BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF024E13

Length=688
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009773433.1|  PREDICTED: BEL1-like homeodomain protein 4         139   2e-34   Nicotiana sylvestris
ref|XP_009614985.1|  PREDICTED: BEL1-like homeodomain protein 4         137   1e-33   Nicotiana tomentosiformis
ref|XP_006366455.1|  PREDICTED: BEL1-like homeodomain protein 4-like    131   1e-31   Solanum tuberosum [potatoes]
gb|KJB43577.1|  hypothetical protein B456_007G207200                    123   2e-28   Gossypium raimondii
ref|XP_008338177.1|  PREDICTED: BEL1-like homeodomain protein 2         120   3e-28   
ref|XP_006283200.1|  hypothetical protein CARUB_v10004235mg             122   4e-28   
ref|XP_006283201.1|  hypothetical protein CARUB_v10004235mg             122   5e-28   
ref|XP_004238216.1|  PREDICTED: BEL1-like homeodomain protein 4         122   5e-28   Solanum lycopersicum
emb|CDX69252.1|  BnaC01g02010D                                          119   5e-27   
ref|XP_010029855.1|  PREDICTED: BEL1-like homeodomain protein 4         119   6e-27   
ref|XP_011099269.1|  PREDICTED: BEL1-like homeodomain protein 4         119   8e-27   Sesamum indicum [beniseed]
emb|CBI19630.3|  unnamed protein product                                115   1e-26   Vitis vinifera
ref|XP_003611874.1|  BEL1-like homeodomain protein                      118   2e-26   Medicago truncatula
emb|CDY46061.1|  BnaA09g41850D                                          116   2e-26   Brassica napus [oilseed rape]
gb|KJB48477.1|  hypothetical protein B456_008G070800                    117   3e-26   Gossypium raimondii
gb|KHG14356.1|  BEL1-like homeodomain protein 2                         116   6e-26   Gossypium arboreum [tree cotton]
ref|XP_006344823.1|  PREDICTED: BEL1-related homeotic protein 22        115   7e-26   
gb|EPS62050.1|  hypothetical protein M569_12744                         110   1e-25   Genlisea aurea
ref|XP_009140492.1|  PREDICTED: BEL1-like homeodomain protein 4         115   1e-25   Brassica rapa
ref|XP_009376500.1|  PREDICTED: BEL1-like homeodomain protein 2         115   1e-25   
ref|XP_002281889.1|  PREDICTED: BEL1-like homeodomain protein 4         114   2e-25   Vitis vinifera
emb|CDY39669.1|  BnaA04g13860D                                          114   2e-25   Brassica napus [oilseed rape]
ref|XP_004509227.1|  PREDICTED: BEL1-like homeodomain protein 2-like    114   2e-25   
ref|XP_009396457.1|  PREDICTED: BEL1-like homeodomain protein 4         114   4e-25   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY62523.1|  BnaC04g56300D                                          113   5e-25   Brassica napus [oilseed rape]
ref|XP_002310774.2|  hypothetical protein POPTR_0007s12170g             114   5e-25   
ref|XP_009379163.1|  PREDICTED: BEL1-like homeodomain protein 2         113   8e-25   Pyrus x bretschneideri [bai li]
ref|XP_006425771.1|  hypothetical protein CICLE_v10024897mg             113   9e-25   Citrus clementina [clementine]
ref|XP_006425770.1|  hypothetical protein CICLE_v10024897mg             113   1e-24   
ref|XP_004233410.1|  PREDICTED: BEL1-like homeodomain protein 2         112   1e-24   Solanum lycopersicum
ref|XP_009605852.1|  PREDICTED: BEL1-like homeodomain protein 4 i...    112   1e-24   Nicotiana tomentosiformis
ref|XP_008808897.1|  PREDICTED: BEL1-like homeodomain protein 4         111   1e-24   Phoenix dactylifera
ref|XP_009605853.1|  PREDICTED: BEL1-like homeodomain protein 4 i...    112   1e-24   
ref|XP_011085539.1|  PREDICTED: BEL1-like homeodomain protein 4         112   2e-24   
dbj|BAD94844.1|  putative homeodomain transcription factor              107   2e-24   Arabidopsis thaliana [mouse-ear cress]
gb|EYU45099.1|  hypothetical protein MIMGU_mgv1a003541mg                111   2e-24   Erythranthe guttata [common monkey flower]
ref|XP_011074481.1|  PREDICTED: BEL1-like homeodomain protein 4         111   3e-24   Sesamum indicum [beniseed]
gb|ABF98710.1|  homeodomain protein JUBEL1, putative, expressed         107   5e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004232087.1|  PREDICTED: BEL1-like homeodomain protein 2         110   5e-24   Solanum lycopersicum
ref|XP_004511995.1|  PREDICTED: BEL1-like homeodomain protein 2-like    110   6e-24   Cicer arietinum [garbanzo]
ref|XP_009419344.1|  PREDICTED: BEL1-like homeodomain protein 4         110   6e-24   
gb|ACN29213.1|  unknown                                                 107   7e-24   Zea mays [maize]
ref|XP_010936123.1|  PREDICTED: BEL1-like homeodomain protein 4 i...    107   1e-23   
ref|XP_010936122.1|  PREDICTED: BEL1-like homeodomain protein 4 i...    107   1e-23   
ref|XP_010429329.1|  PREDICTED: BEL1-like homeodomain protein 4 i...    108   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010417119.1|  PREDICTED: BEL1-like homeodomain protein 4         108   2e-23   Camelina sativa [gold-of-pleasure]
ref|NP_179956.1|  BEL1-like homeodomain 4                               108   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAK43834.1|AF353092_1  BEL1-like homeobox 4                          108   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002880524.1|  hypothetical protein ARALYDRAFT_900861             108   2e-23   
emb|CDP02423.1|  unnamed protein product                                106   2e-23   Coffea canephora [robusta coffee]
emb|CDX76849.1|  BnaC08g34350D                                          108   2e-23   
ref|XP_009117270.1|  PREDICTED: BEL1-like homeodomain protein 4         108   2e-23   
ref|XP_006293804.1|  hypothetical protein CARUB_v10022787mg             108   2e-23   
ref|XP_011025689.1|  PREDICTED: BEL1-like homeodomain protein 4         108   2e-23   Populus euphratica
ref|XP_004981881.1|  PREDICTED: BEL1-like homeodomain protein 2-l...    108   2e-23   Setaria italica
ref|XP_010472371.1|  PREDICTED: BEL1-like homeodomain protein 4         108   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_009629330.1|  PREDICTED: BEL1-like homeodomain protein 4         108   2e-23   Nicotiana tomentosiformis
ref|XP_006404859.1|  hypothetical protein EUTSA_v10000076mg             108   2e-23   Eutrema salsugineum [saltwater cress]
ref|XP_006651784.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...    108   2e-23   
