 [Vitis vinifera]
Length=546

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 113/156 (72%), Gaps = 7/156 (4%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LAY++YRNQI+NVY++KY++GG +W IVH  TIFSLVL QIIA+GVFGLK+S V S
Sbjct  387  VYFFLAYLVYRNQIINVYISKYESGGKFWPIVHNTTIFSLVLAQIIAIGVFGLKRSPVPS  446

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+I TLLFNEYCRQRF P+  N  A +L++MDR+DE+  RM+ I+ ++ SAY Q 
Sbjct  447  GFTIPLVIGTLLFNEYCRQRFRPIFENHAATVLIEMDRQDERNGRMEQIHHQLHSAYHQP  506

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDDV-NPAALKP  263
            +R+S         +  E+S   E  D + +P  LKP
Sbjct  507  KRTS------QDSSKGERSNHSEDGDSIQDPEDLKP  536



>ref|XP_006433681.1| hypothetical protein CICLE_v10000392mg [Citrus clementina]
 gb|ESR46921.1| hypothetical protein CICLE_v10000392mg [Citrus clementina]
Length=742

 Score =   176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY++Y+NQI+NVY   Y+ GG YW I HK  I SLVLTQIIALG+FG+KKS VAS
Sbjct  566  IYFVLAYLVYKNQIINVYEKSYENGGQYWPIAHKTIIASLVLTQIIALGIFGIKKSPVAS  625

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLFNEYCRQRF P  + + AQ+L  MD++DEQ  RM++IYQ++ SAYCQF
Sbjct  626  GFTIPLIVGTLLFNEYCRQRFFPSFQKIAAQVLTQMDQQDEQGGRMEEIYQQLKSAYCQF  685

Query  367  RRSSVTL  347
            R  S+ L
Sbjct  686  RLISLDL  692



>emb|CBI19350.3| unnamed protein product [Vitis vinifera]
Length=722

 Score =   175 bits (443),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 113/156 (72%), Gaps = 7/156 (4%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LAY++YRNQI+NVY++KY++GG +W IVH  TIFSLVL QIIA+GVFGLK+S V S
Sbjct  563  VYFFLAYLVYRNQIINVYISKYESGGKFWPIVHNTTIFSLVLAQIIAIGVFGLKRSPVPS  622

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+I TLLFNEYCRQRF P+  N  A +L++MDR+DE+  RM+ I+ ++ SAY Q 
Sbjct  623  GFTIPLVIGTLLFNEYCRQRFRPIFENHAATVLIEMDRQDERNGRMEQIHHQLHSAYHQP  682

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDDV-NPAALKP  263
            +R+S         +  E+S   E  D + +P  LKP
Sbjct  683  KRTS------QDSSKGERSNHSEDGDSIQDPEDLKP  712



>ref|XP_010664474.1| PREDICTED: CSC1-like protein RXW8 isoform X2 [Vitis vinifera]
Length=664

 Score =   174 bits (442),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 113/156 (72%), Gaps = 7/156 (4%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LAY++YRNQI+NVY++KY++GG +W IVH  TIFSLVL QIIA+GVFGLK+S V S
Sbjct  505  VYFFLAYLVYRNQIINVYISKYESGGKFWPIVHNTTIFSLVLAQIIAIGVFGLKRSPVPS  564

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+I TLLFNEYCRQRF P+  N  A +L++MDR+DE+  RM+ I+ ++ SAY Q 
Sbjct  565  GFTIPLVIGTLLFNEYCRQRFRPIFENHAATVLIEMDRQDERNGRMEQIHHQLHSAYHQP  624

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDDV-NPAALKP  263
            +R+S         +  E+S   E  D + +P  LKP
Sbjct  625  KRTS------QDSSKGERSNHSEDGDSIQDPEDLKP  654



>ref|XP_010061607.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Eucalyptus grandis]
 ref|XP_010061608.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Eucalyptus grandis]
Length=743

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 105/147 (71%), Gaps = 8/147 (5%)
 Frame = -2

Query  703  IYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASGFTFPLII  524
            +YRNQILNVY  KY+TGG  W  VH  TIFSLVL QIIALGVFGLK+S VASGFT PLII
Sbjct  576  VYRNQILNVYSPKYETGGQLWPTVHNTTIFSLVLMQIIALGVFGLKRSPVASGFTIPLII  635

Query  523  CTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQFRRSSVTLG  344
            C+LLFNEYCRQRFHP+ +N  AQ+L+DMDR+ EQ   M++I++++ SAYCQF+       
Sbjct  636  CSLLFNEYCRQRFHPIFKNSAAQMLIDMDRQYEQSGSMEEIHRQLRSAYCQFK-------  688

Query  343  SPHPLNPKEQSMLQELEDDVNPAALKP  263
            S H         +Q+ ED+  P  + P
Sbjct  689  SGHSDQSDNGKSIQDSEDE-KPGLIHP  714



>ref|XP_002283520.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Vitis vinifera]
Length=717

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 113/156 (72%), Gaps = 7/156 (4%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LAY++YRNQI+NVY++KY++GG +W IVH  TIFSLVL QIIA+GVFGLK+S V S
Sbjct  558  VYFFLAYLVYRNQIINVYISKYESGGKFWPIVHNTTIFSLVLAQIIAIGVFGLKRSPVPS  617

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+I TLLFNEYCRQRF P+  N  A +L++MDR+DE+  RM+ I+ ++ SAY Q 
Sbjct  618  GFTIPLVIGTLLFNEYCRQRFRPIFENHAATVLIEMDRQDERNGRMEQIHHQLHSAYHQP  677

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDDV-NPAALKP  263
            +R+S         +  E+S   E  D + +P  LKP
Sbjct  678  KRTS------QDSSKGERSNHSEDGDSIQDPEDLKP  707



>ref|XP_010670325.1| PREDICTED: CSC1-like protein RXW8 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670326.1| PREDICTED: CSC1-like protein RXW8 [Beta vulgaris subsp. vulgaris]
Length=747

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 118/180 (66%), Gaps = 10/180 (6%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LAY++YRNQI+NVY+T+Y +GG YW IV  +TIFSLVL QIIA+GVF LK+STV  
Sbjct  566  VYFCLAYLVYRNQIINVYITEYDSGGKYWPIVQTSTIFSLVLAQIIAMGVFVLKRSTVCF  625

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL ICTLLFNEYCR+RF PV  N+ A++L+D+D++DEQ  RM+ IYQ++ +AY QF
Sbjct  626  GFTIPLAICTLLFNEYCRRRFFPVYGNIAAEVLIDLDQQDEQSGRMEAIYQRLQTAYSQF  685

Query  367  --------RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPDMPAGSWNGHTNLEIEE  212
                    RR S  L          Q +  + E + +   +  +    SW  + N E+E 
Sbjct  686  EWLTYGRSRRKSQYLSDDEDTLRHTQEL--KTESEFSQEIIVDESVGKSWPTNHNAEVES  743



>gb|KHN36998.1| Putative membrane protein [Glycine soja]
Length=680

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 118/163 (72%), Gaps = 8/163 (5%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF +AY++YRNQI+NVY+TKY +GG +W IVH  T+FSL+ +Q+IALGVFGLK+S+VAS
Sbjct  498  VYFFIAYLVYRNQIINVYITKYDSGGQFWPIVHNTTVFSLLFSQLIALGVFGLKRSSVAS  557

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+I TLLF++YCRQRF PV R+  AQIL+D+DR+D    RM++IY+ + SAY Q 
Sbjct  558  GFTIPLLIGTLLFHQYCRQRFLPVFRSNSAQILIDLDRRDGHSGRMEEIYEHLRSAYNQ-  616

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPDMPAGSWN  239
              SS+    PH  +  E   L E + D  P++   DM  G+ N
Sbjct  617  --SSLM---PHTTSQPECVSLHE-DKDSGPSS-SEDMETGNEN  652



>ref|XP_008790275.1| PREDICTED: CSC1-like protein RXW8 [Phoenix dactylifera]
Length=733

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 112/166 (67%), Gaps = 3/166 (2%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQI+NVY +KY++GG  W IVH   IFSLVLTQIIALGVFG+K+  VAS
Sbjct  571  VYFFLGYVVYRNQIMNVYCSKYESGGQMWPIVHNTAIFSLVLTQIIALGVFGMKRYPVAS  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+I T+LFNEYCRQRF+P+  N+ AQ L+ MDR DEQ +RM++I+Q + +AYCQ 
Sbjct  631  GFTIPLVIATILFNEYCRQRFYPMFNNISAQDLIQMDRDDEQSDRMEEIHQLLLTAYCQ-  689

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPDMPAGSWNGHT  230
              S+    S    +    S+ +    D +   +    P  +W+  T
Sbjct  690  --SAPPASSQDTCDDDGSSINEANRTDFSQEIIDSITPHQTWDCRT  733



>ref|XP_003575997.1| PREDICTED: CSC1-like protein RXW8 [Brachypodium distachyon]
 ref|XP_010236974.1| PREDICTED: CSC1-like protein RXW8 [Brachypodium distachyon]
Length=764

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQ+LNVY T+Y TGGLYW I H   IFSLVLTQII LGVFGLK+S VA+
Sbjct  571  VYFFLGYVVYRNQLLNVYRTRYDTGGLYWPIAHNTVIFSLVLTQIICLGVFGLKESPVAA  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLII TLLFN+YCR+R  P+ +  PAQ L+DMDR+DE+  RM+ I+ ++ SAYCQF
Sbjct  631  GFTIPLIILTLLFNQYCRKRLLPLFKTFPAQDLIDMDREDERSGRMEHIHHRLHSAYCQF  690



>ref|XP_010061609.1| PREDICTED: CSC1-like protein RXW8 isoform X2 [Eucalyptus grandis]
 gb|KCW68599.1| hypothetical protein EUGRSUZ_F02209 [Eucalyptus grandis]
Length=734

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 102/139 (73%), Gaps = 7/139 (5%)
 Frame = -2

Query  703  IYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASGFTFPLII  524
            +YRNQILNVY  KY+TGG  W  VH  TIFSLVL QIIALGVFGLK+S VASGFT PLII
Sbjct  576  VYRNQILNVYSPKYETGGQLWPTVHNTTIFSLVLMQIIALGVFGLKRSPVASGFTIPLII  635

Query  523  CTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQFRRSSVTLG  344
            C+LLFNEYCRQRFHP+ +N  AQ+L+DMDR+ EQ   M++I++++ SAYCQF+       
Sbjct  636  CSLLFNEYCRQRFHPIFKNSAAQMLIDMDRQYEQSGSMEEIHRQLRSAYCQFK-------  688

Query  343  SPHPLNPKEQSMLQELEDD  287
            S H         +Q+ ED+
Sbjct  689  SGHSDQSDNGKSIQDSEDE  707



>ref|XP_008377944.1| PREDICTED: uncharacterized protein LOC103441021 [Malus domestica]
Length=873

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LAY IYRNQILNVY+ +Y++GG YW ++H   I SLV+ QIIALGVFGL+KS +AS
Sbjct  673  VYFVLAYFIYRNQILNVYIAEYESGGQYWPMIHNTVIISLVIMQIIALGVFGLRKSPIAS  732

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ  371
            GFT PL+I T+LFNEYCRQ+FHP+ +N  A+IL+DMD+KDE+  RM+++YQ++ +AYCQ
Sbjct  733  GFTIPLLIFTILFNEYCRQQFHPLFKNQVAEILIDMDQKDEEAGRMEEVYQQLHTAYCQ  791



>gb|KDO81403.1| hypothetical protein CISIN_1g039780mg [Citrus sinensis]
Length=701

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY++Y+NQI+NVY   Y++GG YW I HK  I SLVLTQIIALG+FG+KKS VAS
Sbjct  539  IYFVLAYLVYKNQIINVYKKSYESGGQYWPIAHKTIIASLVLTQIIALGIFGIKKSPVAS  598

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLFNEYCRQRF P  + + AQ+L  MD++DEQ  RM++IYQ++  AYCQF
Sbjct  599  GFTIPLIVGTLLFNEYCRQRFFPSFQKIAAQVLTQMDQQDEQGGRMEEIYQQLKFAYCQF  658

Query  367  RRSSVTL  347
            R  S+ L
Sbjct  659  RLISLDL  665



>ref|XP_006664233.1| PREDICTED: uncharacterized protein RSN1-like [Oryza brachyantha]
Length=764

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQ+LNVY T+Y TGGLYW I H   IFSLVLTQII LGVFGLK+S VA+
Sbjct  571  VYFFLGYVVYRNQLLNVYRTRYDTGGLYWPIAHNTVIFSLVLTQIICLGVFGLKESPVAA  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLII TLLFN+YCR R  P+ +  PAQ L+DMDR+DE+  RM +I++++ SAYCQF
Sbjct  631  GFTVPLIILTLLFNQYCRNRLLPLFKTSPAQDLIDMDREDERSGRMDEIHRRLHSAYCQF  690

Query  367  RRS  359
              S
Sbjct  691  HDS  693



>ref|XP_006472346.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X1 [Citrus sinensis]
 ref|XP_006472347.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X2 [Citrus sinensis]
Length=742

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY++Y+NQI+NVY   Y++GG YW I HK  I SLVLTQIIALG+FG+KKS VAS
Sbjct  566  IYFVLAYLVYKNQIINVYKKSYESGGQYWPIAHKTIIASLVLTQIIALGIFGIKKSPVAS  625

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLFNEYCRQRF P  + + AQ+L  MD++DEQ  RM++IYQ++  AYCQF
Sbjct  626  GFTIPLIVGTLLFNEYCRQRFFPSFQKIAAQVLTQMDQQDEQGGRMEEIYQQLKFAYCQF  685

Query  367  RRSSVTL  347
            R  S+ L
Sbjct  686  RLISLDL  692



>ref|XP_003556958.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Glycine 
max]
Length=750

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 118/163 (72%), Gaps = 8/163 (5%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF +AY++YRNQI+NVY+TKY +GG +W IVH  T+FSL+ +Q+IALGVFGLK+S+VAS
Sbjct  568  VYFFIAYLVYRNQIINVYITKYDSGGQFWPIVHNTTVFSLLFSQLIALGVFGLKRSSVAS  627

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+I TLLF++YCRQRF PV R+  AQIL+D+DR+D    RM++IY+ + SAY Q 
Sbjct  628  GFTIPLLIGTLLFHQYCRQRFLPVFRSNSAQILIDLDRRDGHSGRMEEIYEHLRSAYNQ-  686

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPDMPAGSWN  239
              SS+    PH  +  E   L E + D  P++   DM  G+ N
Sbjct  687  --SSLM---PHTTSQPECVSLHE-DKDSGPSS-SEDMETGNEN  722



>ref|XP_004963302.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Setaria 
italica]
 ref|XP_004963303.1| PREDICTED: uncharacterized protein RSN1-like isoform X2 [Setaria 
italica]
 ref|XP_004963304.1| PREDICTED: uncharacterized protein RSN1-like isoform X3 [Setaria 
italica]
Length=763

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQ+LNVY T+Y TGGLYW I H   IFSLVLTQ+I LGVFGLK+S VA+
Sbjct  571  VYFFLGYVVYRNQLLNVYRTRYDTGGLYWPIAHNTVIFSLVLTQVIGLGVFGLKESPVAA  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLII TLLFN+YCR R  P+ R  PAQ L+DMDR+DE+  R+ +I+ ++ SAYCQF
Sbjct  631  GFTIPLIILTLLFNQYCRNRLLPLFRTFPAQDLIDMDREDERSGRIDEIHHRLHSAYCQF  690



>ref|XP_008444514.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Cucumis melo]
Length=656

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 113/149 (76%), Gaps = 6/149 (4%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            YF LAY++Y+NQILNVY++KY++GG +W I H  TIF++V+ QIIALGVFG+K+S VASG
Sbjct  482  YFFLAYLVYKNQILNVYISKYESGGQFWPIAHNTTIFAMVVAQIIALGVFGVKESPVASG  541

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF-  368
            FT PLI+ TLLF+ YCRQRF P+ R+  A++L++MDRKDE+  RM+++YQ++ +AYCQF 
Sbjct  542  FTIPLIVGTLLFHGYCRQRFRPIFRDPAAEVLIEMDRKDEECGRMEEMYQQLRTAYCQFT  601

Query  367  ---RRSSVTLGSPHPLNPKEQSMLQELED  290
               +R++ T G         +S + ELE 
Sbjct  602  LLAKRNTSTSGCSS--GHDSESNVTELES  628



>gb|KHN17195.1| Putative membrane protein [Glycine soja]
Length=701

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 118/161 (73%), Gaps = 8/161 (5%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF +AY++YRNQI+NVY+TKY +GG YW IVH  T+FSL+ +Q+IALGVFGLK+S+V S
Sbjct  519  IYFFIAYLVYRNQIINVYITKYDSGGQYWPIVHNTTVFSLLFSQLIALGVFGLKRSSVTS  578

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+I TLLF++YCRQRF PV RN  AQIL+D+DR+DE   R+++IY+ + SAY Q 
Sbjct  579  GFTIPLLIGTLLFHQYCRQRFLPVFRNNSAQILIDLDRRDEHCGRVEEIYEHLCSAYNQ-  637

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPDMPAGS  245
              SS+    PH  +  +   L E + D +P++   DM  G+
Sbjct  638  --SSLM---PHSTSQAKCVSLHE-DKDSSPSS-SEDMEKGN  671



>ref|XP_008444513.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Cucumis melo]
Length=742

 Score =   172 bits (437),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 113/149 (76%), Gaps = 6/149 (4%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            YF LAY++Y+NQILNVY++KY++GG +W I H  TIF++V+ QIIALGVFG+K+S VASG
Sbjct  568  YFFLAYLVYKNQILNVYISKYESGGQFWPIAHNTTIFAMVVAQIIALGVFGVKESPVASG  627

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF-  368
            FT PLI+ TLLF+ YCRQRF P+ R+  A++L++MDRKDE+  RM+++YQ++ +AYCQF 
Sbjct  628  FTIPLIVGTLLFHGYCRQRFRPIFRDPAAEVLIEMDRKDEECGRMEEMYQQLRTAYCQFT  687

Query  367  ---RRSSVTLGSPHPLNPKEQSMLQELED  290
               +R++ T G         +S + ELE 
Sbjct  688  LLAKRNTSTSGCSS--GHDSESNVTELES  714



>ref|XP_003545361.2| PREDICTED: uncharacterized membrane protein C24H6.13-like [Glycine 
max]
Length=750

 Score =   172 bits (437),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 118/161 (73%), Gaps = 8/161 (5%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF +AY++YRNQI+NVY+TKY +GG YW IVH  T+FSL+ +Q+IALGVFGLK+S+V S
Sbjct  568  IYFFIAYLVYRNQIINVYITKYDSGGQYWPIVHNTTVFSLLFSQLIALGVFGLKRSSVTS  627

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+I TLLF++YCRQRF PV RN  AQIL+D+DR+DE   R+++IY+ + SAY Q 
Sbjct  628  GFTIPLLIGTLLFHQYCRQRFLPVFRNNSAQILIDLDRRDEHCGRVEEIYEHLCSAYNQ-  686

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPDMPAGS  245
              SS+    PH  +  +   L E + D +P++   DM  G+
Sbjct  687  --SSLM---PHSTSQAKCVSLHE-DKDSSPSS-SEDMEKGN  720



>ref|XP_010943516.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Elaeis guineensis]
Length=755

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQILNVY  KY+TGGL W  +H  T+FSLVL QIIALGVFG+K+S+VA+
Sbjct  572  VYFLLGYVVYRNQILNVYCAKYETGGLMWPTMHNTTVFSLVLAQIIALGVFGIKESSVAA  631

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT  L+I TLLFNEYCRQRFHP+  +  AQ L++MD +DEQ  RM++I++++  AYCQF
Sbjct  632  GFTIVLVILTLLFNEYCRQRFHPIFESFSAQDLIEMDTEDEQSRRMEEIHRQLHPAYCQF  691



>ref|XP_008674130.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Zea mays]
Length=604

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQ+LNVY T+Y TGGLYW I +   IFSLVLTQII LGVFGLK+S VA+
Sbjct  408  VYFCLGYVVYRNQLLNVYRTRYDTGGLYWPIAYNTVIFSLVLTQIICLGVFGLKESPVAA  467

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLII TLLFN+YCR R  P+ +  PAQ L+DMDR+DE+  RM +I+  + SAYCQF
Sbjct  468  GFTVPLIILTLLFNQYCRNRLLPLFKTFPAQDLIDMDREDERSGRMDEIHHGLHSAYCQF  527



>ref|XP_008798903.1| PREDICTED: CSC1-like protein RXW8 isoform X2 [Phoenix dactylifera]
Length=752

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y +YRNQ+LNVY +KY+TGGL W  +H  T+FSLVL QIIALGVFG+K+S+VAS
Sbjct  569  VYFLLGYAVYRNQLLNVYCSKYETGGLLWPTMHNTTVFSLVLAQIIALGVFGIKESSVAS  628

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT  L+I TLLFNEYCRQRFHPV ++  AQ L++MD +DEQ  RM++I Q++  AYCQF
Sbjct  629  GFTVVLVILTLLFNEYCRQRFHPVFKSFSAQDLIEMDIEDEQSGRMEEIQQQLHPAYCQF  688



>ref|XP_008798900.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Phoenix dactylifera]
 ref|XP_008798901.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Phoenix dactylifera]
 ref|XP_008798902.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Phoenix dactylifera]
Length=755

 Score =   171 bits (433),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y +YRNQ+LNVY +KY+TGGL W  +H  T+FSLVL QIIALGVFG+K+S+VAS
Sbjct  572  VYFLLGYAVYRNQLLNVYCSKYETGGLLWPTMHNTTVFSLVLAQIIALGVFGIKESSVAS  631

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT  L+I TLLFNEYCRQRFHPV ++  AQ L++MD +DEQ  RM++I Q++  AYCQF
Sbjct  632  GFTVVLVILTLLFNEYCRQRFHPVFKSFSAQDLIEMDIEDEQSGRMEEIQQQLHPAYCQF  691



>ref|XP_008674128.1| PREDICTED: uncharacterized protein LOC103650301 isoform X1 [Zea 
mays]
 ref|XP_008674129.1| PREDICTED: uncharacterized protein LOC103650301 isoform X1 [Zea 
mays]
Length=767

 Score =   171 bits (433),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQ+LNVY T+Y TGGLYW I +   IFSLVLTQII LGVFGLK+S VA+
Sbjct  571  VYFCLGYVVYRNQLLNVYRTRYDTGGLYWPIAYNTVIFSLVLTQIICLGVFGLKESPVAA  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLII TLLFN+YCR R  P+ +  PAQ L+DMDR+DE+  RM +I+  + SAYCQF
Sbjct  631  GFTVPLIILTLLFNQYCRNRLLPLFKTFPAQDLIDMDREDERSGRMDEIHHGLHSAYCQF  690



>gb|KHN29744.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=622

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            YF LAY +YRNQILNVY+ KY +GG  W + H  T+FSL+  Q+IALGVFGLK+S VASG
Sbjct  449  YFVLAYFVYRNQILNVYIRKYDSGGQLWPLAHNTTVFSLLFAQVIALGVFGLKQSPVASG  508

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQFR  365
            FT PL+ICT+LFN+YCRQRF PV +    Q+L+DMDR+DE+  RM  IY++V SAYCQ  
Sbjct  509  FTIPLLICTILFNQYCRQRFLPVFQRNATQVLIDMDRRDERCGRMDQIYEQVQSAYCQAT  568

Query  364  RSS  356
             S+
Sbjct  569  HST  571



>ref|XP_010231660.1| PREDICTED: CSC1-like protein RXW8 isoform X3 [Brachypodium distachyon]
Length=692

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 103/150 (69%), Gaps = 1/150 (1%)
 Frame = -2

Query  706  IIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASGFTFPLI  527
            ++YRNQ +NVY TKY TGGLYW I +  TIFS+VLTQII LGVFGLK+S VA+GFT PLI
Sbjct  507  VVYRNQFINVYCTKYDTGGLYWPIAYNTTIFSVVLTQIICLGVFGLKESPVAAGFTVPLI  566

Query  526  ICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ-FRRSSVT  350
            I TLLFN+YCR+R  P+ R  PAQ+L+DMDR DEQ  RM  I+Q++ SAYCQ      ++
Sbjct  567  ILTLLFNQYCRKRLLPLFRTFPAQVLIDMDRDDEQSGRMDAIHQRLQSAYCQSLDADDIS  626

Query  349  LGSPHPLNPKEQSMLQELEDDVNPAALKPD  260
            L     ++  E       E +   +A +PD
Sbjct  627  LEGVETISTDEDGSGSSGESNCKESANQPD  656



>ref|XP_008337022.1| PREDICTED: uncharacterized membrane protein YLR241W, partial 
[Malus domestica]
Length=647

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 111/163 (68%), Gaps = 1/163 (1%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LAY IYRNQILNVY+ +Y++GG +W ++H   I SL++ QIIALGVFGL+++ +AS
Sbjct  475  VYFVLAYFIYRNQILNVYIAEYESGGQFWPMIHNTVIISLLMMQIIALGVFGLRRTPIAS  534

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+I TLLFNEYCRQ+F PV +N  A+ L+DMD+KDEQ  RM++ YQ++ SAYCQ 
Sbjct  535  GFTIPLLIFTLLFNEYCRQQFKPVFKNHVAEXLIDMDQKDEQSGRMEEAYQQLHSAYCQA  594

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPDMPAGSWN  239
              +     S       E  ++ + E +  P   +P     SWN
Sbjct  595  PITPDDSCSSGGSTRHEGDIVPDPE-NAKPPGEEPSXINPSWN  636



>ref|XP_003523635.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Glycine 
max]
Length=744

 Score =   170 bits (431),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            YF LAY +YRNQILNVY+ KY +GG  W + H  T+FSL+  Q+IALGVFGLK+S VASG
Sbjct  571  YFVLAYFVYRNQILNVYIRKYDSGGQLWPLAHNTTVFSLLFAQVIALGVFGLKQSPVASG  630

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQFR  365
            FT PL+ICT+LFN+YCRQRF PV +    Q+L+DMDR+DE+  RM  IY++V SAYCQ  
Sbjct  631  FTIPLLICTILFNQYCRQRFLPVFQRNATQVLIDMDRRDERCGRMDQIYEQVQSAYCQAT  690

Query  364  RSS  356
             S+
Sbjct  691  HST  693



>ref|XP_010936200.1| PREDICTED: CSC1-like protein RXW8 [Elaeis guineensis]
Length=744

 Score =   170 bits (431),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQI+NVY +KY++GG  W IVH   IFSL+LTQIIALGVFG+K+   AS
Sbjct  584  VYFFLGYVVYRNQIMNVYCSKYESGGQMWPIVHNTAIFSLILTQIIALGVFGMKRYPGAS  643

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ  371
            GFT PL+I T+LFNEYCRQRF+P+  N+ AQ L++MDR DEQ  RM++I+Q + +AYCQ
Sbjct  644  GFTIPLVIATILFNEYCRQRFYPMFNNISAQDLIEMDRDDEQSGRMEEIHQLLLTAYCQ  702



>ref|XP_003561325.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Brachypodium distachyon]
Length=762

 Score =   170 bits (430),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 103/150 (69%), Gaps = 1/150 (1%)
 Frame = -2

Query  706  IIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASGFTFPLI  527
            ++YRNQ +NVY TKY TGGLYW I +  TIFS+VLTQII LGVFGLK+S VA+GFT PLI
Sbjct  577  VVYRNQFINVYCTKYDTGGLYWPIAYNTTIFSVVLTQIICLGVFGLKESPVAAGFTVPLI  636

Query  526  ICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ-FRRSSVT  350
            I TLLFN+YCR+R  P+ R  PAQ+L+DMDR DEQ  RM  I+Q++ SAYCQ      ++
Sbjct  637  ILTLLFNQYCRKRLLPLFRTFPAQVLIDMDRDDEQSGRMDAIHQRLQSAYCQSLDADDIS  696

Query  349  LGSPHPLNPKEQSMLQELEDDVNPAALKPD  260
            L     ++  E       E +   +A +PD
Sbjct  697  LEGVETISTDEDGSGSSGESNCKESANQPD  726



>ref|XP_004982191.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Setaria italica]
 ref|XP_004982192.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Setaria italica]
Length=762

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF L Y++YRNQ LNVY TKY TGGLYW I H  TIFSLVL+QII LGVFGLK+S VAS
Sbjct  569  IYFCLGYVVYRNQFLNVYCTKYDTGGLYWPIAHNTTIFSLVLSQIICLGVFGLKESPVAS  628

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLII TLLFN+YCR+R  P+ +  PAQ L+DMD++D+Q  R +D++ ++ SAY QF
Sbjct  629  GFTVPLIIFTLLFNQYCRKRHLPLFKTFPAQSLIDMDKEDQQMGRTEDLHDRLHSAYFQF  688



>ref|XP_009361350.1| PREDICTED: CSC1-like protein RXW8 isoform X2 [Pyrus x bretschneideri]
Length=738

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 112/163 (69%), Gaps = 1/163 (1%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LAY IYRNQILNVY+ +Y++GG +W ++H   I SL++ QIIALGVFGL+++ +AS
Sbjct  566  VYFVLAYFIYRNQILNVYIAEYESGGQFWPMIHNTVIVSLLIMQIIALGVFGLRRTPIAS  625

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+I TLLFNEYCRQ+F PV +N  A+IL+DMD+KDEQ  RM++ Y+++ SAYCQ 
Sbjct  626  GFTIPLLIFTLLFNEYCRQQFKPVFKNHVAEILIDMDQKDEQSGRMEEAYKQLHSAYCQA  685

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPDMPAGSWN  239
              +     S       E  ++ + E +  P   +P     SWN
Sbjct  686  PLTPDDSCSSGGSTRHEGDIVPDPE-NAKPPGEEPSQINPSWN  727



>ref|XP_007136794.1| hypothetical protein PHAVU_009G074900g [Phaseolus vulgaris]
 gb|ESW08788.1| hypothetical protein PHAVU_009G074900g [Phaseolus vulgaris]
Length=678

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            YF LAY++YRNQILNVY+ KY +GG  W I H  T+ SL++ Q+IALGVFG+K++ +ASG
Sbjct  507  YFVLAYLVYRNQILNVYINKYDSGGQLWPIAHNTTVISLLVAQVIALGVFGIKEAPIASG  566

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQFR  365
            FT PL+ICT+LF++YCR+RF PV +N   Q+L+DMDR+DE+  +M+ IY+ V SAYCQF 
Sbjct  567  FTIPLLICTVLFHQYCRERFLPVFKNNATQVLIDMDRRDERCGKMEQIYELVNSAYCQFS  626

Query  364  RSS  356
             S+
Sbjct  627  GST  629



>gb|EMT19397.1| Putative membrane protein [Aegilops tauschii]
Length=786

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQ+LNVY T+Y TGGLYW I+H   IFSLVLTQII LGVFGLK S VA+
Sbjct  573  VYFFLGYVVYRNQLLNVYRTRYDTGGLYWPIIHNTVIFSLVLTQIICLGVFGLKVSPVAA  632

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLII TLLFN+YCR R  P+    PAQ L+DMDR+DE   RM+ I+  + +AYCQF
Sbjct  633  GFTIPLIIFTLLFNQYCRTRLLPLFSTFPAQNLIDMDREDELSGRMEHIHHGLHTAYCQF  692

Query  367  RRS  359
              S
Sbjct  693  PES  695



>ref|XP_006855764.1| hypothetical protein AMTR_s00044p00184510 [Amborella trichopoda]
 gb|ERN17231.1| hypothetical protein AMTR_s00044p00184510 [Amborella trichopoda]
Length=756

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQILNVY +KY+TGG +W IVH  T+FSL+LTQIIALGVFG+K S VAS
Sbjct  573  VYFFLGYVVYRNQILNVYCSKYETGGQFWPIVHNTTVFSLILTQIIALGVFGIKHSPVAS  632

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ  371
            GFT PL++ TLLFNEYCRQRF P+  +  A++L+ MDR+DE   R+  I +++ +AYCQ
Sbjct  633  GFTIPLLLFTLLFNEYCRQRFSPIFHSYSAEVLIKMDREDEGSGRLDGILEQLQAAYCQ  691



>ref|XP_002443649.1| hypothetical protein SORBIDRAFT_08g022840 [Sorghum bicolor]
 gb|EES17487.1| hypothetical protein SORBIDRAFT_08g022840 [Sorghum bicolor]
Length=767

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQ+LNVY T+Y TGGLYW I     IFSLVLTQII LGVFGLK+S VA+
Sbjct  571  VYFCLGYVVYRNQLLNVYRTRYDTGGLYWPIACNTVIFSLVLTQIICLGVFGLKESPVAA  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLII TLLFN+YCR R  P+ +  PAQ L+DMDR+DE+  R+ +I+  + SAYCQF
Sbjct  631  GFTIPLIILTLLFNQYCRNRLLPLFKTFPAQDLIDMDREDERSGRIDEIHHGLHSAYCQF  690



>ref|XP_009361345.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Pyrus x bretschneideri]
Length=778

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LAY IYRNQILNVY+ +Y++GG +W ++H   I SL++ QIIALGVFGL+++ +AS
Sbjct  566  VYFVLAYFIYRNQILNVYIAEYESGGQFWPMIHNTVIVSLLIMQIIALGVFGLRRTPIAS  625

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ  371
            GFT PL+I TLLFNEYCRQ+F PV +N  A+IL+DMD+KDEQ  RM++ Y+++ SAYCQ
Sbjct  626  GFTIPLLIFTLLFNEYCRQQFKPVFKNHVAEILIDMDQKDEQSGRMEEAYKQLHSAYCQ  684



>ref|XP_004142910.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
sativus]
 gb|KGN62417.1| hypothetical protein Csa_2G352960 [Cucumis sativus]
Length=743

 Score =   167 bits (424),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            YF LAY++Y+NQILNVY +KY++GG +W I H  TIF++V+ Q+IALGVFG+K+S VASG
Sbjct  569  YFFLAYLVYKNQILNVYTSKYESGGQFWPIAHNTTIFAMVVAQVIALGVFGVKESPVASG  628

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            FT PLI+ T+LF+ YCRQRF P+ R+  A++L++MDRKDE+  RM+++Y+++ +AYCQF
Sbjct  629  FTIPLIVGTILFHGYCRQRFRPIFRDTAAEVLIEMDRKDEECGRMEEMYRQLRTAYCQF  687



>ref|XP_004501797.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Cicer 
arietinum]
Length=727

 Score =   166 bits (421),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 102/140 (73%), Gaps = 0/140 (0%)
 Frame = -2

Query  703  IYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASGFTFPLII  524
            +YRNQILNVY+TKY  GG  W IV   T+FSL++ QIIALGVFGLK+STVASGFT PL+I
Sbjct  571  VYRNQILNVYITKYDGGGHLWPIVFNTTVFSLLVAQIIALGVFGLKRSTVASGFTIPLLI  630

Query  523  CTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQFRRSSVTLG  344
             T+LFN+YCRQRF PV RN  AQ+L+DMD +DE   RM++IY ++ SAYCQF  SS    
Sbjct  631  GTVLFNQYCRQRFLPVFRNNAAQVLIDMDHRDENCRRMEEIYDQLHSAYCQFNTSSSQTD  690

Query  343  SPHPLNPKEQSMLQELEDDV  284
                   +E++   ++ +D+
Sbjct  691  CFSYAGDRERAQSLQIPEDM  710



>ref|XP_004159572.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein 
C2G11.09-like [Cucumis sativus]
Length=682

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            YF  AY++Y+NQILNVY +KY++GG +W I H  TIF++V+ Q+IALGVFG+K+S VASG
Sbjct  508  YFFXAYLVYKNQILNVYTSKYESGGQFWPIAHNTTIFAMVVAQVIALGVFGVKESPVASG  567

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            FT PLI+ T+LF+ YCRQRF P+ R+  A++L++MDRKDE+  RM+++Y+++ +AYCQF
Sbjct  568  FTIPLIVGTILFHGYCRQRFRPIFRDTAAEVLIEMDRKDEECGRMEEMYRQLRTAYCQF  626



>gb|KEH39976.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=768

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 108/146 (74%), Gaps = 10/146 (7%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY++YRNQI+NVY+TKY +GG YW I H AT+ SL+  Q+IALGVFGLK+STV++
Sbjct  564  IYFFLAYLVYRNQIINVYITKYDSGGQYWPIAHNATVCSLLFAQLIALGVFGLKRSTVSA  623

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GF  PL+I T+LF++YCR+RF PV R+  AQIL+D+D+KDEQ  RM++IY+++ SAY Q 
Sbjct  624  GFIAPLLIVTILFHQYCRKRFLPVFRSNSAQILIDLDKKDEQCGRMEEIYEQLRSAYKQ-  682

Query  367  RRSSVTLGSPHPLNPKEQSMLQELED  290
                     PH  +P E S    LED
Sbjct  683  -------PMPHAPSPSECS--SPLED  699



>ref|XP_002892546.1| hypothetical protein ARALYDRAFT_471124 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68805.1| hypothetical protein ARALYDRAFT_471124 [Arabidopsis lyrata subsp. 
lyrata]
Length=761

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 105/150 (70%), Gaps = 3/150 (2%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF  AY+IY+NQI+NVY+TKY++GG YW + H  TIFSL+L+QIIALG FGLK STVAS
Sbjct  567  IYFFFAYLIYKNQIINVYITKYESGGQYWPVFHNTTIFSLILSQIIALGFFGLKLSTVAS  626

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI  TLLF+EYCRQRF P+ +  PA+IL+ MDR DE   +M++I+  + +AY Q 
Sbjct  627  GFTIPLIFLTLLFSEYCRQRFAPIFKKYPAEILIAMDRADEMTGKMEEIHNNLKAAYSQI  686

Query  367  ---RRSSVTLGSPHPLNPKEQSMLQELEDD  287
                  S   G   P + +E    ++L+ +
Sbjct  687  PTCSEESSKAGCTSPCSDQELPDSEQLKPE  716



>dbj|BAJ92039.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=778

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = -2

Query  706  IIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASGFTFPLI  527
            I+YRNQ +NVY T+Y TGGLYW I + ATIFSLVLTQII LGVFGLK+S VA+GFT PLI
Sbjct  577  IVYRNQFINVYCTRYDTGGLYWPIAYNATIFSLVLTQIICLGVFGLKESPVAAGFTVPLI  636

Query  526  ICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ  371
            I TLLFN+YCR R  P+    PAQ+L+DMDR+DEQ  RM++I++ + SAYCQ
Sbjct  637  ILTLLFNQYCRMRLLPLFGTFPAQVLIDMDREDEQSGRMEEIHEGLHSAYCQ  688



>gb|EMT10348.1| Putative membrane protein [Aegilops tauschii]
Length=818

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -2

Query  706  IIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASGFTFPLI  527
            I+YRNQ +NVY T+Y TGGLYW I + ATIFSLVLTQII LGVFGLK+S VA+GFT PLI
Sbjct  577  IVYRNQFINVYCTRYDTGGLYWPIAYNATIFSLVLTQIICLGVFGLKESPVAAGFTVPLI  636

Query  526  ICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ  371
            I TLLFN+YCR R  P+    PAQ+L+DMDR+DEQ  RM +I++ + +AYCQ
Sbjct  637  IITLLFNQYCRMRLLPLFGTFPAQVLIDMDREDEQSGRMDEIHEGLHAAYCQ  688



>gb|KEH35861.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=736

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = -2

Query  703  IYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASGFTFPLII  524
            +YRNQI+NVY+TKY  GG  W I H  +IFSL++ Q+IALGVFGLK+STVA+GFT PL+I
Sbjct  577  VYRNQIINVYITKYDGGGQLWPIAHTTSIFSLLVAQVIALGVFGLKRSTVAAGFTIPLLI  636

Query  523  CTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQFRRSS  356
             T+LFN+YCRQRF PV +N  AQ+L+DMD +DE   RM++IY ++ SAYCQF  +S
Sbjct  637  GTVLFNQYCRQRFLPVFKNNAAQVLIDMDHRDETFRRMEEIYHQLHSAYCQFNNTS  692



>ref|XP_002464091.1| hypothetical protein SORBIDRAFT_01g012190 [Sorghum bicolor]
 gb|EER91089.1| hypothetical protein SORBIDRAFT_01g012190 [Sorghum bicolor]
Length=783

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 112/182 (62%), Gaps = 11/182 (6%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF L Y++YRNQ LNVY TKY TGGLYW I H  TIFSL+LTQII LGVF +K+S VA+
Sbjct  522  LYFCLGYVVYRNQFLNVYCTKYDTGGLYWPIAHNTTIFSLILTQIICLGVFIIKESPVAA  581

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLII TLLFN+YCR+R  P+ +  PAQ L+DMD++D+Q    +D++ ++ SAY QF
Sbjct  582  GFTVPLIIFTLLFNQYCRKRHLPLFKTFPAQNLIDMDKEDQQSATTEDLHHRLHSAYFQF  641

Query  367  RRSSVTLGSPHPLNPK---------EQSMLQELEDDVNPAALK--PDMPAGSWNGHTNLE  221
              +       H    +         E S  +   D+++   L   P    G W    +++
Sbjct  642  HDTDDVPLEGHSTTGRDEDRSGCSGESSRKESAVDELSHPTLDGLPKEGPGKWEKTEHIQ  701

Query  220  IE  215
            +E
Sbjct  702  VE  703



>ref|XP_006392283.1| hypothetical protein EUTSA_v10023298mg [Eutrema salsugineum]
 gb|ESQ29569.1| hypothetical protein EUTSA_v10023298mg [Eutrema salsugineum]
Length=594

 Score =   161 bits (407),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 113/160 (71%), Gaps = 13/160 (8%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY+IY+NQILNVY+TKY++GG YW I H  TIFSL+LTQIIALG FGLK STVAS
Sbjct  398  IYFFLAYLIYKNQILNVYITKYESGGQYWPIFHNTTIFSLILTQIIALGFFGLKLSTVAS  457

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+ +  PAQ+L+DMDR DE   +M+++++K+ S Y Q 
Sbjct  458  GFTIPLILLTLLFSEYCRQRFAPIFQKHPAQVLIDMDRADEMSGKMEELHKKLHSVYSQL  517

Query  367  ----RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPD  260
                ++SS    S  P         QEL D   P  LKP+
Sbjct  518  PLHSQKSSSKAESSTPFTS------QELPD---PEKLKPE  548



>ref|XP_010553667.1| PREDICTED: CSC1-like protein RXW8 isoform X2 [Tarenaya hassleriana]
Length=683