ref|XP_008797003.1|  PREDICTED: BEL1-like homeodomain protein 4         107   3e-23   Phoenix dactylifera
ref|XP_002466514.1|  hypothetical protein SORBIDRAFT_01g009130          108   3e-23   Sorghum bicolor [broomcorn]
ref|XP_009400050.1|  PREDICTED: BEL1-like homeodomain protein 4 i...    108   3e-23   
emb|CAN64299.1|  hypothetical protein VITISV_034918                     104   3e-23   Vitis vinifera
ref|NP_001148063.1|  homeodomain protein JUBEL1                         108   3e-23   Zea mays [maize]
ref|XP_010243287.1|  PREDICTED: BEL1-like homeodomain protein 2         108   3e-23   Nelumbo nucifera [Indian lotus]
tpg|DAA51178.1|  TPA: putative POX domain/homeobox DNA-binding do...    108   4e-23   
gb|KHN44516.1|  BEL1-like homeodomain protein 2                         107   4e-23   Glycine soja [wild soybean]
ref|XP_009109344.1|  PREDICTED: BEL1-like homeodomain protein 2         108   4e-23   
ref|XP_006574714.1|  PREDICTED: BEL1-like homeodomain protein 2-like    108   4e-23   
ref|XP_011083914.1|  PREDICTED: BEL1-like homeodomain protein 4         107   4e-23   Sesamum indicum [beniseed]
emb|CDY22463.1|  BnaC03g61760D                                          108   4e-23   Brassica napus [oilseed rape]
emb|CDY24765.1|  BnaA08g15450D                                          108   4e-23   Brassica napus [oilseed rape]
gb|AAN03623.1|AF406699_1  BEL1-related homeotic protein 13              107   4e-23   Solanum tuberosum [potatoes]
ref|XP_008440170.1|  PREDICTED: BEL1-like homeodomain protein 4         107   4e-23   Cucumis melo [Oriental melon]
ref|XP_004142028.1|  PREDICTED: homeobox protein BEL1 homolog           107   4e-23   
gb|KGN48456.1|  hypothetical protein Csa_6G487770                       107   5e-23   Cucumis sativus [cucumbers]
ref|XP_006411954.1|  hypothetical protein EUTSA_v10024509mg             108   5e-23   Eutrema salsugineum [saltwater cress]
gb|EAY91758.1|  hypothetical protein OsI_13400                          108   5e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_006599397.1|  PREDICTED: BEL1-like homeodomain protein 2-like    108   5e-23   Glycine max [soybeans]
ref|XP_007204284.1|  hypothetical protein PRUPE_ppa001286mg             108   5e-23   Prunus persica
gb|KHN36166.1|  BEL1-like homeodomain protein 2                         107   5e-23   Glycine soja [wild soybean]
gb|ABF98709.1|  homeodomain protein JUBEL1, putative, expressed         108   5e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008241607.1|  PREDICTED: BEL1-like homeodomain protein 4         108   6e-23   Prunus mume [ume]
emb|CBI17588.3|  unnamed protein product                                107   6e-23   Vitis vinifera
gb|KDP31824.1|  hypothetical protein JCGZ_12285                         107   6e-23   Jatropha curcas
emb|CDX75604.1|  BnaA01g00980D                                          107   6e-23   
emb|CAB16801.2|  BEL1-like homeobox 2 protein (BLH2)                    107   6e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008778978.1|  PREDICTED: BEL1-like homeodomain protein 4 i...    107   6e-23   
ref|XP_010446733.1|  PREDICTED: BEL1-like homeodomain protein 2         107   7e-23   Camelina sativa [gold-of-pleasure]
dbj|BAJ04685.1|  BEL1-type homeodomain protein                          107   7e-23   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ88032.1|  predicted protein                                      107   7e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007156003.1|  hypothetical protein PHAVU_003G250500g             107   7e-23   Phaseolus vulgaris [French bean]
dbj|BAJ04686.1|  BEL1-type homeodomain protein                          107   7e-23   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004300584.1|  PREDICTED: BEL1-like homeodomain protein 2         107   7e-23   Fragaria vesca subsp. vesca
ref|XP_002269670.2|  PREDICTED: BEL1-like homeodomain protein 2         107   7e-23   Vitis vinifera
ref|XP_009141155.1|  PREDICTED: BEL1-like homeodomain protein 2         107   7e-23   Brassica rapa
ref|XP_007156875.1|  hypothetical protein PHAVU_002G024800g             107   7e-23   Phaseolus vulgaris [French bean]
ref|NP_195405.4|  BEL1-like homeodomain protein 2                       107   8e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAD51349.1|  bel1-like homeodomain 2                                 107   8e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KHN42028.1|  BEL1-like homeodomain protein 2                         107   8e-23   Glycine soja [wild soybean]
ref|XP_003538830.1|  PREDICTED: BEL1-like homeodomain protein 2-like    107   8e-23   Glycine max [soybeans]
gb|EEE59870.1|  hypothetical protein OsJ_12461                          107   8e-23   Oryza sativa Japonica Group [Japonica rice]
gb|AAK38645.1|AF334758_1  homeodomain protein JUBEL1                    107   8e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AET04003.2|  BEL1-related homeotic protein                           107   8e-23   Medicago truncatula
dbj|BAJ04684.1|  BEL1-type homeodomain protein                          107   8e-23   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006338267.1|  PREDICTED: BEL1-related homeotic protein 13 ...    107   8e-23   Solanum tuberosum [potatoes]
ref|XP_008813264.1|  PREDICTED: BEL1-like homeodomain protein 4         107   9e-23   Phoenix dactylifera
ref|XP_008344278.1|  PREDICTED: BEL1-like homeodomain protein 2         107   9e-23   
gb|AAF43095.1|AF053769_1  homeodomain protein                           107   9e-23   Malus domestica [apple tree]
ref|XP_010254984.1|  PREDICTED: BEL1-like homeodomain protein 4         107   9e-23   Nelumbo nucifera [Indian lotus]
gb|ACA61780.1|  BIPINNATA                                               107   9e-23   Solanum lycopersicum
ref|XP_002869016.1|  hypothetical protein ARALYDRAFT_328081             107   1e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_011009913.1|  PREDICTED: BEL1-like homeodomain protein 4         107   1e-22   Populus euphratica
gb|KHG13966.1|  BEL1-like homeodomain protein 2                         107   1e-22   Gossypium arboreum [tree cotton]
gb|KJB17836.1|  hypothetical protein B456_003G018100                    107   1e-22   Gossypium raimondii