 Score =   161 bits (408),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF+LAY+IY+NQILNVY+TKY++GG YW I H  T+FSL+LTQIIALG FGLK S VAS
Sbjct  490  IYFSLAYLIYKNQILNVYITKYESGGQYWPIFHSTTLFSLILTQIIALGFFGLKLSPVAS  549

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+ +  PAQ+L+DMDR+DEQ  ++++I++ + +AYCQ 
Sbjct  550  GFTIPLILLTLLFSEYCRQRFLPIFKKHPAQVLIDMDREDEQSGKIEEIHKVLQTAYCQI  609

Query  367  RRSS  356
            + SS
Sbjct  610  QLSS  613



>ref|XP_009396675.1| PREDICTED: CSC1-like protein RXW8 [Musa acuminata subsp. malaccensis]
Length=713

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L +++YRNQILNVY + Y++GG  W IVH  T+FSL+L QIIALGVFG K + VAS
Sbjct  568  VYFFLGHLVYRNQILNVYSSYYESGGRMWPIVHNTTVFSLLLMQIIALGVFGTKDAPVAS  627

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ  371
            GFT PL+I TLLF+EYCR  F+P+ +N  AQ  ++MDR+DEQ  RMKDI+ ++ +AYCQ
Sbjct  628  GFTIPLLIFTLLFSEYCRHHFNPIFKNFSAQDFIEMDREDEQTGRMKDIHMQLLTAYCQ  686



>ref|XP_010553666.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Tarenaya hassleriana]
Length=762

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF+LAY+IY+NQILNVY+TKY++GG YW I H  T+FSL+LTQIIALG FGLK S VAS
Sbjct  569  IYFSLAYLIYKNQILNVYITKYESGGQYWPIFHSTTLFSLILTQIIALGFFGLKLSPVAS  628

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+ +  PAQ+L+DMDR+DEQ  ++++I++ + +AYCQ 
Sbjct  629  GFTIPLILLTLLFSEYCRQRFLPIFKKHPAQVLIDMDREDEQSGKIEEIHKVLQTAYCQI  688

Query  367  RRSS  356
            + SS
Sbjct  689  QLSS  692



>gb|KHF99101.1| Membrane protein [Gossypium arboreum]
Length=622

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LA+++YRNQIL+VYVTKY++ G +W IVH ATIFSLVLTQ+IA+ V  +KKS +AS
Sbjct  449  VYFFLAFLVYRNQILHVYVTKYESAGQFWPIVHNATIFSLVLTQVIAVAVLAMKKSPMAS  508

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ  371
            G T PLII +LLFNEYCR+RF  V +  PAQ+L++MDR+DEQ  + + IY ++ S YCQ
Sbjct  509  GCTIPLIIISLLFNEYCRKRFSQVFKRNPAQVLIEMDRRDEQWGKEEGIYNRLRSEYCQ  567



>ref|XP_006392284.1| hypothetical protein EUTSA_v10023298mg [Eutrema salsugineum]
 gb|ESQ29570.1| hypothetical protein EUTSA_v10023298mg [Eutrema salsugineum]
Length=765

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 113/160 (71%), Gaps = 13/160 (8%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY+IY+NQILNVY+TKY++GG YW I H  TIFSL+LTQIIALG FGLK STVAS
Sbjct  569  IYFFLAYLIYKNQILNVYITKYESGGQYWPIFHNTTIFSLILTQIIALGFFGLKLSTVAS  628

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+ +  PAQ+L+DMDR DE   +M+++++K+ S Y Q 
Sbjct  629  GFTIPLILLTLLFSEYCRQRFAPIFQKHPAQVLIDMDRADEMSGKMEELHKKLHSVYSQL  688

Query  367  ----RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPD  260
                ++SS    S  P         QEL D   P  LKP+
Sbjct  689  PLHSQKSSSKAESSTPFTS------QELPD---PEKLKPE  719



>ref|XP_008643732.1| PREDICTED: uncharacterized protein LOC100382010 isoform X2 [Zea 
mays]
Length=647

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = -2

Query  712  AYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASGFTFP  533
             Y++YRNQ LNVY TKY TGG YW I H  TIFSL+LTQII LGVFGLK+S VA+GFT P
Sbjct  458  GYVVYRNQFLNVYCTKYDTGGQYWPIAHNTTIFSLILTQIICLGVFGLKESPVAAGFTVP  517

Query  532  LIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            LII TLLFN+YCR+R  P+ +  PAQ L+DMD++D+Q +  +D+++++ SAY QF
Sbjct  518  LIIFTLLFNQYCRKRHLPLFKTFPAQNLIDMDKEDQQSDTTEDLHERLHSAYFQF  572



>gb|KJB58719.1| hypothetical protein B456_009G222800 [Gossypium raimondii]
Length=733

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LA+++YRNQIL+VYVTKY++ G +W IVH ATIFSLVLTQ+IA+ V  +KKS +AS
Sbjct  567  VYFFLAFLVYRNQILHVYVTKYESAGQFWPIVHNATIFSLVLTQVIAVAVLAMKKSPMAS  626

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ  371
            G T PLII +LLFNEYCR+RF  V +  PAQ+L++MDR+DEQ  + + IY ++ S YCQ
Sbjct  627  GCTIPLIIISLLFNEYCRKRFSQVFKRNPAQVLIEMDRRDEQWGKEEGIYNRLRSEYCQ  685



>dbj|BAB84010.1| hypothetical protein [Arabidopsis thaliana]
Length=447

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 112/160 (70%), Gaps = 13/160 (8%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY+IY+NQILNVY+TKY++GG YW I H  TIFSL+LTQIIALG FGLK STVAS
Sbjct  272  IYFFLAYLIYKNQILNVYITKYESGGQYWPIFHNTTIFSLILTQIIALGFFGLKLSTVAS  331

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+    PAQ+L+DMDR DE   +M+++++K+ + Y Q 
Sbjct  332  GFTIPLILLTLLFSEYCRQRFAPIFNKNPAQVLIDMDRADEISGKMEELHKKLHNVYSQI  391

Query  367  ----RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPD  260
                ++SS      +P         QEL D   P  LKP+
Sbjct  392  PLHSQKSSSKAECSNPFKK------QELPD---PEKLKPE  422



>gb|KJB58718.1| hypothetical protein B456_009G222800 [Gossypium raimondii]
Length=734

 Score =   159 bits (403),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LA+++YRNQIL+VYVTKY++ G +W IVH ATIFSLVLTQ+IA+ V  +KKS +AS
Sbjct  567  VYFFLAFLVYRNQILHVYVTKYESAGQFWPIVHNATIFSLVLTQVIAVAVLAMKKSPMAS  626

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ  371
            G T PLII +LLFNEYCR+RF  V +  PAQ+L++MDR+DEQ  + + IY ++ S YCQ
Sbjct  627  GCTIPLIIISLLFNEYCRKRFSQVFKRNPAQVLIEMDRRDEQWGKEEGIYNRLRSEYCQ  685



>ref|XP_008643723.1| PREDICTED: uncharacterized protein LOC100382010 isoform X1 [Zea 
mays]
 tpg|DAA50528.1| TPA: hypothetical protein ZEAMMB73_928437 [Zea mays]
 tpg|DAA50529.1| TPA: hypothetical protein ZEAMMB73_928437 [Zea mays]
Length=765

 Score =   159 bits (402),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = -2

Query  712  AYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASGFTFP  533
             Y++YRNQ LNVY TKY TGG YW I H  TIFSL+LTQII LGVFGLK+S VA+GFT P
Sbjct  576  GYVVYRNQFLNVYCTKYDTGGQYWPIAHNTTIFSLILTQIICLGVFGLKESPVAAGFTVP  635

Query  532  LIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            LII TLLFN+YCR+R  P+ +  PAQ L+DMD++D+Q +  +D+++++ SAY QF
Sbjct  636  LIIFTLLFNQYCRKRHLPLFKTFPAQNLIDMDKEDQQSDTTEDLHERLHSAYFQF  690



>ref|XP_006300402.1| hypothetical protein CARUB_v10019848mg [Capsella rubella]
 gb|EOA33300.1| hypothetical protein CARUB_v10019848mg [Capsella rubella]
Length=765

 Score =   159 bits (401),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 112/156 (72%), Gaps = 5/156 (3%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY+IY+NQILNVY+TKY++GG YW I H  TIFSL+LTQIIALG FGLK STVAS
Sbjct  569  IYFFLAYLIYKNQILNVYITKYESGGQYWPIFHNTTIFSLILTQIIALGFFGLKLSTVAS  628

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+    PAQ+L+DMDR DE   +M+++++K+ + Y Q 
Sbjct  629  GFTIPLILLTLLFSEYCRQRFAPIFHKYPAQVLIDMDRADEISGKMEELHKKLHNVYSQ-  687

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPD  260
                + L S  P +  E S     ++  +P  LKP+
Sbjct  688  ----IPLHSQKPSSKAECSTPFANQELPDPEKLKPE  719



>ref|XP_007160961.1| hypothetical protein PHAVU_001G031900g [Phaseolus vulgaris]
 gb|ESW32955.1| hypothetical protein PHAVU_001G031900g [Phaseolus vulgaris]
Length=721

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY++YRNQI+NVY+TKY  GG YW I H  T+FSL+ +Q+IALGVFGLK+S+VAS
Sbjct  568  IYFFLAYLVYRNQIINVYITKYDGGGQYWPIAHNTTVFSLLFSQLIALGVFGLKRSSVAS  627

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+I TLLF++YCRQRF P+ ++  AQ  +DMD +DE   RM++I++ +  AY Q 
Sbjct  628  GFTIPLLIGTLLFHQYCRQRFLPIFKSNSAQTAIDMDLRDEHCGRMEEIHEHLRLAYNQP  687

Query  367  R  365
            R
Sbjct  688  R  688



>dbj|BAG68911.1| hypothetical protein [Arabidopsis thaliana]
Length=657

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 112/160 (70%), Gaps = 13/160 (8%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY+IY+NQILNVY+TKY++GG YW I H  TIFSL+LTQIIALG FGLK STVAS
Sbjct  482  IYFFLAYLIYKNQILNVYITKYESGGQYWPIFHNTTIFSLILTQIIALGFFGLKLSTVAS  541

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+    PAQ+L+DMDR DE   +M+++++K+ + Y Q 
Sbjct  542  GFTIPLILLTLLFSEYCRQRFAPIFNKNPAQVLIDMDRADEISGKMEELHKKLHNVYSQI  601

Query  367  ----RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPD  260
                ++SS      +P         QEL D   P  LKP+
Sbjct  602  PLHSQKSSSKAECSNPFKK------QELPD---PEKLKPE  632



>ref|XP_007160962.1| hypothetical protein PHAVU_001G031900g [Phaseolus vulgaris]
 gb|ESW32956.1| hypothetical protein PHAVU_001G031900g [Phaseolus vulgaris]
Length=751

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY++YRNQI+NVY+TKY  GG YW I H  T+FSL+ +Q+IALGVFGLK+S+VAS
Sbjct  568  IYFFLAYLVYRNQIINVYITKYDGGGQYWPIAHNTTVFSLLFSQLIALGVFGLKRSSVAS  627

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PL+I TLLF++YCRQRF P+ ++  AQ  +DMD +DE   RM++I++ +  AY Q 
Sbjct  628  GFTIPLLIGTLLFHQYCRQRFLPIFKSNSAQTAIDMDLRDEHCGRMEEIHEHLRLAYNQP  687

Query  367  R  365
            R
Sbjct  688  R  688



>emb|CDY04434.1| BnaA03g59260D [Brassica napus]
Length=765

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 112/160 (70%), Gaps = 13/160 (8%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY+IY+NQILNVY+TKY++GG YW I H  TIFSL+LTQIIALG FGLK STVAS
Sbjct  569  IYFFLAYLIYKNQILNVYITKYESGGKYWPIFHNTTIFSLILTQIIALGFFGLKLSTVAS  628

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ-  371
            GFT PLI+ TLLF+EYCR RF P+    PAQ+L+DMDR DE   +M+++++K+ S Y Q 
Sbjct  629  GFTIPLILLTLLFSEYCRNRFAPIFHKHPAQVLIDMDRADEMTGKMEELHKKLHSVYSQI  688

Query  370  ---FRRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPD  260
                ++SS    S  P +       QEL D   P  LKP+
Sbjct  689  PLHLQKSSSNGESSTPFSN------QELPD---PEKLKPE  719



>dbj|BAA88270.1| RXW8 [Arabidopsis thaliana]
 dbj|BAB83877.1| hypothetical protein [Arabidopsis thaliana]
Length=657

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 112/160 (70%), Gaps = 13/160 (8%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY+IY+NQILNVY+TKY++GG YW I H  TIFSL+LTQIIALG FGLK STVAS
Sbjct  482  IYFFLAYLIYKNQILNVYITKYESGGQYWPIFHNTTIFSLILTQIIALGFFGLKLSTVAS  541

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+    PAQ+L+DMDR DE   +M+++++K+ + Y Q 
Sbjct  542  GFTIPLILLTLLFSEYCRQRFAPIFNKNPAQVLIDMDRADEISGKMEELHKKLHNVYSQI  601

Query  367  ----RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPD  260
                ++SS      +P         QEL D   P  LKP+
Sbjct  602  PLHSQKSSSKAECSNPFKK------QELPD---PEKLKPE  632



>ref|NP_683440.2| protein RXW8 [Arabidopsis thaliana]
 sp|F4IBD7.1|CSCLA_ARATH RecName: Full=CSC1-like protein RXW8 [Arabidopsis thaliana]
 gb|AEE33554.1| lipase/hydrolase [Arabidopsis thaliana]
 gb|AIU34621.1| hyperosmolality-gated Ca2+ permeable channel 2.1 [Arabidopsis 
thaliana]
Length=746

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 112/160 (70%), Gaps = 13/160 (8%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY+IY+NQILNVY+TKY++GG YW I H  TIFSL+LTQIIALG FGLK STVAS
Sbjct  571  IYFFLAYLIYKNQILNVYITKYESGGQYWPIFHNTTIFSLILTQIIALGFFGLKLSTVAS  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+    PAQ+L+DMDR DE   +M+++++K+ + Y Q 
Sbjct  631  GFTIPLILLTLLFSEYCRQRFAPIFNKNPAQVLIDMDRADEISGKMEELHKKLHNVYSQI  690

Query  367  ----RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPD  260
                ++SS      +P         QEL D   P  LKP+
Sbjct  691  PLHSQKSSSKAECSNPFKK------QELPD---PEKLKPE  721



>emb|CDY44554.1| BnaA01g21850D [Brassica napus]
Length=723

 Score =   156 bits (395),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 116/184 (63%), Gaps = 28/184 (15%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY+IY+NQILNVY+TKY++GG YW I H  TIFSL+LTQIIALG FGLK STVAS
Sbjct  527  IYFFLAYLIYKNQILNVYITKYESGGQYWPIFHNTTIFSLLLTQIIALGFFGLKLSTVAS  586

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCR RF P+    PAQ+L+DMDR DE   +M+++++K+ S Y Q 
Sbjct  587  GFTIPLILLTLLFSEYCRHRFAPIFHKHPAQVLIDMDRADEMAGKMEELHKKLHSVYSQI  646

Query  367  ----RRSSVT-----------LGSPHPLNPKEQSML-------------QELEDDVNPAA  272
                ++SS             L  P  L P+E   +             QE ED   P+A
Sbjct  647  PLHSQKSSSKGECSTPFANQELPDPEKLKPEEGDAIAKELWGYQGNESGQEHEDKSCPSA  706

Query  271  LKPD  260
              P+
Sbjct  707  SSPE  710



>emb|CDY45880.1| BnaC01g28160D [Brassica napus]
Length=716

 Score =   156 bits (394),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 114/180 (63%), Gaps = 24/180 (13%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY+IY+NQILNVY+TKY++GG YW I H  TIFSL+LTQIIALG FGLK STVAS
Sbjct  524  IYFFLAYLIYKNQILNVYITKYESGGQYWPIFHNTTIFSLLLTQIIALGFFGLKLSTVAS  583

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCR RF P+    PAQ+L+DMDR DE   +M+++++K+ + Y Q 
Sbjct  584  GFTIPLILLTLLFSEYCRHRFAPIFHKHPAQVLLDMDRADEMAGKMEELHKKLHNVYSQI  643

Query  367  -----------RRSSVTLGSPHPLNPKEQSML-------------QELEDDVNPAALKPD  260
                         S+  L  P  L P+E   +             QE ED   P+A  P+
Sbjct  644  PLHSQKSSSKGECSTQELPDPEKLKPEEGDAIAKELWGYQGNESGQEHEDKSCPSASSPE  703



>ref|XP_009124465.1| PREDICTED: CSC1-like protein RXW8 [Brassica rapa]
Length=765

 Score =   156 bits (395),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 111/160 (69%), Gaps = 13/160 (8%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY+IY+NQILNVY+TKY++GG YW I H  TIFSL+LTQIIALG FGLK STVAS
Sbjct  569  IYFFLAYLIYKNQILNVYITKYESGGKYWPIFHNTTIFSLILTQIIALGFFGLKLSTVAS  628

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ-  371
            GFT PLI+ TLLF+EYCR RF P+    PAQ+L+DMDR DE   RM+++++K+ S Y Q 
Sbjct  629  GFTIPLILLTLLFSEYCRHRFAPIFHKHPAQVLIDMDRADEMTGRMEELHKKLHSVYSQI  688

Query  370  ---FRRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPD  260
                ++SS    S  P +        EL D   P  LKP+
Sbjct  689  PLHLQKSSSNGESSTPFSN------LELPD---PEKLKPE  719



>emb|CDY27274.1| BnaC04g18540D [Brassica napus]
Length=723

 Score =   155 bits (393),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 111/160 (69%), Gaps = 13/160 (8%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY+IY+NQILNVY+TKY++GG YW I H  TIFSL+LTQIIALG FGLK STVAS
Sbjct  527  IYFFLAYLIYKNQILNVYITKYESGGKYWPIFHNTTIFSLILTQIIALGFFGLKLSTVAS  586

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ-  371
            GFT PLI+ TLLF+EYCR +F P+    PAQ+L+DMDR DE   +M+++++K+ S Y Q 
Sbjct  587  GFTIPLILLTLLFSEYCRHKFAPIFHKHPAQVLIDMDRADEMTGKMEELHKKLHSVYSQI  646

Query  370  ---FRRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPD  260
                ++SS    S  P         QEL D   P  LKP+
Sbjct  647  PLHLQKSSSNGESSTPFAN------QELPD---PEKLKPE  677



>ref|XP_010470242.1| PREDICTED: CSC1-like protein RXW8 isoform X2 [Camelina sativa]
Length=768

 Score =   156 bits (394),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 109/156 (70%), Gaps = 3/156 (2%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY+IY+NQILNVY+TKY++GG YW I H  TIFSL+LTQIIALG FGLK STVAS
Sbjct  571  IYFFLAYLIYKNQILNVYITKYESGGQYWPIFHNTTIFSLILTQIIALGFFGLKLSTVAS  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+    PAQ+L+DMDR DE   +M+++++K+ + Y Q 
Sbjct  631  GFTIPLILLTLLFSEYCRQRFAPIFHKHPAQVLIDMDRADEISGKMEELHKKLHNVYSQI  690

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPD  260
               S    +          + QEL D   P  LKP+
Sbjct  691  PLHSQKSSTSKAECSTTPLVNQELPD---PKKLKPE  723



>ref|XP_002888209.1| hypothetical protein ARALYDRAFT_893642 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64468.1| hypothetical protein ARALYDRAFT_893642 [Arabidopsis lyrata subsp. 
lyrata]
Length=764

 Score =   156 bits (394),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 111/157 (71%), Gaps = 7/157 (4%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY+IY+NQILNVY+TKY++GG YW I H  TIFSL+LTQIIALG FGLK STVAS
Sbjct  569  IYFFLAYLIYKNQILNVYITKYESGGQYWPIFHNTTIFSLILTQIIALGFFGLKLSTVAS  628

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+    PAQ+L+DMDR DE   +M+++++K+ + Y Q 
Sbjct  629  GFTIPLILLTLLFSEYCRQRFAPIFNKNPAQVLIDMDRADEISGKMEELHKKLHNVYSQI  688

Query  367  RRSSVTLGSPHPL-NPKEQSMLQELEDDVNPAALKPD  260
               S    S     NP +    QEL D   P  LKP+
Sbjct  689  PLHSEKSSSKAECSNPFKN---QELPD---PEKLKPE  719



>gb|AEM36349.1| At1g58520 [Arabidopsis thaliana]
Length=1031

 Score =   156 bits (395),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 112/160 (70%), Gaps = 13/160 (8%)
 Frame = -2

Query  727   VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
             +YF LAY+IY+NQILNVY+TKY++GG YW I H  TIFSL+LTQIIALG FGLK STVAS
Sbjct  856   IYFFLAYLIYKNQILNVYITKYESGGQYWPIFHNTTIFSLILTQIIALGFFGLKLSTVAS  915

Query  547   GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
             GFT PLI+ TLLF+EYCRQRF P+    PAQ+L+DMDR DE   +M+++++K+ + Y Q 
Sbjct  916   GFTIPLILLTLLFSEYCRQRFAPIFNKNPAQVLIDMDRADEISGKMEELHKKLHNVYSQI  975