ref|XP_010230386.1|  PREDICTED: BEL1-like homeodomain protein 4         107   1e-22   Brachypodium distachyon [annual false brome]
ref|XP_002306443.2|  hypothetical protein POPTR_0005s13780g             107   1e-22   Populus trichocarpa [western balsam poplar]
ref|XP_004148064.1|  PREDICTED: uncharacterized protein LOC101212977    106   1e-22   
gb|KGN62029.1|  hypothetical protein Csa_2G287110                       106   1e-22   Cucumis sativus [cucumbers]
emb|CBI34373.3|  unnamed protein product                                104   1e-22   Vitis vinifera
ref|XP_007047070.1|  BEL1-like homeodomain protein 2 isoform 1          107   1e-22   
gb|EYU44317.1|  hypothetical protein MIMGU_mgv1a001716mg                106   1e-22   Erythranthe guttata [common monkey flower]
ref|XP_010680937.1|  PREDICTED: BEL1-like homeodomain protein 4         107   1e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008457795.1|  PREDICTED: BEL1-like homeodomain protein 4         106   1e-22   Cucumis melo [Oriental melon]
gb|AAN03625.1|AF406701_1  BEL1-related homeotic protein 22              106   1e-22   Solanum tuberosum [potatoes]
ref|XP_010097899.1|  BEL1-like homeodomain protein 2                    107   2e-22   
ref|XP_009776283.1|  PREDICTED: BEL1-like homeodomain protein 2         106   2e-22   Nicotiana sylvestris
ref|XP_009411323.1|  PREDICTED: BEL1-like homeodomain protein 4         105   3e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK36785.1|  unknown                                                 102   3e-22   Lotus japonicus
ref|XP_002279230.2|  PREDICTED: homeobox protein BEL1 homolog           105   3e-22   Vitis vinifera
ref|XP_009395654.1|  PREDICTED: BEL1-like homeodomain protein 4         105   4e-22   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAE98691.1|  putative homeodomain protein BELL1                     102   5e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009769608.1|  PREDICTED: BEL1-like homeodomain protein 4         105   5e-22   Nicotiana sylvestris
ref|XP_010938938.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...    105   5e-22   
dbj|BAJ95083.1|  predicted protein                                      105   5e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS53609.1|  BEL1-like homeodomain protein 2                         101   8e-22   Triticum urartu
ref|XP_010531191.1|  PREDICTED: BEL1-like homeodomain protein 4         104   9e-22   Tarenaya hassleriana [spider flower]
tpg|DAA43039.1|  TPA: putative POX domain/homeobox DNA-binding do...    101   9e-22   
ref|XP_010428562.1|  PREDICTED: BEL1-like homeodomain protein 3         103   1e-21   Camelina sativa [gold-of-pleasure]
ref|NP_177674.1|  BEL1-like homeodomain 3                               103   1e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AAL32623.1|  Similar to homeodomain proteins                         103   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302135.1|  hypothetical protein CARUB_v10020140mg             103   1e-21   Capsella rubella
ref|XP_002889024.1|  hypothetical protein ARALYDRAFT_476691             102   1e-21   
gb|ACU01965.1|  bell1-like protein                                      100   1e-21   Santalum album
ref|XP_010941926.1|  PREDICTED: BEL1-like homeodomain protein 4         103   1e-21   
emb|CDY29411.1|  BnaA06g13850D                                          101   1e-21   Brassica napus [oilseed rape]
ref|XP_006664357.1|  PREDICTED: BEL1-like homeodomain protein 1-like    101   1e-21   Oryza brachyantha
gb|ACU01957.1|  aintegumenta-like protein                               100   1e-21   Santalum album
ref|XP_010416424.1|  PREDICTED: BEL1-like homeodomain protein 3         102   1e-21   
ref|XP_010471651.1|  PREDICTED: BEL1-like homeodomain protein 3         102   1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010548375.1|  PREDICTED: BEL1-like homeodomain protein 4         103   1e-21   Tarenaya hassleriana [spider flower]
ref|XP_009376501.1|  PREDICTED: BEL1-like homeodomain protein 4         103   1e-21   
ref|NP_173400.1|  BEL1-like homeodomain 10                              102   2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010459643.1|  PREDICTED: BEL1-like homeodomain protein 10        102   2e-21   Camelina sativa [gold-of-pleasure]
emb|CDY39359.1|  BnaC05g15280D                                          102   2e-21   Brassica napus [oilseed rape]
tpg|DAA43544.1|  TPA: putative POX domain/homeobox DNA-binding do...    100   2e-21   
ref|XP_002893062.1|  hypothetical protein ARALYDRAFT_472196             102   2e-21   
ref|XP_010419211.1|  PREDICTED: BEL1-like homeodomain protein 11      97.4    2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010498393.1|  PREDICTED: BEL1-like homeodomain protein 10        102   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006307208.1|  hypothetical protein CARUB_v10008805mg             102   2e-21   Capsella rubella
gb|ACF83935.1|  unknown                                                 100   2e-21   Zea mays [maize]
ref|XP_009798621.1|  PREDICTED: BEL1-like homeodomain protein 9         100   2e-21   Nicotiana sylvestris
ref|XP_010459644.1|  PREDICTED: BEL1-like homeodomain protein 10        102   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010477192.1|  PREDICTED: BEL1-like homeodomain protein 10        102   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010312363.1|  PREDICTED: BEL1-like homeodomain protein 9 i...    100   2e-21   Solanum lycopersicum
ref|XP_003562164.1|  PREDICTED: homeobox protein BEL1 homolog           102   2e-21   Brachypodium distachyon [annual false brome]
ref|XP_002306891.2|  hypothetical protein POPTR_0005s25350g             101   2e-21   
ref|XP_010028619.1|  PREDICTED: BEL1-like homeodomain protein 7         102   2e-21   Eucalyptus grandis [rose gum]
gb|ACU01963.1|  bell1-like protein                                      100   2e-21   Comandra umbellata [bastard toadflax]
ref|XP_004173415.1|  PREDICTED: BEL1-like homeodomain protein 6-like    102   2e-21   
dbj|BAJ89622.1|  predicted protein                                      102   3e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006384929.1|  homeodomain-containing family protein              100   3e-21   
ref|XP_006341978.1|  PREDICTED: BEL1-like homeodomain protein 11-...    100   3e-21   Solanum tuberosum [potatoes]