Query  367   ----RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPD  260
                 ++SS      +P         QEL D   P  LKP+
Sbjct  976   PLHSQKSSSKAECSNPFKK------QELPD---PEKLKPE  1006



>ref|NP_001154436.1| protein RXW8 [Arabidopsis thaliana]
 gb|AEE33553.1| lipase/hydrolase [Arabidopsis thaliana]
Length=1041

 Score =   156 bits (395),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 112/160 (70%), Gaps = 13/160 (8%)
 Frame = -2

Query  727   VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
             +YF LAY+IY+NQILNVY+TKY++GG YW I H  TIFSL+LTQIIALG FGLK STVAS
Sbjct  866   IYFFLAYLIYKNQILNVYITKYESGGQYWPIFHNTTIFSLILTQIIALGFFGLKLSTVAS  925

Query  547   GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
             GFT PLI+ TLLF+EYCRQRF P+    PAQ+L+DMDR DE   +M+++++K+ + Y Q 
Sbjct  926   GFTIPLILLTLLFSEYCRQRFAPIFNKNPAQVLIDMDRADEISGKMEELHKKLHNVYSQI  985

Query  367   ----RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPD  260
                 ++SS      +P         QEL D   P  LKP+
Sbjct  986   PLHSQKSSSKAECSNPFKK------QELPD---PEKLKPE  1016



>gb|EMS66677.1| Uncharacterized membrane protein C2G11.09 [Triticum urartu]
Length=788

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 95/156 (61%), Gaps = 33/156 (21%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQ+LNVY T+Y TGGLYW I+H   IFSLVLTQII LGVFGLK S VA+
Sbjct  524  VYFFLGYVVYRNQLLNVYRTRYDTGGLYWPIIHNTVIFSLVLTQIICLGVFGLKVSPVAA  583

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQI----------------------------  452
            GFT PLII TLLFN+YCR R  P+    PAQ                             
Sbjct  584  GFTIPLIIFTLLFNQYCRTRLLPLFSTFPAQCKLGNNSGAELYCHFLTGDYYPCFVDRCV  643

Query  451  -----LVDMDRKDEQEERMKDIYQKVTSAYCQFRRS  359
                 L+DMDR+DE   RM+ I+Q++ +AYCQF  S
Sbjct  644  PQVQNLIDMDREDELSGRMEHIHQRLHTAYCQFPDS  679



>ref|XP_009102869.1| PREDICTED: CSC1-like protein RXW8 [Brassica rapa]
 ref|XP_009102875.1| PREDICTED: CSC1-like protein RXW8 [Brassica rapa]
Length=765

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 116/184 (63%), Gaps = 28/184 (15%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY+IY+NQILNVY+TKY++GG YW I H  TIFSL+LTQIIALG FGLK STVAS
Sbjct  569  IYFFLAYLIYKNQILNVYITKYESGGQYWPIFHNTTIFSLLLTQIIALGFFGLKLSTVAS  628

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCR RF P+    PAQ+L+DMDR D+   +M+++++K+ S Y Q 
Sbjct  629  GFTIPLILLTLLFSEYCRHRFAPIFHKHPAQVLIDMDRADKMAGKMEELHKKLHSVYSQI  688

Query  367  ----RRSSVT-----------LGSPHPLNPKEQSML-------------QELEDDVNPAA  272
                ++SS             L  P  L P+E   +             QE ED   P+A
Sbjct  689  PLHSQKSSSKGECSTPFANQELPDPEKLKPEEGDAIAKELWGYQGNESGQEHEDKSCPSA  748

Query  271  LKPD  260
              P+
Sbjct  749  SSPE  752



>ref|XP_010414723.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Camelina sativa]
Length=1041

 Score =   156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 109/156 (70%), Gaps = 3/156 (2%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY+IY+NQILNVY+TKY++GG YW I H  TIFSL+LTQIIALG FGLK STVAS
Sbjct  844  IYFFLAYLIYKNQILNVYITKYESGGQYWPIFHNTTIFSLILTQIIALGFFGLKLSTVAS  903

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+    PAQ+L+DMDR DE   +M+++++K+ + Y Q 
Sbjct  904  GFTIPLILLTLLFSEYCRQRFAPIFHKHPAQVLIDMDRADEISGKMEELHKKLHNVYSQI  963

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPD  260
               S    +          + QEL D   P  LKP+
Sbjct  964  PLHSQKSSTSKAECSTTPLVNQELPD---PKKLKPE  996



>ref|XP_010943525.1| PREDICTED: CSC1-like protein RXW8 isoform X2 [Elaeis guineensis]
Length=663

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  691  QILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASGFTFPLIICTLL  512
            QILNVY  KY+TGGL W  +H  T+FSLVL QIIALGVFG+K+S+VA+GFT  L+I TLL
Sbjct  492  QILNVYCAKYETGGLMWPTMHNTTVFSLVLAQIIALGVFGIKESSVAAGFTIVLVILTLL  551

Query  511  FNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            FNEYCRQRFHP+  +  AQ L++MD +DEQ  RM++I++++  AYCQF
Sbjct  552  FNEYCRQRFHPIFESFSAQDLIEMDTEDEQSRRMEEIHRQLHPAYCQF  599



>ref|XP_010470241.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Camelina sativa]
Length=1062

 Score =   156 bits (394),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 109/156 (70%), Gaps = 3/156 (2%)
 Frame = -2

Query  727   VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
             +YF LAY+IY+NQILNVY+TKY++GG YW I H  TIFSL+LTQIIALG FGLK STVAS
Sbjct  865   IYFFLAYLIYKNQILNVYITKYESGGQYWPIFHNTTIFSLILTQIIALGFFGLKLSTVAS  924

Query  547   GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
             GFT PLI+ TLLF+EYCRQRF P+    PAQ+L+DMDR DE   +M+++++K+ + Y Q 
Sbjct  925   GFTIPLILLTLLFSEYCRQRFAPIFHKHPAQVLIDMDRADEISGKMEELHKKLHNVYSQI  984

Query  367   RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPD  260
                S    +          + QEL D   P  LKP+
Sbjct  985   PLHSQKSSTSKAECSTTPLVNQELPD---PKKLKPE  1017



>ref|XP_010548636.1| PREDICTED: CSC1-like protein RXW8 isoform X2 [Tarenaya hassleriana]
Length=764

 Score =   153 bits (387),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 104/133 (78%), Gaps = 3/133 (2%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF+ AY+IY+NQILNVY+TKY++GG YW I H  TIFSL+LTQIIALG FGLK STVAS
Sbjct  569  IYFSFAYLIYKNQILNVYITKYESGGQYWPIFHSTTIFSLILTQIIALGFFGLKLSTVAS  628

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+ +   AQ+L+DMDR+DEQ  +M++ ++ + +AY Q 
Sbjct  629  GFTIPLILLTLLFSEYCRQRFLPIFKKHSAQVLIDMDREDEQSGKMEERHKNLRTAYFQI  688

Query  367  R---RSSVTLGSP  338
            +   + S   G+P
Sbjct  689  QVPSQESSKAGTP  701



>ref|XP_010548610.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Tarenaya hassleriana]
 ref|XP_010548618.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Tarenaya hassleriana]
 ref|XP_010548625.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Tarenaya hassleriana]
Length=775

 Score =   153 bits (387),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 104/133 (78%), Gaps = 3/133 (2%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF+ AY+IY+NQILNVY+TKY++GG YW I H  TIFSL+LTQIIALG FGLK STVAS
Sbjct  580  IYFSFAYLIYKNQILNVYITKYESGGQYWPIFHSTTIFSLILTQIIALGFFGLKLSTVAS  639

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+ +   AQ+L+DMDR+DEQ  +M++ ++ + +AY Q 
Sbjct  640  GFTIPLILLTLLFSEYCRQRFLPIFKKHSAQVLIDMDREDEQSGKMEERHKNLRTAYFQI  699

Query  367  R---RSSVTLGSP  338
            +   + S   G+P
Sbjct  700  QVPSQESSKAGTP  712



>emb|CDY20660.1| BnaC08g13980D [Brassica napus]
Length=761

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 117/186 (63%), Gaps = 16/186 (9%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY+IY+NQILNVY+TKY++GG YW I H  TIFSL+L+Q+IALG FGLK STVAS
Sbjct  569  IYFFLAYLIYKNQILNVYITKYESGGQYWPIFHNTTIFSLILSQVIALGFFGLKLSTVAS  628

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+ +  PA+IL+ MDR DE   +M++++  + +AY Q 
Sbjct  629  GFTIPLILLTLLFSEYCRQRFAPIFQKYPAEILIAMDRADEITGKMEELHNNLKAAYSQI  688

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPDMPAGSWNGHTNLEIEEVGK**RAS  188
                       PL  +E S     +   +P     ++PA       NLE E +    R+ 
Sbjct  689  -----------PLCSQESS-----KAGCSPPCSDQELPASEQLKPENLEAEMIKAFQRSK  732

Query  187  SDQKVH  170
            S   + 
Sbjct  733  SSHDLE  738



>dbj|BAK06091.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=745

 Score =   151 bits (381),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQILNVY  KY+ GG  W I+H   +FSLVLTQIIALGVF +KK+ VA+
Sbjct  571  VYFCLGYLVYRNQILNVYYPKYEMGGKLWPIMHNTMVFSLVLTQIIALGVFTIKKAPVAT  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ  371
            GFT  L+I T+LFNEYCRQRF  +  +  AQ  +++DR DEQ  RM++I++ +  AYCQ
Sbjct  631  GFTILLLIGTILFNEYCRQRFARIFNSYSAQDFIELDRDDEQSGRMREIHEHLLDAYCQ  689



>dbj|BAJ90247.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=767

 Score =   150 bits (380),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQ+LNVY  +Y +GGLYW I H   IFSLVLTQII LGVFGLKKS VA+
Sbjct  562  VYFFLGYVVYRNQLLNVYRMRYDSGGLYWPIAHNTVIFSLVLTQIICLGVFGLKKSPVAA  621

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GF  P I   L FN+YCR RF P+ +  P Q L+D+DR+D +  RM+ I+  + SAY QF
Sbjct  622  GFAIPPIFFILSFNQYCRTRFLPLFKTFPTQDLIDLDREDVRSGRMEHIHHGLRSAYRQF  681



>gb|EMS66678.1| Uncharacterized membrane protein C2G11.09 [Triticum urartu]
Length=760

 Score =   150 bits (380),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQ+LNVY  +Y +GGLYW IVH   IFSLVLTQ+I  GVFGLK+S VA+
Sbjct  560  VYFFLGYVVYRNQLLNVYRMRYDSGGLYWPIVHNTVIFSLVLTQVICFGVFGLKESPVAA  619

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT P I   L F++YCR RF P+ +  P+Q L+D+DR+D++  RM+ I+  + SAY QF
Sbjct  620  GFTIPPIFFILSFHQYCRTRFLPLFKTFPSQDLIDLDREDQRSGRMEHIHHGLRSAYRQF  679



>ref|XP_009144475.1| PREDICTED: CSC1-like protein At1g10090 [Brassica rapa]
 emb|CDY31049.1| BnaA08g25990D [Brassica napus]
Length=761

 Score =   150 bits (380),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 117/186 (63%), Gaps = 16/186 (9%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY+IY+NQI+NVY+TKY++GG YW I H  TIFSL+L+Q+IALG FGLK STVAS
Sbjct  569  IYFFLAYLIYKNQIINVYITKYESGGQYWPIFHNTTIFSLILSQVIALGFFGLKLSTVAS  628

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+ +  PA+IL+ MDR DE   +M++++  + +AY Q 
Sbjct  629  GFTIPLILLTLLFSEYCRQRFAPIFQKYPAEILIAMDRADEITGKMEELHNNLKAAYSQI  688

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPDMPAGSWNGHTNLEIEEVGK**RAS  188
                       PL  +E S     +   +P     ++PA       NLE E +    R+ 
Sbjct  689  -----------PLCSQESS-----KAGCSPPCSDQELPASEQLKPENLEAEMLKAFQRSK  732

Query  187  SDQKVH  170
            S   + 
Sbjct  733  SSHDLE  738



>gb|AAC34338.1| Hypothetical protein [Arabidopsis thaliana]
Length=509

 Score =   148 bits (374),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 105/150 (70%), Gaps = 3/150 (2%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF  AY+IY+NQI+NVY+TKY++GG YW + H  TIFSL+L+Q+IALG FGLK STVAS
Sbjct  315  IYFFFAYLIYKNQIINVYITKYESGGQYWPVFHNTTIFSLILSQVIALGFFGLKLSTVAS  374

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+ +  PA+IL+ MDR DE   +M++I+  +  AY Q 
Sbjct  375  GFTIPLILLTLLFSEYCRQRFAPIFQKYPAEILIAMDRADEMTGKMEEIHNNLKVAYSQI  434

Query  367  ---RRSSVTLGSPHPLNPKEQSMLQELEDD  287
                  S   G   P + +E    +EL+ +
Sbjct  435  PTCSEESSKAGCTSPCSDQELPDSEELKPE  464



>gb|KCW68598.1| hypothetical protein EUGRSUZ_F02209 [Eucalyptus grandis]
Length=723

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 92/139 (66%), Gaps = 18/139 (13%)
 Frame = -2

Query  703  IYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASGFTFPLII  524
            +YRNQILNVY  KY+TGG  W  VH  TIFSLVL QIIALGVFGLK+S VASGFT PLII
Sbjct  576  VYRNQILNVYSPKYETGGQLWPTVHNTTIFSLVLMQIIALGVFGLKRSPVASGFTIPLII  635

Query  523  CTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQFRRSSVTLG  344
            C+LLFNEYCRQRFHP+ +N  A           Q   M++I++++ SAYCQF+       
Sbjct  636  CSLLFNEYCRQRFHPIFKNSAA-----------QSGSMEEIHRQLRSAYCQFK-------  677

Query  343  SPHPLNPKEQSMLQELEDD  287
            S H         +Q+ ED+
Sbjct  678  SGHSDQSDNGKSIQDSEDE  696



>ref|XP_003559478.1| PREDICTED: CSC1-like protein RXW8 [Brachypodium distachyon]
Length=740

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQILNVY  KY+ GG  W ++H   +FSLVL Q+IALGVF +KKS VA+
Sbjct  571  VYFCLGYLVYRNQILNVYYPKYEMGGKLWPVMHNTIVFSLVLMQVIALGVFTIKKSPVAT  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ  371
            GFT  L+I T+L++EYCRQRF  +  +  AQ L+++DR DEQ  RM+DI+Q +  AYCQ
Sbjct  631  GFTILLLIGTILYSEYCRQRFSRIFHSYSAQDLIELDRDDEQSGRMQDIHQHLLDAYCQ  689



>ref|XP_006303157.1| hypothetical protein CARUB_v10008381mg [Capsella rubella]
 gb|EOA36055.1| hypothetical protein CARUB_v10008381mg [Capsella rubella]
Length=763

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 107/156 (69%), Gaps = 6/156 (4%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY+IY+NQI+NVY+TKY++GG YW + H  TIFSL+L+Q+IALG FGLK STVAS
Sbjct  569  IYFFLAYLIYKNQIINVYITKYESGGQYWPVFHNTTIFSLILSQVIALGFFGLKLSTVAS  628

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+ +  PA+IL+ MDR DE   +M++I+  +  AY Q 
Sbjct  629  GFTIPLILLTLLFSEYCRQRFAPIFQKYPAEILIAMDRADEVSGKMEEIHNNLKVAYSQI  688

Query  367  RRSSVTLGSPHPLNPKEQSMLQELEDDVNPAALKPD  260
               S         +P+     QEL D      LKP+
Sbjct  689  PSCSQESSKACCSSPRSD---QELPDS---EQLKPE  718



>ref|NP_172480.2| Early-responsive to dehydration stress protein ERD4 [Arabidopsis 
thaliana]
 sp|Q94A87.1|CSCL9_ARATH RecName: Full=CSC1-like protein At1g10090 [Arabidopsis thaliana]
 gb|AAK83615.1| At1g10080/T27I1_10 [Arabidopsis thaliana]
 dbj|BAD44185.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD44218.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE28540.1| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis 
thaliana]
 gb|AIU34622.1| hyperosmolality-gated Ca2+ permeable channel 2.2 [Arabidopsis 
thaliana]
Length=762

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 105/150 (70%), Gaps = 3/150 (2%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF  AY+IY+NQI+NVY+TKY++GG YW + H  TIFSL+L+Q+IALG FGLK STVAS
Sbjct  568  IYFFFAYLIYKNQIINVYITKYESGGQYWPVFHNTTIFSLILSQVIALGFFGLKLSTVAS  627

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+ +  PA+IL+ MDR DE   +M++I+  +  AY Q 
Sbjct  628  GFTIPLILLTLLFSEYCRQRFAPIFQKYPAEILIAMDRADEMTGKMEEIHNNLKVAYSQI  687

Query  367  ---RRSSVTLGSPHPLNPKEQSMLQELEDD  287
                  S   G   P + +E    +EL+ +
Sbjct  688  PTCSEESSKAGCTSPCSDQELPDSEELKPE  717



>gb|AAM63909.1| unknown [Arabidopsis thaliana]
Length=762

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 105/150 (70%), Gaps = 3/150 (2%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF  AY+IY+NQI+NVY+TKY++GG YW + H  TIFSL+L+Q+IALG FGLK STVAS
Sbjct  568  IYFFFAYLIYKNQIINVYITKYESGGQYWPVFHNTTIFSLILSQVIALGFFGLKLSTVAS  627

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+ +  PA+IL+ MDR DE   +M++I+  +  AY Q 
Sbjct  628  GFTIPLILLTLLFSEYCRQRFAPIFQKYPAEILIAMDRADEMTGKMEEIHNNLKVAYSQI  687

Query  367  ---RRSSVTLGSPHPLNPKEQSMLQELEDD  287
                  S   G   P + +E    +EL+ +
Sbjct  688  PTCSEESSKAGCTSPCSDQELPDSEELKPE  717



>dbj|BAD43330.1| unnamed protein product [Arabidopsis thaliana]
Length=762

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 105/150 (70%), Gaps = 3/150 (2%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF  AY+IY+NQI+NVY+TKY++GG YW + H  TIFSL+L+Q+IALG FGLK STVAS
Sbjct  568  IYFFFAYLIYKNQIINVYITKYESGGQYWPVFHNTTIFSLILSQVIALGFFGLKLSTVAS  627

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+ +  PA+IL+ MDR DE   +M++I+  +  AY Q 
Sbjct  628  GFTIPLILLTLLFSEYCRQRFAPIFQKYPAEILIAMDRADEMTGKMEEIHNNLKVAYSQI  687

Query  367  ---RRSSVTLGSPHPLNPKEQSMLQELEDD  287
                  S   G   P + +E    +EL+ +
Sbjct  688  PTCSEESSKAGCTSPCSDQELPDSEELKPE  717



>ref|XP_010490656.1| PREDICTED: CSC1-like protein At1g10090 [Camelina sativa]
Length=765

 Score =   148 bits (374),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 108/152 (71%), Gaps = 5/152 (3%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF  AY++Y+NQI+NVY+TKY++GG YW + H  TIFSL+L+Q+IALG FGLK STVAS
Sbjct  569  IYFFFAYLVYKNQIINVYITKYESGGQYWPVFHNTTIFSLILSQVIALGFFGLKLSTVAS  628

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+ +  PA+IL+ MDR DE + +M +I+  + +AY Q 
Sbjct  629  GFTIPLILLTLLFSEYCRQRFAPIFQKYPAEILIAMDRADEVKGKMDEIHNNLKAAYSQI  688

Query  367  -----RRSSVTLGSPHPLNPKEQSMLQELEDD  287
                  + S   G   P + +E S  ++L+ +
Sbjct  689  PSLSCSQESSKAGCSSPGSDQELSDSEQLKPE  720



>ref|XP_006417497.1| hypothetical protein EUTSA_v10006880mg [Eutrema salsugineum]
 gb|ESQ35850.1| hypothetical protein EUTSA_v10006880mg [Eutrema salsugineum]
Length=764

 Score =   148 bits (373),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 110/150 (73%), Gaps = 3/150 (2%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAY+IY+NQI+NVY+TKY++GG YW + H  TIFSL+L+Q+IALG FGLK STVAS
Sbjct  570  IYFFLAYLIYKNQIINVYITKYESGGQYWPVFHNTTIFSLILSQVIALGFFGLKLSTVAS  629

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            GFT PLI+ TLLF+EYCRQRF P+ +  PA++L+ MDR+DE   +M++++  + +AY Q 
Sbjct  630  GFTIPLILLTLLFSEYCRQRFAPIFQKYPAEVLIAMDREDEITGKMEELHSNLKAAYSQI  689

Query  367  ---RRSSVTLGSPHPLNPKEQSMLQELEDD  287
                + S   G   P + +E  + ++L+ +
Sbjct  690  PSCSQESSKDGCSPPCSDQELPVSEQLKPE  719



>ref|XP_003621301.1| Membrane protein, putative [Medicago truncatula]
 gb|ABN08272.1| Protein of unknown function DUF221 [Medicago truncatula]
 gb|AES77519.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=790

 Score =   148 bits (373),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L YIIYRNQ+L VYV K++TGG +W IVH  TIFS+VL  II +G+FGLK+  +AS
Sbjct  570  VYFCLGYIIYRNQLLYVYVQKFETGGEFWPIVHNCTIFSMVLMHIIVIGIFGLKELPIAS  629