gb|ACD39462.1|  BEL14 protein                                           102   3e-21   Solanum etuberosum
ref|XP_004500978.1|  PREDICTED: BEL1-like homeodomain protein 10-...    102   3e-21   Cicer arietinum [garbanzo]
gb|AAN03624.1|AF406700_1  BEL1-related homeotic protein 14              102   3e-21   Solanum tuberosum [potatoes]
ref|XP_004983819.1|  PREDICTED: homeobox protein BEL1 homolog iso...    102   3e-21   
ref|XP_009372989.1|  PREDICTED: BEL1-like homeodomain protein 6         102   3e-21   Pyrus x bretschneideri [bai li]
emb|CDX73170.1|  BnaC06g36180D                                          101   3e-21   
ref|XP_008382306.1|  PREDICTED: BEL1-like homeodomain protein 6         102   3e-21   Malus domestica [apple tree]
emb|CAN65696.1|  hypothetical protein VITISV_001987                     102   3e-21   Vitis vinifera
ref|XP_009106194.1|  PREDICTED: BEL1-like homeodomain protein 3         101   3e-21   Brassica rapa
ref|XP_004249839.1|  PREDICTED: BEL1-like homeodomain protein 9 i...    100   3e-21   Solanum lycopersicum
emb|CDY47524.1|  BnaAnng09220D                                          101   3e-21   Brassica napus [oilseed rape]
ref|XP_003539486.1|  PREDICTED: BEL1-like homeodomain protein 1-like    101   3e-21   Glycine max [soybeans]
ref|XP_003623151.1|  BEL1-like homeodomain protein                      101   3e-21   Medicago truncatula
gb|KHN17979.1|  BEL1-like homeodomain protein 1                         101   3e-21   Glycine soja [wild soybean]
ref|XP_010941766.1|  PREDICTED: BEL1-like homeodomain protein 4         102   3e-21   Elaeis guineensis
ref|XP_008377278.1|  PREDICTED: BEL1-like homeodomain protein 6 i...    102   3e-21   
ref|XP_010312362.1|  PREDICTED: BEL1-like homeodomain protein 9 i...    100   3e-21   Solanum lycopersicum
ref|XP_009128099.1|  PREDICTED: BEL1-like homeodomain protein 3         101   3e-21   Brassica rapa
ref|XP_008377277.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    102   3e-21   Malus domestica [apple tree]
ref|XP_010516766.1|  PREDICTED: BEL1-like homeodomain protein 7         101   3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_009395039.1|  PREDICTED: homeobox protein BEL1 homolog           101   3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011073138.1|  PREDICTED: homeobox protein BEL1 homolog           102   3e-21   Sesamum indicum [beniseed]
ref|XP_004515685.1|  PREDICTED: BEL1-like homeodomain protein 9-like    101   3e-21   Cicer arietinum [garbanzo]
ref|XP_009137061.1|  PREDICTED: BEL1-like homeodomain protein 7         100   3e-21   Brassica rapa
emb|CDY39031.1|  BnaA02g17200D                                          101   3e-21   Brassica napus [oilseed rape]
ref|XP_004978737.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    102   3e-21   
ref|XP_006390306.1|  hypothetical protein EUTSA_v10018381mg             101   3e-21   Eutrema salsugineum [saltwater cress]
emb|CDY52073.1|  BnaCnng21740D                                          100   3e-21   Brassica napus [oilseed rape]
tpg|DAA56837.1|  TPA: putative POX domain/homeobox DNA-binding do...  99.8    4e-21   
ref|XP_009347845.1|  PREDICTED: BEL1-like homeodomain protein 7         102   4e-21   Pyrus x bretschneideri [bai li]
ref|XP_003572007.1|  PREDICTED: BEL1-like homeodomain protein 4         102   4e-21   Brachypodium distachyon [annual false brome]
ref|XP_010093716.1|  BEL1-like homeodomain protein 1                    100   4e-21   
emb|CDX85896.1|  BnaC06g22380D                                          101   4e-21   
ref|XP_008355199.1|  PREDICTED: BEL1-like homeodomain protein 9       99.4    4e-21   
ref|XP_007140461.1|  hypothetical protein PHAVU_008G114300g             102   4e-21   Phaseolus vulgaris [French bean]
dbj|BAK04286.1|  predicted protein                                      102   4e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS59583.1|  hypothetical protein M569_15223                       99.4    4e-21   Genlisea aurea
ref|NP_001066216.1|  Os12g0160500                                       100   4e-21   
ref|XP_002465808.1|  hypothetical protein SORBIDRAFT_01g046170          102   4e-21   Sorghum bicolor [broomcorn]
ref|XP_002465020.1|  hypothetical protein SORBIDRAFT_01g030620          102   4e-21   Sorghum bicolor [broomcorn]
ref|XP_010489213.1|  PREDICTED: BEL1-like homeodomain protein 7         100   4e-21   Camelina sativa [gold-of-pleasure]
gb|EYU32892.1|  hypothetical protein MIMGU_mgv1a006708mg                100   4e-21   Erythranthe guttata [common monkey flower]
dbj|BAJ99003.1|  predicted protein                                      102   4e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009149453.1|  PREDICTED: BEL1-like homeodomain protein 10        101   4e-21   Brassica rapa
ref|XP_006297524.1|  hypothetical protein CARUB_v10013548mg             100   4e-21   Capsella rubella
ref|XP_002886224.1|  hypothetical protein ARALYDRAFT_480804             100   4e-21   
dbj|BAK05542.1|  predicted protein                                      102   4e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002313027.2|  hypothetical protein POPTR_0009s12360g             101   4e-21   
ref|XP_003576293.1|  PREDICTED: BEL1-like homeodomain protein 1         102   4e-21   Brachypodium distachyon [annual false brome]
ref|XP_009619241.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    101   5e-21   Nicotiana tomentosiformis
ref|NP_001140490.1|  uncharacterized protein LOC100272551               100   5e-21   Zea mays [maize]
ref|XP_010467364.1|  PREDICTED: BEL1-like homeodomain protein 7         100   5e-21   Camelina sativa [gold-of-pleasure]
emb|CDY02261.1|  BnaA03g39060D                                          100   5e-21   
ref|XP_011048824.1|  PREDICTED: BEL1-like homeodomain protein 11        100   5e-21   Populus euphratica
ref|XP_009136305.1|  PREDICTED: BEL1-like homeodomain protein 7         100   5e-21   Brassica rapa
ref|XP_011037163.1|  PREDICTED: BEL1-like homeodomain protein 6         102   5e-21   Populus euphratica
gb|KJB79130.1|  hypothetical protein B456_013G034600                    101   5e-21   Gossypium raimondii
gb|AFW65587.1|  putative POX domain/homeobox DNA-binding domain f...    102   5e-21   