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
            GFT PL I TLLFNEYC++RF P+    PA+ L+  DR D+ +  M + Y K+T+AY
Sbjct  630  GFTLPLPIVTLLFNEYCQKRFIPIFNAYPAECLIKKDRADQNDPNMSEFYDKLTNAY  686



>ref|XP_010458341.1| PREDICTED: CSC1-like protein At1g10090 [Camelina sativa]
 ref|XP_010458342.1| PREDICTED: CSC1-like protein At1g10090 [Camelina sativa]
Length=765

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF  AY++Y+NQI+NVY+TKY++GG YW I H  TIFSL+L+Q+IALG FGLK STVAS
Sbjct  569  IYFFFAYLVYKNQIINVYITKYESGGQYWPIFHNTTIFSLILSQVIALGFFGLKLSTVAS  628

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ  371
            GFT PLI+ TLLF+EYCRQRF P+ +  PA+IL+ MDR DE + +M +I+  + +AY Q
Sbjct  629  GFTIPLILLTLLFSEYCRQRFAPIFQKYPAEILIAMDRADEVKGKMDEIHNNLKAAYSQ  687



>gb|KJB64004.1| hypothetical protein B456_010G028700 [Gossypium raimondii]
Length=736

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 111/150 (74%), Gaps = 4/150 (3%)
 Frame = -2

Query  703  IYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASGFTFPLII  524
            +YRNQILNVYV KY++GG +W IVH + IFSL+LTQ+IALGVFG+K+S VASGF  PLI+
Sbjct  579  VYRNQILNVYVRKYESGGEFWPIVHNSAIFSLLLTQVIALGVFGIKQSPVASGFIIPLIL  638

Query  523  CTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ--FRRSSVT  350
             TLLFNEYCRQRF PV +  PAQIL++MD++DEQ  R ++I+ ++ SAY Q       V+
Sbjct  639  LTLLFNEYCRQRFSPVFKRRPAQILIEMDQQDEQLGRKEEIHNQIRSAYFQNPIISHQVS  698

Query  349  LGSPHPLNPKEQSMLQELEDDVNP-AALKP  263
            + S  PL+ +  S  Q  ED+++   +LKP
Sbjct  699  INSNLPLS-RNTSHHQGDEDNLHGLKSLKP  727



>ref|XP_007018412.1| Lipases,hydrolases, acting on ester bonds isoform 3 [Theobroma 
cacao]
 gb|EOY15637.1| Lipases,hydrolases, acting on ester bonds isoform 3 [Theobroma 
cacao]
Length=497

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LA+++YRNQIL+VYV+KY+ GG +W IVH  TIFSLVLTQIIALGVFG+K+S VAS
Sbjct  404  VYFFLAFLVYRNQILHVYVSKYECGGQFWPIVHNTTIFSLVLTQIIALGVFGIKQSPVAS  463

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQIL  449
            GFT PLI  TLLFNEYCRQRF PV ++ PAQ+ 
Sbjct  464  GFTIPLIFFTLLFNEYCRQRFSPVFKSSPAQVF  496



>gb|KDO72652.1| hypothetical protein CISIN_1g014468mg [Citrus sinensis]
Length=424

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY+ L YIIYRNQ+LNVY  K++TGG +W IVH +TIFSL+L  +IA+G+FGLKK  +AS
Sbjct  281  VYYCLGYIIYRNQLLNVYAPKFETGGKFWPIVHNSTIFSLLLMHVIAIGIFGLKKLPLAS  340

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
                PL + TLLFNEYCR+RF P+    P + LV  DR+D+ +  M + Y+K+ +AY
Sbjct  341  SLVIPLPVLTLLFNEYCRKRFLPIFEAYPTECLVKKDREDQNDATMAEFYEKLVTAY  397



>gb|KJB64002.1| hypothetical protein B456_010G028700 [Gossypium raimondii]
Length=758

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 111/150 (74%), Gaps = 4/150 (3%)
 Frame = -2

Query  703  IYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASGFTFPLII  524
            +YRNQILNVYV KY++GG +W IVH + IFSL+LTQ+IALGVFG+K+S VASGF  PLI+
Sbjct  601  VYRNQILNVYVRKYESGGEFWPIVHNSAIFSLLLTQVIALGVFGIKQSPVASGFIIPLIL  660

Query  523  CTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ--FRRSSVT  350
             TLLFNEYCRQRF PV +  PAQIL++MD++DEQ  R ++I+ ++ SAY Q       V+
Sbjct  661  LTLLFNEYCRQRFSPVFKRRPAQILIEMDQQDEQLGRKEEIHNQIRSAYFQNPIISHQVS  720

Query  349  LGSPHPLNPKEQSMLQELEDDVNP-AALKP  263
            + S  PL+ +  S  Q  ED+++   +LKP
Sbjct  721  INSNLPLS-RNTSHHQGDEDNLHGLKSLKP  749



>ref|XP_010661094.1| PREDICTED: CSC1-like protein HYP1 isoform X3 [Vitis vinifera]
Length=651

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LAYI+YRNQ+LNV+  KY+TGG +W IVH +TIFSLVL  IIA+G+FGLKK  +AS
Sbjct  508  VYFCLAYIVYRNQLLNVFAPKYETGGKFWPIVHNSTIFSLVLMHIIAIGIFGLKKLPLAS  567

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL + TLLFNE+CR+RF P+ R+  A+ L++ DR+D+++  M +   K+ +AY
Sbjct  568  SLTIPLPVLTLLFNEFCRKRFLPIFRDYSAECLINKDREDQRDPTMVEFRDKLVTAY  624



>gb|KHG12367.1| Membrane protein [Gossypium arboreum]
Length=703

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 110/150 (73%), Gaps = 4/150 (3%)
 Frame = -2

Query  703  IYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASGFTFPLII  524
            +YRNQILNVYV KY++GG +W IVH + IFSL+LTQ+IALG+FG+K+S VASGF  PLI+
Sbjct  546  VYRNQILNVYVRKYESGGEFWPIVHNSAIFSLLLTQVIALGIFGIKRSPVASGFIIPLIL  605

Query  523  CTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ--FRRSSVT  350
             TLLFNEYCRQRF PV +  PAQIL++MD++DEQ  R ++I  ++ SAY Q       V+
Sbjct  606  LTLLFNEYCRQRFSPVFKRRPAQILIEMDQQDEQLGRKEEIRNQIRSAYFQNPIISHQVS  665

Query  349  LGSPHPLNPKEQSMLQELEDDVNP-AALKP  263
            + S  PL+ +  S  Q  ED+++   +LKP
Sbjct  666  INSNLPLS-RNTSHHQGDEDNLHGLKSLKP  694



>ref|XP_010661092.1| PREDICTED: CSC1-like protein HYP1 isoform X1 [Vitis vinifera]
Length=714

 Score =   145 bits (365),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LAYI+YRNQ+LNV+  KY+TGG +W IVH +TIFSLVL  IIA+G+FGLKK  +AS
Sbjct  571  VYFCLAYIVYRNQLLNVFAPKYETGGKFWPIVHNSTIFSLVLMHIIAIGIFGLKKLPLAS  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL + TLLFNE+CR+RF P+ R+  A+ L++ DR+D+++  M +   K+ +AY
Sbjct  631  SLTIPLPVLTLLFNEFCRKRFLPIFRDYSAECLINKDREDQRDPTMVEFRDKLVTAY  687



>ref|XP_007018411.1| Lipases,hydrolases, acting on ester bonds isoform 2 [Theobroma 
cacao]
 gb|EOY15636.1| Lipases,hydrolases, acting on ester bonds isoform 2 [Theobroma 
cacao]
Length=665

 Score =   144 bits (363),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LA+++YRNQIL+VYV+KY+ GG +W IVH  TIFSLVLTQIIALGVFG+K+S VAS
Sbjct  567  VYFFLAFLVYRNQILHVYVSKYECGGQFWPIVHNTTIFSLVLTQIIALGVFGIKQSPVAS  626

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQI  452
            GFT PLI  TLLFNEYCRQRF PV ++ PAQ+
Sbjct  627  GFTIPLIFFTLLFNEYCRQRFSPVFKSSPAQV  658



>ref|XP_007032618.1| Early-responsive to dehydration stress protein (ERD4), putative 
isoform 2 [Theobroma cacao]
 gb|EOY03544.1| Early-responsive to dehydration stress protein (ERD4), putative 
isoform 2 [Theobroma cacao]
Length=594

 Score =   143 bits (361),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY+ L YIIYRNQ LNVY +K++TGG +W IVH +TIFSLVL  IIA+G+FGLKK  +AS
Sbjct  451  VYYCLGYIIYRNQFLNVYASKFETGGKFWPIVHNSTIFSLVLMHIIAIGIFGLKKLPLAS  510

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              + PL + TL+FNEYCR+RF P+ +  P + L+  DR+D+ +  M +  +K+ +AY
Sbjct  511  SLSIPLPVLTLIFNEYCRKRFRPIFKAYPTECLIKKDREDQNDPTMTEFLEKLATAY  567



>ref|XP_002463956.1| hypothetical protein SORBIDRAFT_01g009540 [Sorghum bicolor]
 gb|EER90954.1| hypothetical protein SORBIDRAFT_01g009540 [Sorghum bicolor]
Length=677

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQILNVY  KY+ GG  W I+H   +FSLVLTQ+IALGVF +K S VA+
Sbjct  501  VYFCLGYLVYRNQILNVYYPKYEMGGKLWPIMHNTIVFSLVLTQVIALGVFTIKHSPVAA  560

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ  371
            GFT  L++ T+LFNEYCR RF  +     AQ ++++DR DEQ  RM++I+Q +  AY Q
Sbjct  561  GFTILLLVGTVLFNEYCRHRFSRIFEAYSAQDVIELDRDDEQSGRMQEIHQHLLDAYSQ  619



>ref|XP_008644541.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
 ref|XP_008644542.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
 gb|AFW67743.1| hypothetical protein ZEAMMB73_500032 [Zea mays]
Length=749

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQILNVY  KY+ GG  W ++H A +FSLVLTQ+IALGVF +K+S V +
Sbjct  572  VYFCLGYLVYRNQILNVYYPKYEMGGKLWPVMHNAIVFSLVLTQVIALGVFTIKRSPVTA  631

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ  371
            GFT  L++ T+LFNEYCR RF  +     AQ ++++DR DEQ  RM++I+Q +  AY Q
Sbjct  632  GFTILLLVGTVLFNEYCRHRFSRIFEAYSAQDVIELDRDDEQSGRMQEIHQHLLDAYSQ  690



>ref|XP_002530016.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32378.1| conserved hypothetical protein [Ricinus communis]
Length=717

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF L YII+RNQ+LNVY  KY+T G +W IVH +T+FSL+L  +IA+G FGLKK  +AS
Sbjct  575  IYFCLGYIIFRNQLLNVYAPKYETSGKFWPIVHYSTVFSLILMHVIAIGTFGLKKLPLAS  634

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL + TLLFNEYCR+RF P+ +  P + LV  D++DE E  M + Y K+ SAY
Sbjct  635  SLTIPLPVLTLLFNEYCRKRFLPIFKAYPTECLVTKDKEDENEPSMAEFYDKLVSAY  691



>ref|XP_008230811.1| PREDICTED: phosphate metabolism protein 7 isoform X2 [Prunus 
mume]
Length=596

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY  L YIIYRNQ+LNVY  KY TGG +W  VH +TIFSLVL  +IA+G+FGLKK ++AS
Sbjct  454  VYCCLGYIIYRNQLLNVYAPKYDTGGRFWPTVHNSTIFSLVLMHVIAIGIFGLKKLSLAS  513

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I TLLFNEYCR+RF P+ ++ P + L+  DR+D+ +  +   Y K+++AY
Sbjct  514  SLTVPLPIVTLLFNEYCRKRFLPIFKDYPVECLIKKDREDQNDPTIAVFYDKLSTAY  570



>emb|CBI22257.3| unnamed protein product [Vitis vinifera]
Length=917

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF LAYI+YRNQ+LNV+  KY+TGG +W IVH +TIFSLVL  IIA+G+FGLKK  +AS
Sbjct  774  VYFCLAYIVYRNQLLNVFAPKYETGGKFWPIVHNSTIFSLVLMHIIAIGIFGLKKLPLAS  833

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL + TLLFNE+CR+RF P+ R+  A+ L++ DR+D+++  M +   K+ +AY
Sbjct  834  SLTIPLPVLTLLFNEFCRKRFLPIFRDYSAECLINKDREDQRDPTMVEFRDKLVTAY  890



>ref|XP_009147396.1| PREDICTED: CSC1-like protein HYP1 [Brassica rapa]
Length=713

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y+IYRNQ+LNVY  KY+TGG +W IVH +TIFSLVL  IIA+G+FGLKK  +AS
Sbjct  570  VYFCLGYVIYRNQLLNVYEAKYETGGKFWPIVHSSTIFSLVLMHIIAIGLFGLKKLPLAS  629

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL + TLLF+ YC++RF P  ++ P + LV+ D+ DE+EE M + Y K+  AY
Sbjct  630  SLTIPLPVLTLLFSIYCQRRFLPNFKSYPTECLVNKDKADEREENMSEFYSKLVVAY  686



>ref|XP_007032617.1| Early-responsive to dehydration stress protein (ERD4), putative 
isoform 1 [Theobroma cacao]
 gb|EOY03543.1| Early-responsive to dehydration stress protein (ERD4), putative 
isoform 1 [Theobroma cacao]
Length=714

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY+ L YIIYRNQ LNVY +K++TGG +W IVH +TIFSLVL  IIA+G+FGLKK  +AS
Sbjct  571  VYYCLGYIIYRNQFLNVYASKFETGGKFWPIVHNSTIFSLVLMHIIAIGIFGLKKLPLAS  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              + PL + TL+FNEYCR+RF P+ +  P + L+  DR+D+ +  M +  +K+ +AY
Sbjct  631  SLSIPLPVLTLIFNEYCRKRFRPIFKAYPTECLIKKDREDQNDPTMTEFLEKLATAY  687



>ref|XP_009360589.1| PREDICTED: CSC1-like protein HYP1 [Pyrus x bretschneideri]
Length=716

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 91/132 (69%), Gaps = 4/132 (3%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY  L YII+RNQ LNVY  KY+TGG +W  VH +TIFSLVL  IIA+G+FGLK+  +A+
Sbjct  574  VYCCLGYIIFRNQFLNVYEPKYETGGRFWPTVHNSTIFSLVLMHIIAIGMFGLKEIPLAA  633

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
            G   PL I TLLFNEYCR+RF P+ ++ PA+ L+  DR+DE++  +   Y+K+T+AY   
Sbjct  634  GLIIPLPILTLLFNEYCRKRFLPIFQDYPAECLIKKDREDEKDPTISAFYEKLTTAY---  690

Query  367  RRSSVTLGSPHP  332
             R    L   HP
Sbjct  691  -RDPALLPMQHP  701



>ref|XP_006482641.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X1 [Citrus sinensis]
 ref|XP_006482642.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X2 [Citrus sinensis]
 ref|XP_006482643.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X3 [Citrus sinensis]
 ref|XP_006482644.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X4 [Citrus sinensis]
Length=714

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY+ L YIIYRNQ+LNVY  K++TGG +W IVH +TIFSL+L  +IA+G+FGLKK  +AS
Sbjct  571  VYYCLGYIIYRNQLLNVYAPKFETGGKFWPIVHNSTIFSLLLMHVIAIGIFGLKKLPLAS  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
                PL + TLLFNEYCR+RF P+    P + LV  DR+D+ +  M + Y+K+ +AY
Sbjct  631  SLVIPLPVLTLLFNEYCRKRFLPIFEAYPTECLVKKDREDQNDPTMAEFYEKLVTAY  687



>gb|KDP27183.1| hypothetical protein JCGZ_19882 [Jatropha curcas]
Length=717

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 88/128 (69%), Gaps = 0/128 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF L YII+RNQ+LNVY  KY+T G YW IVH +TIFSL+L  +IA+G+FG+K   +AS
Sbjct  575  IYFCLGYIIFRNQLLNVYAPKYETSGKYWPIVHNSTIFSLILMHVIAIGLFGIKDLPLAS  634

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQF  368
              T PL + TL+FNEYCR+RF P+    P++ LV  D++D+ E  M + Y K+ +AY   
Sbjct  635  SLTIPLPVLTLIFNEYCRKRFRPIFNGYPSECLVKRDKEDQNEPNMAEFYDKLVTAYRDP  694

Query  367  RRSSVTLG  344
              + V LG
Sbjct  695  ALAPVQLG  702



>emb|CDY37544.1| BnaA05g34090D [Brassica napus]
Length=792

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y+IYRNQ+LNVY  KY+TGG +W IVH +TIFSLVL  IIA+G+FGLKK  +AS
Sbjct  649  VYFCLGYVIYRNQLLNVYEAKYETGGKFWPIVHSSTIFSLVLMHIIAIGLFGLKKLPLAS  708

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL + TLLF+ YC++RF P  ++ P + LV+ D+ DE+EE M + Y K+  AY
Sbjct  709  SLTIPLPVLTLLFSIYCQRRFLPNFKSYPTECLVNKDKADEREENMSEFYSKLVVAY  765



>ref|XP_008379386.1| PREDICTED: phosphate metabolism protein 7-like [Malus domestica]
Length=716

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY  L YII+RNQ LNVY  KY+T G +W  VH +TIF+LVL  IIA+G+FGLKK  +AS
Sbjct  574  VYCCLGYIIFRNQFLNVYAPKYETXGKFWPTVHNSTIFALVLMHIIAIGMFGLKKVPLAS  633

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I TLLFNEYCR+RF P+ +  PA+ L+  DR+DE + R+   Y+K+++AY
Sbjct  634  SLTIPLPILTLLFNEYCRKRFLPIFKAYPAECLIKKDREDENDRRISTFYEKLSTAY  690



>gb|EEC76105.1| hypothetical protein OsI_13363 [Oryza sativa Indica Group]
Length=743

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQILNVY  KY+ GG  W I+H   +F+LVLTQ IALGVF +K +T++S
Sbjct  571  VYFCLGYLVYRNQILNVYYPKYEMGGKLWPIMHSTLVFALVLTQTIALGVFTIKHATISS  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ  371
            GFT  LII T+LF++YCR RF  +  +  AQ L++MDR DEQ  RM++I++ +  AY Q
Sbjct  631  GFTILLIIGTVLFHQYCRHRFSSIFNSFSAQDLIEMDRDDEQSGRMEEIHKHLLDAYSQ  689



>ref|XP_006650526.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Oryza 
brachyantha]
Length=743

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 100/159 (63%), Gaps = 11/159 (7%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQILNVY  KY+ GG  W I+H A +F+L+LTQ IALGVF +K + VA+
Sbjct  571  VYFCLGYLVYRNQILNVYYPKYEMGGKLWPIMHTALVFALLLTQTIALGVFTIKHAPVAA  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ-  371
            GFT  L+I T LFNEYCR RF  +  +  AQ L+++DR DE   RM++I+Q +  AY Q 
Sbjct  631  GFTILLLIGTFLFNEYCRHRFSSIFNSCSAQDLIELDRDDELSGRMEEIHQHLLDAYSQG  690

Query  370  -----FRRSSVTLGSPHPL---NPKE--QSMLQELEDDV  284
                   RSS   G P  +   +P +  Q   QEL D V
Sbjct  691  SYNTDISRSSRNAGGPIEMVMDDPAKDAQDSNQELCDTV  729



>ref|NP_001051134.1| Os03g0726300 [Oryza sativa Japonica Group]
 gb|AAS07159.1| expressed protein [Oryza sativa Japonica Group]
 gb|AAT77082.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF98645.1| early-responsive to dehydration protein, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13048.1| Os03g0726300 [Oryza sativa Japonica Group]
 dbj|BAG92902.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AIU34634.1| hyperosmolality-gated Ca2+ permeable channel 2.3 [Oryza sativa]
Length=743

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQILNVY  KY+ GG  W I+H   +F+LVLTQ IALGVF +K +T++S
Sbjct  571  VYFCLGYLVYRNQILNVYYPKYEMGGKLWPIMHSTLVFALVLTQTIALGVFTIKHATISS  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ  371
            GFT  LII T+LF++YCR RF  +  +  AQ L++MDR DEQ  RM++I++ +  AY Q
Sbjct  631  GFTVLLIIGTVLFHQYCRHRFSSIFNSFSAQDLIEMDRDDEQSGRMEEIHKHLLDAYSQ  689



>gb|EEE59847.1| hypothetical protein OsJ_12422 [Oryza sativa Japonica Group]
Length=738

 Score =   142 bits (358),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQILNVY  KY+ GG  W I+H   +F+LVLTQ IALGVF +K +T++S
Sbjct  588  VYFCLGYLVYRNQILNVYYPKYEMGGKLWPIMHSTLVFALVLTQTIALGVFTIKHATISS  647

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ  371
            GFT  LII T+LF++YCR RF  +  +  AQ L++MDR DEQ  RM++I++ +  AY Q
Sbjct  648  GFTVLLIIGTVLFHQYCRHRFSSIFNSFSAQDLIEMDRDDEQSGRMEEIHKHLLDAYSQ  706



>ref|XP_008230810.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X1 
[Prunus mume]
Length=724

 Score =   142 bits (357),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY  L YIIYRNQ+LNVY  KY TGG +W  VH +TIFSLVL  +IA+G+FGLKK ++AS
Sbjct  582  VYCCLGYIIYRNQLLNVYAPKYDTGGRFWPTVHNSTIFSLVLMHVIAIGIFGLKKLSLAS  641