ref|XP_007047071.1|  BEL1-like homeodomain protein 2 isoform 2          102   5e-21   
ref|XP_008679683.1|  PREDICTED: BEL1-like homeodomain protein 1         102   5e-21   Zea mays [maize]
ref|XP_004985591.1|  PREDICTED: BEL1-like homeodomain protein 7-l...    101   5e-21   Setaria italica
ref|NP_001168681.1|  putative POX domain/homeobox DNA-binding dom...    101   5e-21   Zea mays [maize]
gb|KHN21192.1|  BEL1-like homeodomain protein 1                         101   5e-21   Glycine soja [wild soybean]
ref|XP_004156658.1|  PREDICTED: BEL1-like homeodomain protein 9-like  99.0    5e-21   
gb|ACD39467.1|  BEL30 protein                                           102   5e-21   Solanum palustre
ref|XP_010428564.1|  PREDICTED: BEL1-like homeodomain protein 11      99.0    5e-21   Camelina sativa [gold-of-pleasure]
ref|XP_002889025.1|  predicted protein                                99.0    5e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_002306123.2|  hypothetical protein POPTR_0004s16660g             101   5e-21   
gb|EYU37829.1|  hypothetical protein MIMGU_mgv1a003764mg                101   5e-21   Erythranthe guttata [common monkey flower]
ref|XP_009761066.1|  PREDICTED: BEL1-like homeodomain protein 11 ...  99.0    5e-21   Nicotiana sylvestris
dbj|BAJ34230.1|  unnamed protein product                                100   5e-21   Eutrema halophilum
gb|KEH36201.1|  BEL1-related homeotic protein                           100   5e-21   Medicago truncatula
gb|AFV13862.1|  replumless-like protein RPL                           96.7    5e-21   Cakile lanceolata [searocket]
gb|EEE52807.1|  hypothetical protein OsJ_35304                          101   5e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010416425.1|  PREDICTED: BEL1-like homeodomain protein 11      99.0    5e-21   Camelina sativa [gold-of-pleasure]
tpg|DAA43547.1|  TPA: putative POX domain/homeobox DNA-binding do...    101   5e-21   
ref|XP_007042091.1|  BEL1-like homeodomain protein 6 isoform 1          102   5e-21   
gb|KDP41749.1|  hypothetical protein JCGZ_26767                         102   5e-21   Jatropha curcas
gb|KEH36200.1|  BEL1-related homeotic protein                           101   5e-21   Medicago truncatula
gb|AFV13869.1|  replumless-like protein RPL                           96.7    5e-21   Erucaria erucarioides
ref|NP_179233.1|  BEL1-like homeodomain 7                               100   5e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CBI30476.3|  unnamed protein product                                101   5e-21   Vitis vinifera
gb|KHG17019.1|  BEL1-like homeodomain protein 6                         101   5e-21   Gossypium arboreum [tree cotton]
gb|AAL10487.1|  At2g16400/F16F14.10                                     100   5e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301007.1|  hypothetical protein CARUB_v10021397mg           99.0    6e-21   Capsella rubella
emb|CDO97015.1|  unnamed protein product                                101   6e-21   Coffea canephora [robusta coffee]
gb|AAP47023.1|AF375964_1  bell-like homeodomain protein 3               100   6e-21   Solanum lycopersicum
ref|XP_004985907.1|  PREDICTED: homeobox protein BEL1 homolog iso...    101   6e-21   Setaria italica
gb|EYU41787.1|  hypothetical protein MIMGU_mgv1a002791mg                101   6e-21   Erythranthe guttata [common monkey flower]
ref|XP_002974618.1|  hypothetical protein SELMODRAFT_414952             102   6e-21   
ref|XP_004961888.1|  PREDICTED: BEL1-like homeodomain protein 9-like    101   6e-21   Setaria italica
ref|XP_011047809.1|  PREDICTED: BEL1-like homeodomain protein 7         101   6e-21   Populus euphratica
emb|CDX89711.1|  BnaC03g46250D                                          100   6e-21   
gb|KEH29763.1|  BEL1-related homeotic protein                           102   6e-21   Medicago truncatula
ref|NP_177676.2|  BEL1-like homeodomain 11                            98.6    6e-21   Arabidopsis thaliana [mouse-ear cress]
gb|ACD39463.1|  BEL30 protein                                           101   6e-21   Solanum etuberosum
ref|XP_006663234.1|  PREDICTED: BEL1-like homeodomain protein 1-like    101   6e-21   Oryza brachyantha
ref|XP_006362026.1|  PREDICTED: BEL1-related homeotic protein 30        101   6e-21   Solanum tuberosum [potatoes]
ref|XP_010654234.1|  PREDICTED: BEL1-like homeodomain protein 9         101   6e-21   Vitis vinifera
ref|XP_007199727.1|  hypothetical protein PRUPE_ppa002499mg             101   6e-21   
ref|XP_003532909.1|  PREDICTED: homeobox protein BEL1 homolog iso...    101   6e-21   Glycine max [soybeans]
ref|XP_002512955.1|  bel1 homeotic protein, putative                    101   6e-21   Ricinus communis
gb|KHG19008.1|  BEL1-like homeodomain protein 9                         100   6e-21   Gossypium arboreum [tree cotton]
emb|CAN73410.1|  hypothetical protein VITISV_024375                     101   6e-21   Vitis vinifera
ref|XP_010557975.1|  PREDICTED: BEL1-like homeodomain protein 1         101   6e-21   Tarenaya hassleriana [spider flower]
ref|XP_004246395.1|  PREDICTED: BEL1-like homeodomain protein 9         100   6e-21   Solanum lycopersicum
ref|XP_010437584.1|  PREDICTED: BEL1-like homeodomain protein 6         100   6e-21   
ref|XP_008236952.1|  PREDICTED: BEL1-like homeodomain protein 7         101   7e-21   
ref|XP_003540818.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    101   7e-21   
gb|EMT07957.1|  BEL1-like homeodomain protein 4                         100   7e-21   
ref|NP_001275368.1|  BEL1-related homeotic protein 30                   101   7e-21   
ref|XP_010107836.1|  BEL1-like homeodomain protein 6                    101   7e-21   
ref|XP_004291836.1|  PREDICTED: BEL1-like homeodomain protein 11      99.8    7e-21   
ref|XP_004289652.1|  PREDICTED: BEL1-like homeodomain protein 6         101   7e-21   
ref|NP_180290.2|  BEL1-like homeodomain 5                             99.8    7e-21   
ref|XP_006416473.1|  hypothetical protein EUTSA_v10007267mg             100   7e-21   
ref|XP_006649449.1|  PREDICTED: BEL1-like homeodomain protein 7-like    101   7e-21   
gb|KJB16914.1|  hypothetical protein B456_002G255800                    100   7e-21   
gb|AAM15481.1|  putative homeodomain transcription factor             99.8    7e-21   
ref|XP_010548069.1|  PREDICTED: BEL1-like homeodomain protein 6         101   7e-21   
ref|XP_010545511.1|  PREDICTED: homeobox protein BEL1 homolog           101   7e-21   
ref|XP_006283499.1|  hypothetical protein CARUB_v10004551mg             100   7e-21   
ref|XP_008221348.1|  PREDICTED: BEL1-like homeodomain protein 11        100   7e-21   
ref|XP_002439906.1|  hypothetical protein SORBIDRAFT_09g022270          100   7e-21   
ref|XP_004150064.1|  PREDICTED: BEL1-like homeodomain protein 6-like    101   7e-21   
ref|XP_010066189.1|  PREDICTED: BEL1-like homeodomain protein 6         101   7e-21   
ref|XP_009138307.1|  PREDICTED: BEL1-like homeodomain protein 6         100   7e-21   
ref|XP_006294234.1|  hypothetical protein CARUB_v10023231mg           99.8    7e-21   
ref|XP_010432392.1|  PREDICTED: BEL1-like homeodomain protein 6         100   7e-21   
gb|KHN12676.1|  BEL1-like homeodomain protein 7                         101   8e-21   
gb|ACN27211.1|  unknown                                               98.2    8e-21   
ref|XP_006838675.1|  hypothetical protein AMTR_s00002p00243900          101   8e-21   
gb|EAY82346.1|  hypothetical protein OsI_37556                          101   8e-21   
ref|XP_008647499.1|  PREDICTED: uncharacterized protein LOC100272...    100   8e-21   
ref|XP_006343945.1|  PREDICTED: homeobox protein BEL1 homolog           101   8e-21   
ref|XP_003549446.2|  PREDICTED: BEL1-like homeodomain protein 3-like    101   8e-21   
ref|XP_008460982.1|  PREDICTED: BEL1-like homeodomain protein 7         101   8e-21   
ref|XP_009761064.1|  PREDICTED: BEL1-like homeodomain protein 11 ...  99.4    8e-21   
ref|NP_001065808.2|  Os11g0158600                                       101   8e-21   
gb|AAP47024.1|AF375965_1  bell-like homeodomain protein 1             99.0    8e-21   
ref|XP_010254698.1|  PREDICTED: BEL1-like homeodomain protein 6         101   8e-21   
ref|XP_002867111.1|  hypothetical protein ARALYDRAFT_912924             100   8e-21   
ref|XP_009619240.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    101   8e-21   
ref|XP_011080922.1|  PREDICTED: homeobox protein BEL1 homolog           101   8e-21   
ref|XP_009592944.1|  PREDICTED: BEL1-like homeodomain protein 11      99.4    8e-21   
ref|XP_007223034.1|  hypothetical protein PRUPE_ppa005361mg           99.8    8e-21   
ref|XP_006340982.1|  PREDICTED: BEL1-like homeodomain protein 9-like    100   8e-21   
dbj|BAJ94700.1|  predicted protein                                      100   8e-21   
ref|XP_006649302.1|  PREDICTED: homeobox protein BEL1 homolog           100   8e-21   
ref|NP_195187.1|  BEL1-like homeodomain 6                               100   8e-21   
ref|XP_003551512.1|  PREDICTED: BEL1-like homeodomain protein 9-like    100   8e-21   
gb|KHN06991.1|  BEL1-like homeodomain protein 9                         100   8e-21   
ref|XP_010521016.1|  PREDICTED: BEL1-like homeodomain protein 1         101   9e-21   
ref|XP_009106195.1|  PREDICTED: BEL1-like homeodomain protein 11      98.2    9e-21   
emb|CBI38029.3|  unnamed protein product                                100   9e-21   
gb|EYU18114.1|  hypothetical protein MIMGU_mgv1a010011mg              98.6    9e-21   
emb|CDY47523.1|  BnaAnng09210D                                        98.2    9e-21   
ref|XP_006390303.1|  hypothetical protein EUTSA_v10018958mg           98.2    9e-21   
gb|EEE51686.1|  hypothetical protein OsJ_33045                          101   9e-21   
ref|NP_001048808.1|  Os03g0124000                                       100   9e-21   
ref|XP_004506223.1|  PREDICTED: BEL1-like homeodomain protein 1-like    100   9e-21   
emb|CDX73171.1|  BnaC06g36190D                                        98.2    9e-21   
ref|XP_004238268.1|  PREDICTED: BEL1-like homeodomain protein 11      99.4    9e-21   
ref|XP_010447052.1|  PREDICTED: BEL1-like homeodomain protein 6         100   9e-21   
ref|XP_008675423.1|  PREDICTED: BEL1-related homeotic protein 14 ...    100   9e-21   
ref|XP_011094923.1|  PREDICTED: BEL1-like homeodomain protein 9 i...    100   9e-21   
ref|XP_003631586.1|  PREDICTED: BEL1-like homeodomain protein 3         101   9e-21   
ref|XP_006487350.1|  PREDICTED: BEL1-like homeodomain protein 6-l...    101   9e-21   
ref|NP_001049067.1|  Os03g0165300                                       100   9e-21   
ref|NP_001189615.1|  BEL1-like homeodomain 5                          99.4    9e-21   
ref|XP_004143976.1|  PREDICTED: homeobox protein BEL1 homolog           100   9e-21   
gb|KJB20609.1|  hypothetical protein B456_003G156000                    100   9e-21   
ref|XP_010275541.1|  PREDICTED: BEL1-like homeodomain protein 11      99.8    9e-21   
ref|XP_006487349.1|  PREDICTED: BEL1-like homeodomain protein 6-l...    101   9e-21   
gb|EEE51314.1|  hypothetical protein OsJ_32275                          100   9e-21   
gb|KDO49465.1|  hypothetical protein CISIN_1g038021mg                   101   1e-20   
gb|KDP38560.1|  hypothetical protein JCGZ_04485                         101   1e-20   
gb|EAY88336.1|  hypothetical protein OsI_09793                          100   1e-20   
ref|XP_011094924.1|  PREDICTED: BEL1-like homeodomain protein 9 i...    100   1e-20   
gb|KJB32555.1|  hypothetical protein B456_005G246400                    100   1e-20   
ref|XP_011083617.1|  PREDICTED: BEL1-like homeodomain protein 11      99.8    1e-20   
ref|NP_001148180.1|  BEL1-related homeotic protein 14                   100   1e-20   
ref|XP_008674921.1|  PREDICTED: bell-like homeodomain protein 3 i...    100   1e-20   
ref|XP_006412205.1|  hypothetical protein EUTSA_v10024906mg             100   1e-20   
ref|XP_006423388.1|  hypothetical protein CICLE_v10027952mg             101   1e-20   
ref|XP_010089795.1|  BEL1-like homeodomain protein 1                    101   1e-20   
ref|XP_010275538.1|  PREDICTED: BEL1-like homeodomain protein 6         101   1e-20   
gb|KHN33725.1|  BEL1-like homeodomain protein 6                         100   1e-20   
ref|XP_006577910.1|  PREDICTED: BEL1-like homeodomain protein 6-l...    100   1e-20   
gb|EMS60062.1|  BEL1-like homeodomain protein 6                         100   1e-20   
ref|XP_010053224.1|  PREDICTED: homeobox protein BEL1 homolog           101   1e-20   
emb|CAN62866.1|  hypothetical protein VITISV_015924                     101   1e-20   