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I TLLFNEYCR+RF P+ ++ P + L+  DR+D+ +  +   Y K+++AY
Sbjct  642  SLTVPLPIVTLLFNEYCRKRFLPIFKDYPVECLIKKDREDQNDPTIAVFYDKLSTAY  698



>ref|XP_006431218.1| hypothetical protein CICLE_v10011183mg [Citrus clementina]
 gb|ESR44458.1| hypothetical protein CICLE_v10011183mg [Citrus clementina]
Length=714

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY+ L YIIYRNQ+LNVY  K++TGG +W IVH +TIFSL+L  +IA+G+FGLKK  +AS
Sbjct  571  VYYCLGYIIYRNQLLNVYAPKFETGGKFWPIVHNSTIFSLLLMHVIAIGIFGLKKLPLAS  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
                PL + TLLFNEYCR+RF P+    P + LV  DR+D+ +  M + Y K+ +AY
Sbjct  631  SLVIPLPVLTLLFNEYCRKRFLPIFEAYPTECLVKKDREDQNDATMAEFYGKLVTAY  687



>ref|XP_007216321.1| hypothetical protein PRUPE_ppa019884mg [Prunus persica]
 gb|EMJ17520.1| hypothetical protein PRUPE_ppa019884mg [Prunus persica]
Length=757

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY  L YIIYRNQ+LNVY  KY+TGG +W  VH +TIFSLVL  +IA+G+FGLKK ++AS
Sbjct  615  VYCCLGYIIYRNQLLNVYAPKYETGGRFWPTVHNSTIFSLVLMHVIAIGIFGLKKLSLAS  674

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I TLLFNEYCR+RF P+ ++ P + L+  DR+D+ +  +   Y K+ +AY
Sbjct  675  SLTVPLPILTLLFNEYCRKRFLPIFKDYPVECLIKKDREDQNDPTIAVFYDKLRTAY  731



>ref|XP_002305383.1| HYPOTHETICAL protein 1 [Populus trichocarpa]
 gb|EEE85894.1| HYPOTHETICAL protein 1 [Populus trichocarpa]
Length=716

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 90/137 (66%), Gaps = 7/137 (5%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L YII+RNQ+LNVY  KY+T G++W IVH +TIFSL+L  IIA+G+FGLKK  +AS
Sbjct  573  VYFCLGYIIFRNQLLNVYAPKYETAGMFWPIVHNSTIFSLILMHIIAIGIFGLKKLPLAS  632

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY---  377
                PL + TL+FN YC++RF P+ +  P + L+  DRKD  E  M + Y K+ +AY   
Sbjct  633  SLIIPLPVLTLIFNAYCQKRFLPLFKAYPTECLIKKDRKDLNEAGMTEFYDKLVTAYQDP  692

Query  376  ----CQFRRSSVTLGSP  338
                 Q+ RSS    SP
Sbjct  693  ALRPVQYARSSDRDTSP  709



>ref|XP_010670228.1| PREDICTED: CSC1-like protein HYP1 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=650

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 91/137 (66%), Gaps = 7/137 (5%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF + Y+I+RNQ+LNVY  KY+TGG YW IVH +TI SLVL  IIA G+FGLK   +AS
Sbjct  507  VYFCMGYLIFRNQLLNVYAPKYETGGNYWPIVHNSTILSLVLMHIIAFGIFGLKVLPLAS  566

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY---  377
                PL I TLLFNEYCR+RF P+ +  PA+ L+  DR++  + RM +  +K+ SAY   
Sbjct  567  TLIIPLPILTLLFNEYCRKRFLPLFKAFPAECLIKKDREEHNDPRMGEFLEKLMSAYEDP  626

Query  376  ----CQFRRSSVTLGSP  338
                 Q+ R++ +  SP
Sbjct  627  VLKPTQYSRNADSQTSP  643



>ref|XP_004981918.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X1 [Setaria italica]
 ref|XP_004981919.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X2 [Setaria italica]
Length=746

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQILNVY  KY+ GG  W I+H   +FSLVL Q+IALG+F +K S VA+
Sbjct  571  VYFCLGYLVYRNQILNVYYPKYEMGGKLWPIMHNTIVFSLVLMQVIALGIFTIKHSPVAT  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ  371
            GFT  L++ T+LFNEYCR RF  +     AQ ++++DR DEQ  RM++I+Q +  AY Q
Sbjct  631  GFTILLLVGTVLFNEYCRHRFSRIFEAYSAQDVIELDRDDEQSGRMQEIHQHLQDAYSQ  689



>ref|XP_008341608.1| PREDICTED: phosphate metabolism protein 7-like [Malus domestica]
Length=716

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 87/117 (74%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY  L YII+RNQ LNVY  KY+TGG +W  VH +TIFSLVL  IIA+G+FGLK+  +A+
Sbjct  574  VYCCLGYIIFRNQFLNVYEPKYETGGRFWPTVHNSTIFSLVLMHIIAIGMFGLKELPLAA  633

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I TLLFNEYCR+RF P+ ++ PA+ L+  DR+DE++  +   Y+K+T+AY
Sbjct  634  TLTIPLPILTLLFNEYCRKRFLPIFQDYPAECLIKKDREDEKDPTIFAFYEKLTTAY  690



>emb|CAA56145.1| HYP1 [Arabidopsis thaliana]
Length=468

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY+ L YIIYRNQ+LNVY  KY+TGG +W IVH  TIFSLVL  IIA+G+FGLK+  VAS
Sbjct  336  VYYCLGYIIYRNQVLNVYAAKYETGGKFWPIVHSYTIFSLVLMHIIAVGLFGLKELPVAS  395

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL + T+LF+ YC++RF P  ++ P Q LV+ D+ DE+E+ M + Y ++  AY
Sbjct  396  SLTIPLPVLTVLFSIYCQRRFLPNFKSYPTQCLVNKDKADEREQNMSEFYSELVVAY  452



>emb|CDY43268.1| BnaC05g48610D [Brassica napus]
Length=713

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y+IYRNQ+LNVY  KY+TGG +W IVH +TIFSLVL  IIA+G+FGLKK  +AS
Sbjct  570  VYFCLGYVIYRNQLLNVYEAKYETGGKFWPIVHSSTIFSLVLMHIIAIGLFGLKKLPLAS  629

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL + TLLF+ YC++RF P  ++ P + LV+ D+ DE+EE M + + ++  AY
Sbjct  630  SLTIPLPVLTLLFSIYCQRRFLPNFKSYPTECLVNKDKADEREENMSEFFSELVVAY  686



>ref|XP_010670229.1| PREDICTED: CSC1-like protein HYP1 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=713

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 91/137 (66%), Gaps = 7/137 (5%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF + Y+I+RNQ+LNVY  KY+TGG YW IVH +TI SLVL  IIA G+FGLK   +AS
Sbjct  570  VYFCMGYLIFRNQLLNVYAPKYETGGNYWPIVHNSTILSLVLMHIIAFGIFGLKVLPLAS  629

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY---  377
                PL I TLLFNEYCR+RF P+ +  PA+ L+  DR++  + RM +  +K+ SAY   
Sbjct  630  TLIIPLPILTLLFNEYCRKRFLPLFKAFPAECLIKKDREEHNDPRMGEFLEKLMSAYEDP  689

Query  376  ----CQFRRSSVTLGSP  338
                 Q+ R++ +  SP
Sbjct  690  VLKPTQYSRNADSQTSP  706



>ref|XP_004304272.1| PREDICTED: CSC1-like protein HYP1 [Fragaria vesca subsp. vesca]
Length=716

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 90/141 (64%), Gaps = 4/141 (3%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY  + Y+IYRNQ+LNVY  KY TGG +W IVH +TIFSLVL  IIA+G+FG+K   +AS
Sbjct  575  VYCCMGYLIYRNQLLNVYAPKYDTGGKFWPIVHGSTIFSLVLMHIIAIGMFGIKDLALAS  634

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQ-  371
                PL I TLLFNEYCR+RF P+  + P + LV  D++D+ +  M   Y K+++AY   
Sbjct  635  SLMVPLPILTLLFNEYCRKRFLPIFESYPVECLVKKDKEDQSDPSMDAFYDKLSTAYEDP  694

Query  370  ---FRRSSVTLGSPHPLNPKE  317
                RR   T G   PL P E
Sbjct  695  ALIPRRQRSTDGHNSPLLPAE  715



>gb|AAF26164.1|AC008261_21 unknown protein [Arabidopsis thaliana]
 emb|CAA55187.1| HYP1 [Arabidopsis thaliana]
Length=468

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY+ L YIIYRNQ+LNVY  KY+TGG +W IVH  TIFSLVL  IIA+G+FGLK+  VAS
Sbjct  336  VYYCLGYIIYRNQLLNVYAAKYETGGKFWPIVHSYTIFSLVLMHIIAVGLFGLKELPVAS  395

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL + T+LF+ YC++RF P  ++ P Q LV+ D+ DE+E+ M + Y ++  AY
Sbjct  396  SLTIPLPVLTVLFSIYCQRRFLPNFKSYPTQCLVNKDKADEREQNMSEFYSELVVAY  452



>gb|KJB80261.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
Length=645

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 89/137 (65%), Gaps = 7/137 (5%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY  LAYIIYRNQ LNVY  KY+T G +W IVH + IFSLVL Q IA+G+F LKK  +AS
Sbjct  500  VYLCLAYIIYRNQFLNVYAPKYETAGKFWPIVHNSMIFSLVLMQAIAIGLFTLKKLPLAS  559

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY---  377
               FPL + TLLFNEYCR+RF P     PA++L+  DR+D  + +M + Y  + +AY   
Sbjct  560  TLIFPLPVLTLLFNEYCRKRFLPNFIAYPAEVLIKRDREDRYDPKMAEFYDNLVAAYQDP  619

Query  376  ----CQFRRSSVTLGSP  338
                 QF  +S +L SP
Sbjct  620  ALLPIQFSANSDSLNSP  636



>gb|KJB75683.1| hypothetical protein B456_012G051600 [Gossypium raimondii]
Length=628

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY  L YIIYRNQ LNVY  K++TGG +W IVH +TIFSLVL  +IA+G+FGLKK  +AS
Sbjct  485  VYCCLGYIIYRNQFLNVYAPKFETGGKFWPIVHNSTIFSLVLMHVIAIGIFGLKKLPLAS  544

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I TL+FN YCR+RF P+ +  P + L+  DRKD+ +  M +  +K+ +AY
Sbjct  545  SLTIPLPILTLVFNAYCRKRFLPIFKAYPTECLIKKDRKDQDDPTMTEFLEKLATAY  601



>ref|XP_009407408.1| PREDICTED: CSC1-like protein HYP1 [Musa acuminata subsp. malaccensis]
Length=714

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            V+F + YIIYRNQ+LNVY  KY TGG +W IVH  TIFSL+L QI+A+G+FGLKK  +AS
Sbjct  573  VFFCIGYIIYRNQLLNVYQPKYDTGGRFWPIVHNTTIFSLILMQILAVGIFGLKKLPLAS  632

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
                PL + TLLFN+YCR+RF P+  +  A+ L+  DR+D+ +  M++ + K+ +AY
Sbjct  633  SLILPLPVLTLLFNDYCRKRFLPIFHDFAAETLIKKDREDQNDPAMEEFFDKLITAY  689



>ref|XP_011098667.1| PREDICTED: CSC1-like protein HYP1 isoform X1 [Sesamum indicum]
 ref|XP_011098668.1| PREDICTED: CSC1-like protein HYP1 isoform X1 [Sesamum indicum]
Length=719

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY+ L Y+IYRNQ+LNVY  K++TGG +W +VH ATIFSL+L  +IA+G+FGLKK  +AS
Sbjct  576  VYYCLGYVIYRNQLLNVYAPKFETGGKFWPVVHDATIFSLILMHVIAIGIFGLKKVPLAS  635

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I TL+FN YCR+RF P  ++ PA+ L++ DR D+ +  +   Y ++ +AY
Sbjct  636  SLTIPLPILTLIFNSYCRRRFLPSFKSYPAECLINKDRFDQSDPSISSFYDELATAY  692



>gb|KJB75678.1| hypothetical protein B456_012G051600 [Gossypium raimondii]
 gb|KJB75679.1| hypothetical protein B456_012G051600 [Gossypium raimondii]
 gb|KJB75680.1| hypothetical protein B456_012G051600 [Gossypium raimondii]
 gb|KJB75681.1| hypothetical protein B456_012G051600 [Gossypium raimondii]
 gb|KJB75682.1| hypothetical protein B456_012G051600 [Gossypium raimondii]
Length=715

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY  L YIIYRNQ LNVY  K++TGG +W IVH +TIFSLVL  +IA+G+FGLKK  +AS
Sbjct  572  VYCCLGYIIYRNQFLNVYAPKFETGGKFWPIVHNSTIFSLVLMHVIAIGIFGLKKLPLAS  631

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I TL+FN YCR+RF P+ +  P + L+  DRKD+ +  M +  +K+ +AY
Sbjct  632  SLTIPLPILTLVFNAYCRKRFLPIFKAYPTECLIKKDRKDQDDPTMTEFLEKLATAY  688



>gb|KJB80259.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
 gb|KJB80262.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
 gb|KJB80263.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
 gb|KJB80264.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
 gb|KJB80265.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
 gb|KJB80266.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
 gb|KJB80267.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
Length=715

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 89/137 (65%), Gaps = 7/137 (5%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY  LAYIIYRNQ LNVY  KY+T G +W IVH + IFSLVL Q IA+G+F LKK  +AS
Sbjct  570  VYLCLAYIIYRNQFLNVYAPKYETAGKFWPIVHNSMIFSLVLMQAIAIGLFTLKKLPLAS  629

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY---  377
               FPL + TLLFNEYCR+RF P     PA++L+  DR+D  + +M + Y  + +AY   
Sbjct  630  TLIFPLPVLTLLFNEYCRKRFLPNFIAYPAEVLIKRDREDRYDPKMAEFYDNLVAAYQDP  689

Query  376  ----CQFRRSSVTLGSP  338
                 QF  +S +L SP
Sbjct  690  ALLPIQFSANSDSLNSP  706



>ref|XP_010029368.1| PREDICTED: CSC1-like protein HYP1 [Eucalyptus grandis]
 ref|XP_010029369.1| PREDICTED: CSC1-like protein HYP1 [Eucalyptus grandis]
 gb|KCW56265.1| hypothetical protein EUGRSUZ_I02009 [Eucalyptus grandis]
 gb|KCW56266.1| hypothetical protein EUGRSUZ_I02009 [Eucalyptus grandis]
Length=718

 Score =   139 bits (350),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +Y+ + YI++RNQ+LNVYVTKY+T G +W IVH +TIFSLVL  IIA+G+FGLK   +AS
Sbjct  571  IYYCMGYIVFRNQLLNVYVTKYETSGKFWPIVHNSTIFSLVLMHIIAIGIFGLKNLPLAS  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
            G   PL + TLLFN+YC++RF P+ +  PA+ L   DR+DE +  + + Y K+ +AY
Sbjct  631  GLMVPLPVLTLLFNQYCQKRFLPLFKAYPAECLKKKDREDENDPTIGEFYNKLATAY  687



>ref|XP_010258582.1| PREDICTED: CSC1-like protein HYP1 isoform X1 [Nelumbo nucifera]
Length=714

 Score =   139 bits (349),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY+ L YIIYRNQ+LNVY  K++TGG +W IVH +TIFSL+L Q IA+G+FGLKK  +AS
Sbjct  571  VYYCLGYIIYRNQLLNVYAPKFETGGKFWPIVHNSTIFSLILMQAIAIGIFGLKKLPLAS  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL++ TLLFNEYCR+RF PV     A+ L+  D++D+ +  M +   K+ +AY
Sbjct  631  SLTIPLLVLTLLFNEYCRKRFLPVFIAYSAESLIKKDKEDKNDPSMDEFLDKLVTAY  687



>ref|XP_006408462.1| hypothetical protein EUTSA_v10020163mg [Eutrema salsugineum]
 gb|ESQ49915.1| hypothetical protein EUTSA_v10020163mg [Eutrema salsugineum]
Length=713

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y+IYRNQ+LNVY  KY+TGG +W IVH +TIFSLVL  IIA+G+FGLK+  +AS
Sbjct  570  VYFCLGYVIYRNQLLNVYEAKYETGGKFWPIVHSSTIFSLVLMHIIAVGLFGLKELPLAS  629

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I T+LF+ YC++RF P  +  P + LV+ DR DE ++ M + Y K+  AY
Sbjct  630  SLTIPLPILTVLFSIYCQRRFLPNFKTYPTECLVNKDRADESDQNMSEFYSKLVVAY  686



>ref|XP_006844825.1| hypothetical protein AMTR_s00058p00059520 [Amborella trichopoda]
 gb|ERN06500.1| hypothetical protein AMTR_s00058p00059520 [Amborella trichopoda]
Length=713

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 82/116 (71%), Gaps = 0/116 (0%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            Y+ L YIIYRNQ+LNVY  K++TGG +W IVH  TIFSL + Q+IA+G+FGLKK  +AS 
Sbjct  571  YYCLGYIIYRNQLLNVYSPKFETGGKFWPIVHNCTIFSLFVMQVIAVGIFGLKKIPLASS  630

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
             T PL + TLLFNEYCR+RF P+ R    + L+  DR+DE+   M   Y K+ +AY
Sbjct  631  LTVPLPVLTLLFNEYCRKRFLPIFRAYSVESLITRDREDEKNMEMDQFYNKLVNAY  686



>dbj|BAD94293.1| hypothetical protein [Arabidopsis thaliana]
Length=703

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY+ L YIIYRNQ+LNVY  KY+TGG +W IVH  TIFSLVL  IIA+G+FGLK+  VAS
Sbjct  571  VYYCLGYIIYRNQLLNVYAAKYETGGKFWPIVHSYTIFSLVLMHIIAVGLFGLKELPVAS  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL + T+LF+ YC++RF P  ++ P Q LV+ D+ DE+E+ M + Y ++  AY
Sbjct  631  SLTIPLPVLTVLFSIYCQRRFLPNFKSYPTQCLVNKDKADEREQNMSEFYSELVVAY  687



>ref|NP_186759.2| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8GUH7.1|CSCLC_ARATH RecName: Full=CSC1-like protein HYP1; AltName: Full=HYPOTHETICAL 
PROTEIN 1 [Arabidopsis thaliana]
 gb|AAO00858.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP37778.1| At3g01100 [Arabidopsis thaliana]
 gb|AEE73610.1| uncharacterized protein AT3G01100 [Arabidopsis thaliana]
 gb|AIU34623.1| hyperosmolality-gated Ca2+ permeable channel 2.3 [Arabidopsis 
thaliana]
Length=703

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY+ L YIIYRNQ+LNVY  KY+TGG +W IVH  TIFSLVL  IIA+G+FGLK+  VAS
Sbjct  571  VYYCLGYIIYRNQLLNVYAAKYETGGKFWPIVHSYTIFSLVLMHIIAVGLFGLKELPVAS  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL + T+LF+ YC++RF P  ++ P Q LV+ D+ DE+E+ M + Y ++  AY
Sbjct  631  SLTIPLPVLTVLFSIYCQRRFLPNFKSYPTQCLVNKDKADEREQNMSEFYSELVVAY  687



>gb|KHG30396.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=703

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY  L YIIYRNQ LNVY  K++TGG +W IVH +TIFSLVL  +IA+G+FGLKK  +A+
Sbjct  560  VYCCLGYIIYRNQFLNVYAPKFETGGKFWPIVHNSTIFSLVLMHVIAIGIFGLKKLPLAA  619

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I TL+FN YCR+RF P+ +  P + L+  DRKD+ +  M +  +K+ +AY
Sbjct  620  SLTIPLPILTLVFNAYCRKRFLPIFKAYPTECLIKKDRKDQDDPTMTEFLEKLATAY  676



>ref|XP_002882200.1| hypothetical protein ARALYDRAFT_477418 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58459.1| hypothetical protein ARALYDRAFT_477418 [Arabidopsis lyrata subsp. 
lyrata]
Length=699

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY+ L Y+IYRNQ+LNVY  KY+TGG +W IVH  TIFSLVL  IIA+G+FGLK+  VAS
Sbjct  567  VYYCLGYVIYRNQLLNVYAAKYETGGKFWPIVHSYTIFSLVLMHIIAVGLFGLKELPVAS  626

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I T+LF+ YC++RF P  ++ P Q LV+ D+ DE+E+ M + Y  +  AY
Sbjct  627  SLTIPLPILTVLFSIYCQRRFLPNFKSYPTQCLVNKDKADEREQNMSEFYSDLVVAY  683



>ref|XP_007045993.1| Early-responsive to dehydration stress protein (ERD4) isoform 
1 [Theobroma cacao]
 ref|XP_007045994.1| Early-responsive to dehydration stress protein (ERD4) isoform 
1 [Theobroma cacao]
 gb|EOY01825.1| Early-responsive to dehydration stress protein (ERD4) isoform 
1 [Theobroma cacao]
 gb|EOY01826.1| Early-responsive to dehydration stress protein (ERD4) isoform 
1 [Theobroma cacao]
Length=715

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 90/137 (66%), Gaps = 7/137 (5%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY  LAY+IYRNQ +NVY  KY+T G +W IVH + IFSLVL Q IA+G+F LKK ++AS
Sbjct  570  VYLCLAYVIYRNQFINVYAPKYETAGKFWPIVHNSMIFSLVLMQAIAVGIFTLKKLSLAS  629

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY---  377
               FPL + TLLFNEYCR+RF P     PA++L+  DR+D  +  M++ Y  + +AY   
Sbjct  630  TLVFPLPVLTLLFNEYCRKRFLPNFIAYPAEVLIKRDREDRNDPTMEEFYDNLVTAYQDP  689

Query  376  ----CQFRRSSVTLGSP  338
                 QF  ++ +L SP
Sbjct  690  ALLPIQFSPNADSLNSP  706



>ref|XP_011010302.1| PREDICTED: CSC1-like protein HYP1 [Populus euphratica]
 ref|XP_011010303.1| PREDICTED: CSC1-like protein HYP1 [Populus euphratica]
Length=716

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 82/117 (70%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L YII+RNQ+LNVY  KY+T G++W IVH +TIFSL+L  IIA+G+FGLKK  +AS
Sbjct  573  VYFCLGYIIFRNQLLNVYAPKYETAGMFWPIVHNSTIFSLILMHIIAIGIFGLKKLPLAS  632

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
                PL + TL+FN YC+ RF P+ +  P + L+  DR+D  E  M + Y K+ +AY
Sbjct  633  SLIIPLPVLTLIFNAYCQNRFLPLFKAYPTECLIKKDREDLNEAGMTEFYDKLVTAY  689



>ref|XP_004490117.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cicer 
arietinum]
Length=724

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 92/146 (63%), Gaps = 9/146 (6%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            YF LAYIIYRNQ +NVY  +Y+T G +W IVH + IFSLVL  IIA G+F LKK ++AS 
Sbjct  573  YFCLAYIIYRNQFMNVYAPRYETAGKFWPIVHNSMIFSLVLMHIIASGIFALKKLSLAST  632

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY----  377
              FPL + TLLFNEYCR+RF P+     A+ L+  DR+D+ +  M + Y  +  AY    
Sbjct  633  LMFPLPVVTLLFNEYCRKRFLPIFIGYSAECLIKKDREDQNDATMNEFYNNLVDAYKDPA  692

Query  376  ---CQFRRSSVTLGSP--HPLNPKEQ  314
                Q+  ++ +L SP    LN +EQ
Sbjct  693  LIPIQYSSNNDSLSSPLISQLNAEEQ  718



>gb|EYU44140.1| hypothetical protein MIMGU_mgv1a002119mg [Erythranthe guttata]
Length=711

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +Y+   YIIYRNQ+LNVY  K++TGG +W +VH ATIFSL+L  IIA+G+FGLKK  +AS
Sbjct  561  IYYCFGYIIYRNQLLNVYEPKFETGGKFWPVVHDATIFSLILMHIIAVGIFGLKKVPLAS  620

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I TL+FN YCR+RF P  +  PA+ L++ DR D  +  +   Y+K+ SAY
Sbjct  621  SLTVPLPIITLIFNSYCRRRFLPSFKGYPAECLINKDRVDISDPVISSFYRKLESAY  677



>ref|XP_002888719.1| hypothetical protein ARALYDRAFT_339179 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64978.1| hypothetical protein ARALYDRAFT_339179 [Arabidopsis lyrata subsp. 
lyrata]
Length=711

 Score =   137 bits (344),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAYIIYRNQ +NVY  K+ TGG++W ++H   IFSLVL   IA+G+F LKK  +A+
Sbjct  565  LYFCLAYIIYRNQFMNVYAPKFDTGGMFWPMIHYTMIFSLVLMHAIAIGLFALKKMELAT  624

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
                PL +CTLLFNE+CR+RF P+    PA++L   D++D  + RM + Y  + SAY
Sbjct  625  YLLVPLPVCTLLFNEFCRKRFMPIFTAYPAEVLTKRDKEDRNDPRMPEFYNNLVSAY  681



>ref|XP_010470930.1| PREDICTED: CSC1-like protein At1g69450 [Camelina sativa]
 ref|XP_010470931.1| PREDICTED: CSC1-like protein At1g69450 [Camelina sativa]
Length=709

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            YF LAYI+YRNQ +NVY  K+ TGG++W ++H   IFSLVL   IA+G+F LKK  +A+ 
Sbjct  566  YFCLAYIVYRNQFMNVYAPKFDTGGMFWPMIHYTMIFSLVLMHAIAIGLFALKKMELATY  625

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
               PL +CTLLFNE+CR+RF P+    PA++L   D++D  + RM + Y  + SAY
Sbjct  626  LLVPLPVCTLLFNEFCRKRFMPIFTAYPAEVLTKRDKEDRNDPRMPEFYDNLVSAY  681



>ref|XP_010511974.1| PREDICTED: CSC1-like protein At1g69450 [Camelina sativa]
Length=709

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            YF LAYI+YRNQ +NVY  K+ TGG++W ++H   IFSLVL   IA+G+F LKK  +A+ 
Sbjct  566  YFCLAYIVYRNQFMNVYAPKFDTGGMFWPMIHYTMIFSLVLMHAIAIGLFALKKMELATY  625

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
               PL +CTLLFNE+CR+RF P+    PA++L   D++D  + RM + Y  + SAY
Sbjct  626  LLVPLPVCTLLFNEFCRKRFMPIFTAYPAEVLTKRDKEDRNDPRMPEFYDNLVSAY  681



>ref|XP_010415590.1| PREDICTED: CSC1-like protein At1g69450 [Camelina sativa]
Length=709

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            YF LAYI+YRNQ +NVY  K+ TGG++W ++H   IFSLVL   IA+G+F LKK  +A+ 
Sbjct  566  YFCLAYIVYRNQFMNVYAPKFDTGGMFWPMIHYTMIFSLVLMHAIAIGLFALKKMELATY  625

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
               PL +CTLLFNE+CR+RF P+    PA++L   D++D  + RM + Y  + SAY
Sbjct  626  LLVPLPVCTLLFNEFCRKRFMPIFTAYPAEVLTKRDKEDRNDPRMPEFYDNLVSAY  681



>dbj|BAJ86319.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=676

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y++YRNQ+LNVY T+Y TGGLYW I+H   IFSLVLTQII LGVFGLK S VA+
Sbjct  573  VYFFLGYVVYRNQLLNVYRTRYDTGGLYWPIIHNTVIFSLVLTQIICLGVFGLKVSPVAA  632

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILV  446
            GFT PLII TLLFN+YCR R  P+    PAQ+ +
Sbjct  633  GFTIPLIIFTLLFNQYCRTRLLPLFSTFPAQVCI  666



>ref|XP_010525100.1| PREDICTED: CSC1-like protein HYP1 [Tarenaya hassleriana]
Length=715

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY+ L YII+RNQ+LNVY  KY+TGG +W IVH++T+FSL+L  +IA+G+FGLK+  +AS
Sbjct  570  VYYCLGYIIFRNQLLNVYAGKYETGGKFWPIVHRSTVFSLILMHVIAIGIFGLKERPLAS  629

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I T LF+ YC++RF P+ R+ P + LV+ DR DE++  M + +  +  AY
Sbjct  630  SLTIPLPILTTLFSFYCQRRFLPIFRSYPTECLVNKDRADERDPDMSEFHANLVVAY  686



>ref|XP_006300796.1| hypothetical protein CARUB_v10019875mg [Capsella rubella]
 gb|EOA33694.1| hypothetical protein CARUB_v10019875mg [Capsella rubella]
Length=709

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAYIIYRNQ +NVY  K+ T GL+W ++H   IFSLVL   IA+G+F LKK  +A+
Sbjct  565  LYFCLAYIIYRNQFMNVYAPKFDTAGLFWPMIHYTMIFSLVLMHAIAIGLFALKKMELAT  624

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
                PL +CTLLFNE+CR+RF P+  + PA++L   D++D  + +M + Y  + SAY
Sbjct  625  YLLVPLPVCTLLFNEFCRKRFMPIFTSYPAEVLTKRDKEDRNDPKMPEFYNNLVSAY  681



>ref|XP_007157718.1| hypothetical protein PHAVU_002G092500g [Phaseolus vulgaris]
 gb|ESW29712.1| hypothetical protein PHAVU_002G092500g [Phaseolus vulgaris]
Length=714

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 81/116 (70%), Gaps = 0/116 (0%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            YF LAYIIYRNQ +NVY  KY T G +W ++H + IFSLVL QIIA+G+F LKK ++AS 
Sbjct  574  YFCLAYIIYRNQFINVYAPKYDTAGKFWPVIHNSMIFSLVLMQIIAVGIFALKKLSMAST  633

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
             T PL + TLLFNEYCR+RF P+     A+ L+  DR+D+ +  M   Y+ + +AY
Sbjct  634  LTMPLPVLTLLFNEYCRKRFLPIFVAYSAESLIKKDRQDQNDATMTQFYENLVNAY  689



>ref|XP_008230809.1| PREDICTED: phosphate metabolism protein 7-like isoform X2 [Prunus 
mume]
Length=576

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY  L YIIYRNQ+L VY  KY TGG +W  VH +TIFSLVL  IIA+G+FGLK  ++AS
Sbjct  434  VYCCLGYIIYRNQLLIVYAPKYDTGGRFWPTVHNSTIFSLVLMHIIAIGIFGLKNLSLAS  493

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
                PL I TLLFNEYCR+RF P+  + P + L+  DR+D+ +  +   Y K+++AY
Sbjct  494  SLIVPLPILTLLFNEYCRKRFLPIFEDYPLECLIKKDRQDQNDPTIAVFYNKLSTAY  550



>ref|XP_003618549.1| Membrane protein, putative [Medicago truncatula]
Length=433

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF L YII+RNQ L VYV K++TGG +W  VH +TIFSL+L  +IA+G+FGLKK  +AS
Sbjct  290  IYFCLGYIIFRNQFLKVYVPKFETGGEFWPTVHNSTIFSLILMHVIAIGIFGLKKLPLAS  349

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I TLLFNEYC++RF P+ +N PA+ L+  DR DE E  M + Y K+ +AY
Sbjct  350  ALTLPLPILTLLFNEYCQKRFRPIFKNFPAECLIKKDRADEIEHNMSEFYDKMENAY  406



>ref|XP_009134634.1| PREDICTED: CSC1-like protein HYP1 [Brassica rapa]
 ref|XP_009134635.1| PREDICTED: CSC1-like protein HYP1 [Brassica rapa]
Length=713

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y+IYRNQ+LNVY  KY+TGG +W IVH +TIFSLVL  +IA+G+FGLK+  +AS
Sbjct  570  VYFCLGYVIYRNQLLNVYAAKYETGGKFWPIVHNSTIFSLVLMHVIAIGIFGLKELPLAS  629

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I T+LF+ YC++RF    ++ P + LV+ D+ D +E+ M + Y K+  AY
Sbjct  630  SLTIPLPILTVLFSIYCQRRFLANFKSYPTECLVNKDKADAREQNMSEFYAKLVVAY  686



>emb|CDX74284.1| BnaA03g27630D [Brassica napus]
Length=702

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y+IYRNQ+LNVY  KY+TGG +W IVH +TIFSLVL  +IA+G+FGLK+  +AS
Sbjct  559  VYFCLGYVIYRNQLLNVYAAKYETGGKFWPIVHNSTIFSLVLMHVIAIGIFGLKELPLAS  618

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I T+LF+ YC++RF    ++ P + LV+ D+ D +E+ M + Y K+  AY
Sbjct  619  SLTIPLPILTVLFSIYCQRRFLANFKSYPTECLVNKDKADAREQNMSEFYAKLVVAY  675



>ref|XP_009105488.1| PREDICTED: CSC1-like protein At1g69450 [Brassica rapa]
 emb|CDX95935.1| BnaA07g27960D [Brassica napus]
Length=715

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 82/117 (70%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAYIIYRNQ +NVY  KY+TGG++W ++H   IFSLVL   IA+G+F LKK  +A+
Sbjct  569  LYFVLAYIIYRNQFINVYEPKYETGGMFWPMIHYTMIFSLVLMHGIAIGLFALKKMELAT  628

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
                PL + TLLFNE+CR+RF P+    PA++L   DR+D+ + RM + Y  + SAY
Sbjct  629  YLLIPLPVFTLLFNEFCRKRFMPIFTAYPAEVLTKRDREDQNDPRMGEFYDNLVSAY  685



>ref|XP_010485425.1| PREDICTED: CSC1-like protein HYP1 [Camelina sativa]
 ref|XP_010485426.1| PREDICTED: CSC1-like protein HYP1 [Camelina sativa]
 ref|XP_010485427.1| PREDICTED: CSC1-like protein HYP1 [Camelina sativa]
 ref|XP_010485428.1| PREDICTED: CSC1-like protein HYP1 [Camelina sativa]
Length=702

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            Y+ L Y+IYRNQ+LNVY  KY+TGG +W IVH  TIFSLVL  IIA+G+FGLK+   AS 
Sbjct  571  YYCLGYVIYRNQLLNVYAAKYETGGKFWPIVHSYTIFSLVLMHIIAVGLFGLKEVPWASY  630

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
             T PL I T+LF+ YC++RF P  R+ P + LV+ D++DE+++ M + Y K+  AY
Sbjct  631  LTIPLPILTVLFSIYCQRRFLPNFRSYPTECLVNKDKEDERDQNMSEFYSKLVVAY  686



>ref|XP_010430647.1| PREDICTED: LOW QUALITY PROTEIN: CSC1-like protein HYP1 [Camelina 
sativa]
Length=699

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            Y+ L Y+IYRNQ+LNVY  KY+TGG +W IVH  TIFSLVL  IIA+G+FGLK+   AS 
Sbjct  568  YYCLGYVIYRNQLLNVYAAKYETGGKFWPIVHSYTIFSLVLMHIIAVGLFGLKEVPWASY  627

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
             T PL I T+LF+ YC++RF P  R+ P + LV+ D++DE+++ M + Y K+  AY
Sbjct  628  LTIPLPILTVLFSIYCQRRFLPNFRSYPTECLVNKDKEDERDQNMSEFYSKLVVAY  683



>emb|CDY40924.1| BnaC06g30620D [Brassica napus]
Length=715

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 82/117 (70%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAYIIYRNQ +NVY  KY+TGG++W ++H   +FSLVL   IA+G+F LKK  +A+
Sbjct  569  LYFVLAYIIYRNQFINVYEPKYETGGMFWPMIHYTMVFSLVLMHGIAIGLFALKKMELAT  628

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
                PL + TLLFNE+CR+RF P+    PA++L   DR+D+ + RM + Y  + SAY
Sbjct  629  YLLIPLPVFTLLFNEFCRKRFMPIFTAYPAEVLTKRDREDQNDPRMGEFYDNLVSAY  685



>ref|XP_010939466.1| PREDICTED: CSC1-like protein HYP1 [Elaeis guineensis]
Length=683

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 92/140 (66%), Gaps = 5/140 (4%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            V+F + YIIYRNQ+LNVY+ KY+TGG +W IVH +TIFSL+L  II +G+FGLK+  +AS
Sbjct  539  VFFCVGYIIYRNQLLNVYLPKYETGGRFWPIVHNSTIFSLILMHIIVIGIFGLKQLPLAS  598

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQE-ERMKDIYQKVTSAYCQ  371
                PL + TLLFN+YCR+RF P+ +   A+ L+  DR+D+ +  +M + + K+ +AY  
Sbjct  599  SLILPLPVLTLLFNDYCRKRFLPIFQAYSAETLIKKDREDQNDPAKMAEFFDKLVTAY--  656

Query  370  FRRSSVTLGSPHPLNPKEQS  311
              R    +   H  N  E +
Sbjct  657  --RDPALMPINHSQNSNEHT  674



>ref|XP_006573974.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Glycine 
max]
Length=652

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            YF LAYII+RNQ +NVY  KY T G +W I+H + IFSLVL  IIA+G+F LKK ++AS 
Sbjct  511  YFCLAYIIFRNQFINVYAPKYDTAGKFWPIIHNSMIFSLVLMHIIAVGIFALKKLSLAST  570

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
             T PL + TLLFNEYCR+RF P+     A+ L+  DR+D+ +  M   Y+ + +AY
Sbjct  571  LTMPLPVLTLLFNEYCRKRFLPIFAAYSAESLIKKDRQDQNDATMTQFYENLVNAY  626



>emb|CDX91963.1| BnaC03g32650D [Brassica napus]
Length=1240

 Score =   135 bits (340),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 112/186 (60%), Gaps = 13/186 (7%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y+IYRNQ+LNVY  KY+TGG +W IVH +TIFSLVL  +IA+G+FGLK+  +AS
Sbjct  571  VYFCLGYVIYRNQLLNVYAAKYETGGKFWPIVHNSTIFSLVLMHVIAIGIFGLKELPLAS  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY---  377
              T PL I T+LF+ YC++RF    ++ P + LV+ D+ D +E+   + Y K+  AY   
Sbjct  631  SLTIPLPILTVLFSIYCQRRFLANFKSYPTECLVNKDKADAREQNKSEFYAKLVVAYRDP  690

Query  376  ----CQFRRSSVTLGSPHPLNPKEQSM--LQELEDDVN--PAALKPDMPAGSWNGHTNLE  221
                 ++ R  ++L  P PL  K QS+      +  +N  P ALK D   G     + L+
Sbjct  691  AVSASRYAR-GISLEDP-PLLLKTQSVSSFNRWKKTLNRLPCALKMDGSGGRGGVESILQ  748

Query  220  IEEVGK  203
              ++G+
Sbjct  749  NYKLGR  754



>ref|XP_006299849.1| hypothetical protein CARUB_v10016052mg [Capsella rubella]
 gb|EOA32747.1| hypothetical protein CARUB_v10016052mg [Capsella rubella]
Length=702

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L Y+IYRNQ+LNVY  KY+TGG +W IVH  TIFSLVL  IIA+G+FGLK+   AS
Sbjct  570  VYFCLGYVIYRNQLLNVYTAKYETGGKFWPIVHSYTIFSLVLMHIIAVGLFGLKEVPWAS  629

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I T+LF+ YC++RF P  ++ P + LV+ D+ DE+++ M + Y ++  AY
Sbjct  630  YLTIPLPILTVLFSIYCQRRFLPNFKSYPTECLVNKDKADERDQNMSEFYSELVVAY  686



>ref|XP_010108715.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXC20026.1| Uncharacterized membrane protein [Morus notabilis]
Length=717

 Score =   134 bits (336),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 82/117 (70%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L YI++RNQ +NVY  +Y+T G +W IVH +TIFSLVL   IA+G+F LKK ++AS
Sbjct  573  VYFCLGYIVFRNQFINVYAPRYETAGKFWPIVHNSTIFSLVLMHAIAVGIFTLKKLSLAS  632

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
                PL I TLLFNEYCR+RF P+     A+ L+  DR+DE +  M + ++K+ +AY
Sbjct  633  SLVIPLPILTLLFNEYCRKRFLPIFVGYSAESLIKRDRQDESDPAMPEFFEKLVTAY  689



>ref|XP_008230808.1| PREDICTED: phosphate metabolism protein 7-like isoform X1 [Prunus 
mume]
Length=715

 Score =   133 bits (335),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY  L YIIYRNQ+L VY  KY TGG +W  VH +TIFSLVL  IIA+G+FGLK  ++AS
Sbjct  573  VYCCLGYIIYRNQLLIVYAPKYDTGGRFWPTVHNSTIFSLVLMHIIAIGIFGLKNLSLAS  632

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
                PL I TLLFNEYCR+RF P+  + P + L+  DR+D+ +  +   Y K+++AY
Sbjct  633  SLIVPLPILTLLFNEYCRKRFLPIFEDYPLECLIKKDRQDQNDPTIAVFYNKLSTAY  689



>ref|XP_007217011.1| hypothetical protein PRUPE_ppa002110mg [Prunus persica]
 gb|EMJ18210.1| hypothetical protein PRUPE_ppa002110mg [Prunus persica]
Length=715

 Score =   133 bits (335),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY  L YIIYRNQ+L VY  KY TGG +W  VH +TIFSLVL  IIA+G+FGLK  ++AS
Sbjct  573  VYCCLGYIIYRNQLLIVYAPKYDTGGRFWPTVHNSTIFSLVLMHIIAIGIFGLKNLSLAS  632

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
                PL I TLLFNEYCR+RF P+  + P + L+  DR+D+ +  +   Y K+++AY
Sbjct  633  SLIVPLPILTLLFNEYCRKRFLPIFEDYPLECLIKKDRQDQNDPTIAVFYNKLSTAY  689



>gb|AAG60099.1|AC073178_10 unknown protein [Arabidopsis thaliana]
Length=646

 Score =   132 bits (333),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAYIIYRNQ +NVY  K+ TGG++W ++H   IFSLVL Q IA+G+F LKK  +A+
Sbjct  500  LYFILAYIIYRNQFMNVYAPKFDTGGMFWPMIHYTMIFSLVLMQAIAIGLFALKKMELAT  559

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
                PL + TLLFNE+CR+RF P+  + PA++L   D++D  +  M + Y  + SAY
Sbjct  560  YLLVPLPVFTLLFNEFCRKRFMPIFTDYPAEVLTKRDKEDRNDPTMPEFYNNLVSAY  616



>ref|XP_006391015.1| hypothetical protein EUTSA_v10018196mg [Eutrema salsugineum]
 gb|ESQ28301.1| hypothetical protein EUTSA_v10018196mg [Eutrema salsugineum]
Length=716