ref|XP_009757871.1|  PREDICTED: BEL1-like homeodomain protein 7         100   1e-20   
ref|XP_006435066.1|  hypothetical protein CICLE_v10001116mg           98.6    1e-20   
ref|NP_001065164.1|  Os10g0534900                                       100   1e-20   
ref|XP_004298825.1|  PREDICTED: homeobox protein BEL1 homolog           100   1e-20   
ref|XP_006349489.1|  PREDICTED: BEL1-like homeodomain protein 9-like    100   1e-20   
ref|XP_011088451.1|  PREDICTED: BEL1-like homeodomain protein 7         100   1e-20   
ref|XP_006595918.1|  PREDICTED: BEL1-like homeodomain protein 3-l...    100   1e-20   
ref|NP_001147936.1|  bell-like homeodomain protein 3                    100   1e-20   
ref|XP_007040322.1|  POX family protein isoform 1                       100   1e-20   
ref|XP_010228131.1|  PREDICTED: homeobox protein BEL1 homolog iso...  98.6    1e-20   
ref|XP_010417873.1|  PREDICTED: BEL1-like homeodomain protein 5       99.0    1e-20   
ref|XP_008784116.1|  PREDICTED: BEL1-like homeodomain protein 1         100   1e-20   
gb|EPS71587.1|  hypothetical protein M569_03172                         100   1e-20   
ref|XP_007017639.1|  BEL1-like homeodomain protein 11 isoform 1       99.4    1e-20   
dbj|BAJ98782.1|  predicted protein                                      100   1e-20   
gb|AAN03622.1|AF406698_1  BEL1-related homeotic protein 11              100   1e-20   
gb|KGN50071.1|  hypothetical protein Csa_5G152860                       100   1e-20   
ref|XP_008230296.1|  PREDICTED: BEL1-like homeodomain protein 1         100   1e-20   
ref|XP_010544329.1|  PREDICTED: BEL1-like homeodomain protein 5         100   1e-20   
ref|XP_010473114.1|  PREDICTED: BEL1-like homeodomain protein 5       98.6    1e-20   
gb|EYU23458.1|  hypothetical protein MIMGU_mgv1a002357mg                100   1e-20   
ref|XP_010059079.1|  PREDICTED: BEL1-like homeodomain protein 1         100   1e-20   
gb|EEC67362.1|  hypothetical protein OsI_34463                          100   1e-20   
ref|XP_010533636.1|  PREDICTED: homeobox protein BEL1 homolog           100   1e-20   
ref|XP_002464081.1|  hypothetical protein SORBIDRAFT_01g011960          100   1e-20   
ref|XP_007160096.1|  hypothetical protein PHAVU_002G292000g             100   1e-20   
gb|KJB52176.1|  hypothetical protein B456_008G248900                    100   1e-20   
ref|XP_008373620.1|  PREDICTED: homeobox protein BEL1 homolog           100   1e-20   
ref|XP_008442501.1|  PREDICTED: BEL1-like homeodomain protein 9       99.4    1e-20   
ref|XP_007017640.1|  BEL1-like homeodomain protein 11 isoform 2       99.4    1e-20   
gb|KJB24319.1|  hypothetical protein B456_004G139300                    100   1e-20   
gb|EEE64958.1|  hypothetical protein OsJ_19849                        98.2    1e-20   
ref|XP_009606015.1|  PREDICTED: BEL1-like homeodomain protein 9       99.8    1e-20   
ref|XP_002509843.1|  bel1 homeotic protein, putative                    100   1e-20   
ref|XP_008437318.1|  PREDICTED: LOW QUALITY PROTEIN: homeobox pro...    100   1e-20   
gb|KDO76309.1|  hypothetical protein CISIN_1g005058mg                   100   1e-20   
ref|XP_008377240.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...  97.4    1e-20   
dbj|BAJ04689.1|  BEL1-type homeodomain protein                          100   1e-20   
ref|XP_003562035.1|  PREDICTED: BEL1-like homeodomain protein 7         100   1e-20   
ref|XP_007208166.1|  hypothetical protein PRUPE_ppa002583mg             100   1e-20   
gb|KDO76305.1|  hypothetical protein CISIN_1g005058mg                   100   1e-20   
ref|XP_002510447.1|  bel1 homeotic protein, putative                  99.4    1e-20   
ref|XP_006439494.1|  hypothetical protein CICLE_v10019130mg             100   1e-20   
ref|XP_004970574.1|  PREDICTED: BEL1-like homeodomain protein 9-like    100   1e-20   
ref|XP_010089065.1|  Homeobox protein BEL1-like protein                 100   1e-20   
ref|XP_009363416.1|  PREDICTED: homeobox protein BEL1 homolog           100   1e-20   
ref|XP_009363409.1|  PREDICTED: homeobox protein BEL1 homolog           100   1e-20   
gb|EPS62339.1|  hypothetical protein M569_12452                       99.0    1e-20   
gb|KDO84667.1|  hypothetical protein CISIN_1g005863mg                   100   1e-20   
ref|XP_010471654.1|  PREDICTED: BEL1-like homeodomain protein 11      97.8    1e-20   
ref|XP_007132496.1|  hypothetical protein PHAVU_011G099100g             100   1e-20   
ref|XP_003539151.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    100   1e-20   
ref|XP_006435065.1|  hypothetical protein CICLE_v10000508mg             100   1e-20   
ref|XP_004499204.1|  PREDICTED: BEL1-like homeodomain protein 10-...    100   1e-20   
gb|KHN19925.1|  BEL1-like homeodomain protein 1                         100   1e-20   
ref|XP_007160715.1|  hypothetical protein PHAVU_001G011000g             100   1e-20   
ref|XP_004137755.1|  PREDICTED: BEL1-like homeodomain protein 9-like  99.4    1e-20   
ref|XP_006476516.1|  PREDICTED: homeobox protein BEL1 homolog           100   1e-20   
ref|XP_010325299.1|  PREDICTED: bell-like homeodomain protein 3 i...    100   2e-20   
ref|XP_011077622.1|  PREDICTED: BEL1-like homeodomain protein 9         100   2e-20   
ref|XP_007136630.1|  hypothetical protein PHAVU_009G060400g           99.8    2e-20   
gb|KEH21114.1|  BEL1-related homeotic protein                           100   2e-20   
ref|XP_006409439.1|  hypothetical protein EUTSA_v10022660mg           99.4    2e-20   
ref|XP_003523566.1|  PREDICTED: BEL1-like homeodomain protein 10-...    100   2e-20   
ref|NP_001266274.1|  bell-like homeodomain protein 3                    100   2e-20   
ref|XP_009110262.1|  PREDICTED: BEL1-like homeodomain protein 10      99.4    2e-20   
gb|KHG01894.1|  BEL1-like homeodomain protein 1                         100   2e-20   
ref|XP_009396189.1|  PREDICTED: homeobox protein BEL1 homolog           100   2e-20   
ref|XP_009335838.1|  PREDICTED: BEL1-like homeodomain protein 11      99.0    2e-20   
gb|AGU36610.1|  BEL1-related homeotic protein 29                      95.9    2e-20   
ref|XP_008238940.1|  PREDICTED: homeobox protein BEL1 homolog           100   2e-20   
ref|XP_002458762.1|  hypothetical protein SORBIDRAFT_03g039840          100   2e-20   