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 82/117 (70%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAYIIYRNQ +NVY  KY+TGG++W ++H   IFSLVL   IA+G+F LKK  +A+
Sbjct  570  LYFVLAYIIYRNQFINVYEPKYETGGMFWPMIHYTMIFSLVLMHAIAIGLFALKKMELAT  629

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
                PL I TLLFNE+CR+RF P+    PA++L   D++D+ + RM + Y  + +AY
Sbjct  630  YLLVPLPIFTLLFNEFCRKRFMPIFTAYPAEVLTKRDKEDQNDPRMPEFYNNLVNAY  686



>gb|EMT18535.1| Putative membrane protein [Aegilops tauschii]
Length=707

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 91/140 (65%), Gaps = 10/140 (7%)
 Frame = -2

Query  691  QILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASGFTFPLIICTLL  512
            QILNVY  KY+ GG  W I+H   +FSLVLTQIIALGVF +KK+ +++GFT  L+I T+L
Sbjct  545  QILNVYYPKYEMGGKLWPIMHNTMVFSLVLTQIIALGVFTIKKAPISTGFTILLLIGTIL  604

Query  511  FNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAYCQFRRSSVTLGSPHP  332
            FNEYCRQRF  +  +  AQ  +++DR+DEQ  RM++I++ +  AYCQ         SP P
Sbjct  605  FNEYCRQRFSRIFNSFSAQDFIELDREDEQSGRMREIHEHLLDAYCQ---------SP-P  654

Query  331  LNPKEQSMLQELEDDVNPAA  272
             +  E  M   +ED    A+
Sbjct  655  GSADEIPMEMIMEDPAQEAS  674



>ref|XP_002522488.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39980.1| conserved hypothetical protein [Ricinus communis]
Length=710

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY  LAYII+RNQ +NVY  KY+T G +W IVH + IFSLVL   IA+G+F LKK + AS
Sbjct  568  VYLCLAYIIFRNQFMNVYAPKYETAGKFWPIVHNSMIFSLVLMHAIAIGIFTLKKLSTAS  627

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
               FPL + TLLFNEYCR+RF P+     A++L+  DR++E +  M + + K+ +AY
Sbjct  628  TLIFPLPVLTLLFNEYCRKRFLPIFIAYSAEVLIKKDREEENDPAMHEFFDKLVTAY  684



>ref|XP_003551746.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Glycine 
max]
 gb|KHN13592.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=713

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L YIIYRNQ+LNVY+ KYQTGG +W  VH  TIFSLVL  II +G+FGLKK  +AS
Sbjct  573  VYFCLGYIIYRNQLLNVYMAKYQTGGEFWPTVHNYTIFSLVLMHIIVIGIFGLKKLPIAS  632

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I TLLFNEYC++RF P+ +  PA+ L+  DR+D+ E  M + Y K+  AY
Sbjct  633  ALTLPLPILTLLFNEYCQKRFFPIFKAYPAECLIKKDRQDQNEPNMPEFYDKLVKAY  689



>ref|NP_177104.2| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis 
thaliana]
 ref|NP_001185356.1| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis 
thaliana]
 sp|F4I248.1|CSCLB_ARATH RecName: Full=CSC1-like protein At1g69450 [Arabidopsis thaliana]
 gb|AEE34926.1| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis 
thaliana]
 gb|AEE34927.1| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis 
thaliana]
 gb|AIU34624.1| hyperosmolality-gated Ca2+ permeable channel 2.4 [Arabidopsis 
thaliana]
Length=711

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF LAYIIYRNQ +NVY  K+ TGG++W ++H   IFSLVL Q IA+G+F LKK  +A+
Sbjct  565  LYFILAYIIYRNQFMNVYAPKFDTGGMFWPMIHYTMIFSLVLMQAIAIGLFALKKMELAT  624

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
                PL + TLLFNE+CR+RF P+  + PA++L   D++D  +  M + Y  + SAY
Sbjct  625  YLLVPLPVFTLLFNEFCRKRFMPIFTDYPAEVLTKRDKEDRNDPTMPEFYNNLVSAY  681



>gb|AES74766.2| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=712

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF L YII+RNQ L VYV K++TGG +W  VH +TIFSL+L  +IA+G+FGLKK  +AS
Sbjct  569  IYFCLGYIIFRNQFLKVYVPKFETGGEFWPTVHNSTIFSLILMHVIAIGIFGLKKLPLAS  628

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I TLLFNEYC++RF P+ +N PA+ L+  DR DE E  M + Y K+ +AY
Sbjct  629  ALTLPLPILTLLFNEYCQKRFRPIFKNFPAECLIKKDRADEIEHNMSEFYDKMENAY  685



>ref|XP_003618548.1| Membrane protein, putative [Medicago truncatula]
Length=721

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF L YII+RNQ L VYV K++TGG +W  VH +TIFSL+L  +IA+G+FGLKK  +AS
Sbjct  578  IYFCLGYIIFRNQFLKVYVPKFETGGEFWPTVHNSTIFSLILMHVIAIGIFGLKKLPLAS  637

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I TLLFNEYC++RF P+ +N PA+ L+  DR DE E  M + Y K+ +AY
Sbjct  638  ALTLPLPILTLLFNEYCQKRFRPIFKNFPAECLIKKDRADEIEHNMSEFYDKMENAY  694



>ref|XP_006574920.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X5 [Glycine max]
Length=573

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            YF LAYII+RNQ +NVY  KY T G +W I+H + IFSLVL  IIA+G+F LKK ++AS 
Sbjct  433  YFCLAYIIFRNQFINVYAPKYDTAGKFWPIIHNSMIFSLVLMHIIAVGIFALKKLSLAST  492

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
             T PL + TLLFNEYCR+RF P+     A+ L   DR+D+ +  M   Y+ + +AY
Sbjct  493  LTMPLPVLTLLFNEYCRKRFLPIFVAYSAESLKKKDRQDQNDATMTQFYENLVNAY  548



>ref|XP_008780953.1| PREDICTED: CSC1-like protein HYP1 [Phoenix dactylifera]
Length=713

 Score =   131 bits (329),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 92/136 (68%), Gaps = 5/136 (4%)
 Frame = -2

Query  715  LAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASGFTF  536
            + YIIYRNQ+LNVY+ KY+TGG +W IVH +TIFSL+L  IIA+G+FGLK+  +AS    
Sbjct  573  IGYIIYRNQLLNVYLPKYETGGRFWPIVHNSTIFSLILMHIIAIGIFGLKQLPLASSLIL  632

Query  535  PLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQE-ERMKDIYQKVTSAYCQFRRS  359
            PL + TLLFN+YCR+RF P+ +   A+ L+  DR+D+ +  +M + + K+ +AY    R 
Sbjct  633  PLPVLTLLFNDYCRKRFLPIFQAYSAETLIRKDREDQNDPAKMAEFFDKLVTAY----RD  688

Query  358  SVTLGSPHPLNPKEQS  311
               +   H LN  E++
Sbjct  689  PSLMPINHFLNSNERT  704



>ref|XP_006574918.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X3 [Glycine max]
Length=642

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            YF LAYII+RNQ +NVY  KY T G +W I+H + IFSLVL  IIA+G+F LKK ++AS 
Sbjct  502  YFCLAYIIFRNQFINVYAPKYDTAGKFWPIIHNSMIFSLVLMHIIAVGIFALKKLSLAST  561

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
             T PL + TLLFNEYCR+RF P+     A+ L   DR+D+ +  M   Y+ + +AY
Sbjct  562  LTMPLPVLTLLFNEYCRKRFLPIFVAYSAESLKKKDRQDQNDATMTQFYENLVNAY  617



>ref|XP_006574916.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X1 [Glycine max]
 ref|XP_006574917.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X2 [Glycine max]
 gb|KHN01989.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=712

 Score =   130 bits (327),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            YF LAYII+RNQ +NVY  KY T G +W I+H + IFSLVL  IIA+G+F LKK ++AS 
Sbjct  572  YFCLAYIIFRNQFINVYAPKYDTAGKFWPIIHNSMIFSLVLMHIIAVGIFALKKLSLAST  631

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
             T PL + TLLFNEYCR+RF P+     A+ L   DR+D+ +  M   Y+ + +AY
Sbjct  632  LTMPLPVLTLLFNEYCRKRFLPIFVAYSAESLKKKDRQDQNDATMTQFYENLVNAY  687



>ref|XP_002269926.1| PREDICTED: CSC1-like protein HYP1 [Vitis vinifera]
 ref|XP_010645179.1| PREDICTED: CSC1-like protein HYP1 [Vitis vinifera]
 ref|XP_010645180.1| PREDICTED: CSC1-like protein HYP1 [Vitis vinifera]
 ref|XP_010645181.1| PREDICTED: CSC1-like protein HYP1 [Vitis vinifera]
 ref|XP_010645182.1| PREDICTED: CSC1-like protein HYP1 [Vitis vinifera]
 ref|XP_010645183.1| PREDICTED: CSC1-like protein HYP1 [Vitis vinifera]
Length=715

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 80/117 (68%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY  L YII+RNQ LNVY  KY+T G +W IVH + IFSLVL   IA+G+F +KK ++AS
Sbjct  573  VYLCLGYIIFRNQFLNVYAPKYETAGKFWPIVHNSMIFSLVLMHAIAIGIFTVKKLSIAS  632

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
               FPL + TLLFNEYCR+RF P+     A+ L+  DR+D+ E  M + + ++ +AY
Sbjct  633  TLIFPLPVLTLLFNEYCRKRFLPIFIAYSAESLIKRDRQDQNEPSMDEFFHELVTAY  689



>emb|CBI38238.3| unnamed protein product [Vitis vinifera]
Length=888

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 80/117 (68%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY  L YII+RNQ LNVY  KY+T G +W IVH + IFSLVL   IA+G+F +KK ++AS
Sbjct  746  VYLCLGYIIFRNQFLNVYAPKYETAGKFWPIVHNSMIFSLVLMHAIAIGIFTVKKLSIAS  805

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
               FPL + TLLFNEYCR+RF P+     A+ L+  DR+D+ E  M + + ++ +AY
Sbjct  806  TLIFPLPVLTLLFNEYCRKRFLPIFIAYSAESLIKRDRQDQNEPSMDEFFHELVTAY  862



>ref|XP_007139547.1| hypothetical protein PHAVU_008G039200g [Phaseolus vulgaris]
 gb|ESW11541.1| hypothetical protein PHAVU_008G039200g [Phaseolus vulgaris]
Length=714

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 80/117 (68%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF L YIIYRNQ+LNVYV KY TGG +W  VH  TIFSL+L  II +G+FG KK  +AS
Sbjct  570  VYFCLGYIIYRNQLLNVYVAKYHTGGEFWPTVHNCTIFSLILMHIIVIGIFGQKKLPLAS  629

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
                PL I TLLFNEYCR+RF P+ +  P + L+  DR+D+ E  M + Y K+  AY
Sbjct  630  ALILPLPILTLLFNEYCRKRFFPIFKAFPTECLIKKDREDQNEPNMSEFYDKLAIAY  686



>gb|KDP41246.1| hypothetical protein JCGZ_15653 [Jatropha curcas]
Length=709

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 88/137 (64%), Gaps = 7/137 (5%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY  LAYII+ NQ  NVY+ KY+T G +W IVH + IFSLVL   IA+G+F LKK ++AS
Sbjct  568  VYLCLAYIIFLNQFTNVYMPKYETAGKFWPIVHNSMIFSLVLMHAIAIGIFTLKKLSIAS  627

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY---  377
               FPL + TLLFNEYCR+RF P     PA++L+  DR++E +  M + +  + +AY   
Sbjct  628  TLIFPLPVLTLLFNEYCRKRFLPNFVAYPAEVLLKKDRQEENDPAMAEFFNHLVTAYEDP  687

Query  376  ----CQFRRSSVTLGSP  338
                 Q+  ++ +L SP
Sbjct  688  ALMPIQYSATTDSLNSP  704



>ref|XP_009356342.1| PREDICTED: CSC1-like protein At1g69450 [Pyrus x bretschneideri]
Length=717

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 85/137 (62%), Gaps = 7/137 (5%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY  L +IIYRNQ +NVY  +Y+T G +W IVH + IFSLVL   IA+G+F +KK  +AS
Sbjct  573  VYLCLGFIIYRNQFMNVYAPRYETAGKFWPIVHTSMIFSLVLMHAIAVGIFTIKKVDLAS  632

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY---  377
              TFPL + TLLFNEYCR+RF P     PA+ L+  DR+DE +  M + + K+ + Y   
Sbjct  633  TLTFPLPVFTLLFNEYCRKRFLPNFVAYPAESLIRKDRQDENDPSMPEFFDKLVTVYQDP  692

Query  376  ----CQFRRSSVTLGSP  338
                  +  SS  L SP
Sbjct  693  DLMPINYSGSSDRLSSP  709



>ref|XP_003554648.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X1 [Glycine max]
 ref|XP_006603879.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X2 [Glycine max]
Length=712

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +YF L YII+RNQ+L VYV KY+TGG +W  VH +TIFSL+L  IIA+G+FGLKK  +AS
Sbjct  570  IYFCLGYIIFRNQLLKVYVPKYETGGEFWPTVHSSTIFSLILMHIIAIGLFGLKKLPLAS  629

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
                PL I TLLFNEYC++RF P+ +N  A+ L+  DR D+ E  M + Y K+ +AY
Sbjct  630  ILILPLPILTLLFNEYCQKRFFPIFKNYSAECLIKKDRADQNEHNMSEFYDKLANAY  686



>ref|XP_008221566.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Prunus 
mume]
 ref|XP_008221567.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Prunus 
mume]
Length=719

 Score =   128 bits (321),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 78/117 (67%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY  L YIIYRNQ +NVY  +Y+T G +W IVH + IFSLVL   IA+G+F LKK  +AS
Sbjct  573  VYLCLGYIIYRNQFINVYAPQYETAGKFWPIVHNSMIFSLVLMHAIAVGIFTLKKLPLAS  632

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
               FPL + TLLFNEYCR+RF P     PA+IL+  DR+DE +  M +   ++ S Y
Sbjct  633  TLVFPLPVLTLLFNEYCRKRFLPNFVAYPAEILIRKDRQDENDPTMPEFLDELISFY  689



>ref|XP_010088119.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB31931.1| Uncharacterized membrane protein [Morus notabilis]
Length=751

 Score =   128 bits (321),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +Y+ L YII+RNQILNVY+ KY++ G +W  VH +T+FSLVL  IIA+GVFGLKK  +A+
Sbjct  608  IYYCLGYIIFRNQILNVYINKYESVGRFWPTVHYSTVFSLVLMHIIAIGVFGLKKVRLAA  667

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I TLLFNE+CR+RF  +  N P + L+  D++++ +  M + + K+ +AY
Sbjct  668  TLTIPLPILTLLFNEFCRKRFLSMFDNPPLECLMKKDKEEQNDLDMDEFHGKLATAY  724



>ref|XP_004297274.1| PREDICTED: CSC1-like protein At1g69450 [Fragaria vesca subsp. 
vesca]
Length=719

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 75/116 (65%), Gaps = 0/116 (0%)
 Frame = -2

Query  724  YFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVASG  545
            Y  L YI+YRNQ +NVY  +Y+T G +W I H + IFSLVL   IA+GVF LK   VAS 
Sbjct  574  YLCLGYIVYRNQFINVYAPRYETAGKFWPIAHNSVIFSLVLMHAIAVGVFTLKTVPVAST  633

Query  544  FTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
             TFPL + TLLFNEYCR+RF P     PA+ L+  DR+DE +  M + Y K+   Y
Sbjct  634  LTFPLPVFTLLFNEYCRKRFLPNFTAYPAESLLKKDRQDENDPTMPEFYTKLIGTY  689



>ref|XP_009789228.1| PREDICTED: CSC1-like protein HYP1 isoform X2 [Nicotiana sylvestris]
Length=590

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY+ L Y+IYRNQ+LNVY  KY+TGG  W IVH + IFSL+L  +IA+G+FGLKK  +AS
Sbjct  445  VYYCLGYLIYRNQLLNVYAPKYETGGKLWPIVHDSMIFSLILMHVIAIGIFGLKKLPLAS  504

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
                PL I TL+FN YCR+RF P+ ++   + L+  DR+++ +  M   + ++ +AY
Sbjct  505  SLIVPLPILTLVFNSYCRRRFLPMFKSYSVESLLKKDREEQNDPTMASFHDRLATAY  561



>ref|XP_010316242.1| PREDICTED: CSC1-like protein HYP1 isoform X3 [Solanum lycopersicum]
Length=602

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY+ L Y+IYRNQ+LNVY  KY+TGG  W IVH + IFSL+L  +IA+G+FGLKK  +AS
Sbjct  457  VYYCLGYLIYRNQLLNVYAPKYETGGKLWPIVHDSMIFSLILMHVIAIGIFGLKKLPLAS  516

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I TL+FN YCR+RF P+ ++   + L+  D++++ +  +   ++++ +AY
Sbjct  517  SLTVPLPILTLVFNSYCRRRFLPMFKSYSVESLLKKDKEEQNDPTIASFHERLATAY  573



>gb|ABR16200.1| unknown [Picea sitchensis]
 gb|ABR16390.1| unknown [Picea sitchensis]
Length=717

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VYF + YI YRNQ+L VY  ++++ G +W IVH  TIFSLV  QIIA+G+FG+KK   AS
Sbjct  575  VYFFVGYIFYRNQMLKVYSPRFESAGQFWPIVHNCTIFSLVFMQIIAIGIFGVKKVPFAS  634

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERM  410
            G+  P+ + TLLFN+YCR+RF P+    PA+IL+  D +DE+  +M
Sbjct  635  GWVIPMTVITLLFNDYCRKRFLPIFNRYPAEILIKRDGEDERNPQM  680



>ref|XP_010316241.1| PREDICTED: CSC1-like protein HYP1 isoform X2 [Solanum lycopersicum]
Length=639

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY+ L Y+IYRNQ+LNVY  KY+TGG  W IVH + IFSL+L  +IA+G+FGLKK  +AS
Sbjct  494  VYYCLGYLIYRNQLLNVYAPKYETGGKLWPIVHDSMIFSLILMHVIAIGIFGLKKLPLAS  553

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I TL+FN YCR+RF P+ ++   + L+  D++++ +  +   ++++ +AY
Sbjct  554  SLTVPLPILTLVFNSYCRRRFLPMFKSYSVESLLKKDKEEQNDPTIASFHERLATAY  610



>ref|XP_009789223.1| PREDICTED: CSC1-like protein HYP1 isoform X1 [Nicotiana sylvestris]
 ref|XP_009789224.1| PREDICTED: CSC1-like protein HYP1 isoform X1 [Nicotiana sylvestris]
 ref|XP_009789226.1| PREDICTED: CSC1-like protein HYP1 isoform X1 [Nicotiana sylvestris]
 ref|XP_009789227.1| PREDICTED: CSC1-like protein HYP1 isoform X1 [Nicotiana sylvestris]
Length=715

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY+ L Y+IYRNQ+LNVY  KY+TGG  W IVH + IFSL+L  +IA+G+FGLKK  +AS
Sbjct  570  VYYCLGYLIYRNQLLNVYAPKYETGGKLWPIVHDSMIFSLILMHVIAIGIFGLKKLPLAS  629

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
                PL I TL+FN YCR+RF P+ ++   + L+  DR+++ +  M   + ++ +AY
Sbjct  630  SLIVPLPILTLVFNSYCRRRFLPMFKSYSVESLLKKDREEQNDPTMASFHDRLATAY  686



>ref|XP_006483099.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Citrus sinensis]
 ref|XP_006483100.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X3 [Citrus sinensis]
 ref|XP_006483101.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X4 [Citrus sinensis]
Length=713

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 78/117 (67%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            +Y  LAYIIYRNQ +NVY  KY+T G +W IVH + IFSLVL   IA+G+F +KK + AS
Sbjct  570  IYLCLAYIIYRNQFINVYEPKYETAGKFWPIVHNSMIFSLVLMHAIAVGIFTIKKLSTAS  629

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
               FPL + TLLFNEYCR+RF P     PA++L+  DR+D  +  + + +  +  AY
Sbjct  630  TLIFPLPVLTLLFNEYCRKRFLPNFIAYPAEVLIKKDREDRDDATIAEFFDSLAIAY  686



>ref|XP_006338419.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Solanum 
tuberosum]
Length=716

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -2

Query  727  VYFALAYIIYRNQILNVYVTKYQTGGLYWIIVHKATIFSLVLTQIIALGVFGLKKSTVAS  548
            VY+ L Y+IYRNQ+LNVY  KY+TGG  W IVH + IFSL+L  +IA+G+FGLKK  +AS
Sbjct  571  VYYCLGYLIYRNQLLNVYAPKYETGGKLWPIVHDSMIFSLILMHVIAIGIFGLKKLPLAS  630

Query  547  GFTFPLIICTLLFNEYCRQRFHPVLRNLPAQILVDMDRKDEQEERMKDIYQKVTSAY  377
              T PL I TL+FN YCR+RF P+ ++   + L+  D++++ +  +   ++++ +AY
Sbjct  631  SLTVPLPILTLVFNSYCRRRFLPMFKSYSVESLLKKDKEEQNDPTIASFHERLATAY  687



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1300407706455