gb|KJB16539.1|  hypothetical protein B456_002G234900                    100   2e-20   
ref|XP_011029331.1|  PREDICTED: homeobox protein BEL1 homolog           100   2e-20   
ref|XP_006473896.1|  PREDICTED: BEL1-like homeodomain protein 11-...  98.6    2e-20   
ref|XP_003589334.1|  BEL1-like homeodomain protein                      100   2e-20   
ref|XP_007210325.1|  hypothetical protein PRUPE_ppa002081mg             100   2e-20   
gb|KDP25399.1|  hypothetical protein JCGZ_20555                         100   2e-20   
ref|XP_009773899.1|  PREDICTED: BEL1-like homeodomain protein 1         100   2e-20   
ref|XP_003568329.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...    100   2e-20   
gb|KHN45879.1|  BEL1-like homeodomain protein 11                      97.8    2e-20   
ref|XP_007160717.1|  hypothetical protein PHAVU_001G011100g             100   2e-20   
gb|AGU36609.1|  BEL1-related homeotic protein 29                      95.9    2e-20   
ref|XP_009604673.1|  PREDICTED: homeobox protein BEL1 homolog           100   2e-20   
gb|AFV46214.1|  hypothetical protein                                  97.1    2e-20   
gb|AGU36604.1|  BEL1-related homeotic protein 29                      95.9    2e-20   
gb|AGU36605.1|  BEL1-related homeotic protein 29                      95.9    2e-20   
gb|AGU36603.1|  BEL1-related homeotic protein 29                      95.9    2e-20   
tpg|DAA56836.1|  TPA: putative POX domain/homeobox DNA-binding do...    100   2e-20   
gb|AGU36600.1|  BEL1-related homeotic protein 29                      95.9    2e-20   
gb|EEE58381.1|  hypothetical protein OsJ_09538                          100   2e-20   
ref|XP_008801354.1|  PREDICTED: BEL1-like homeodomain protein 9       99.8    2e-20   
ref|XP_006435067.1|  hypothetical protein CICLE_v10001116mg           98.6    2e-20   
ref|XP_009613053.1|  PREDICTED: BEL1-like homeodomain protein 1         100   2e-20   
ref|XP_003543416.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    100   2e-20   
gb|KDO84669.1|  hypothetical protein CISIN_1g012938mg                 98.6    2e-20   
ref|XP_004503684.1|  PREDICTED: homeobox protein BEL1 homolog           100   2e-20   
ref|XP_003527678.1|  PREDICTED: BEL1-like homeodomain protein 3-l...    100   2e-20   
ref|XP_008811362.1|  PREDICTED: BEL1-like homeodomain protein 9       99.8    2e-20   
gb|EPS61807.1|  hypothetical protein M569_12981                       98.2    2e-20   
ref|XP_004230877.1|  PREDICTED: BEL1-like homeodomain protein 7         100   2e-20   
gb|ACD39465.1|  BEL14 protein                                         99.4    2e-20   
ref|XP_010254699.1|  PREDICTED: BEL1-like homeodomain protein 11      98.6    2e-20   
ref|XP_010255251.1|  PREDICTED: homeobox protein BEL1 homolog           100   2e-20   
ref|NP_001274921.1|  BEL1-related homeotic protein 5                    100   2e-20   
ref|XP_006654500.1|  PREDICTED: BEL1-like homeodomain protein 9-like  99.8    2e-20   
ref|NP_001055721.1|  Os05g0455200                                     99.8    2e-20   
ref|XP_009358787.1|  PREDICTED: BEL1-like homeodomain protein 9         100   2e-20   
ref|XP_008388082.1|  PREDICTED: BEL1-like homeodomain protein 9         100   2e-20   
ref|XP_010558342.1|  PREDICTED: BEL1-like homeodomain protein 9 i...  99.4    2e-20   
ref|XP_003517476.1|  PREDICTED: homeobox protein BEL1 homolog iso...    100   2e-20   
gb|KJB47546.1|  hypothetical protein B456_008G031100                    100   2e-20   
gb|KHG12221.1|  BEL1-like homeodomain protein 6                         100   2e-20   
gb|KDO76303.1|  hypothetical protein CISIN_1g005058mg                   100   2e-20   
gb|KHN22224.1|  BEL1-like homeodomain protein 3                       99.8    2e-20   
ref|XP_009629592.1|  PREDICTED: BEL1-like homeodomain protein 1         100   2e-20   
emb|CDX96653.1|  BnaA08g21960D                                        99.4    2e-20   
gb|AGU36602.1|  BEL1-related homeotic protein 29                      95.5    2e-20   
ref|XP_010088560.1|  BEL1-like homeodomain protein 9                  99.8    2e-20   
ref|XP_006646480.1|  PREDICTED: BEL1-like homeodomain protein 9-like  99.8    2e-20   
gb|KJB47548.1|  hypothetical protein B456_008G031100                    100   2e-20   
ref|XP_008783445.1|  PREDICTED: homeobox protein BEL1 homolog         99.8    2e-20   
ref|XP_009800804.1|  PREDICTED: homeobox protein BEL1 homolog           100   2e-20   
ref|XP_006361091.1|  PREDICTED: BEL1-related homeotic protein 5         100   2e-20   
ref|XP_008796600.1|  PREDICTED: BEL1-like homeodomain protein 7 i...  99.4    2e-20   
gb|EEE63947.1|  hypothetical protein OsJ_18772                        99.8    2e-20   
ref|NP_001234599.1|  bell-like homeodomain protein 2                    100   2e-20   
gb|EAY98277.1|  hypothetical protein OsI_20184                        99.8    2e-20   
gb|AFW75231.1|  putative POX domain/homeobox DNA-binding domain f...  97.1    2e-20   
emb|CDP07471.1|  unnamed protein product                              98.2    2e-20   
gb|KJB76817.1|  hypothetical protein B456_012G108300                  99.8    2e-20   
ref|XP_002281033.1|  PREDICTED: BEL1-like homeodomain protein 11      98.6    2e-20   
ref|XP_009778869.1|  PREDICTED: BEL1-like homeodomain protein 1         100   2e-20   
ref|XP_007134014.1|  hypothetical protein PHAVU_010G011900g           99.8    2e-20   
ref|XP_009404911.1|  PREDICTED: BEL1-like homeodomain protein 1         100   2e-20   



>ref|XP_009773433.1| PREDICTED: BEL1-like homeodomain protein 4 [Nicotiana sylvestris]
Length=657

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 127/211 (60%), Gaps = 20/211 (9%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VNVLR+WLFEHFL+PYPSEADK LLSRQTGLSKNQVSNWFINARVRLWKPMVEEMY+QET
Sbjct  451  VNVLRAWLFEHFLHPYPSEADKHLLSRQTGLSKNQVSNWFINARVRLWKPMVEEMYQQET  510

Query  507  keeENAQTPMPRDDDDDNSKE-ItattsttptttttlpsaaaTKRCQFNATENDSSRTni  331
            KEEE  Q     + ++  S + +     +   T+ T  +   + R +FNA E D S+  I
Sbjct  511  KEEETDQDQEEEEQENQVSAQTLMHDKISNMATSATTTTMPLSVRSEFNANERDLSKNII  570

Query  330  innyaaqyaASGNQVTMINGNTAA-------VPPPVSLSFAAAAAP--VVDCGGGFGTPA  178
                 A     GNQ+ M+  +TA        V   V+  F AA A   V +    FG+  
Sbjct  571  NYRQYAL----GNQLVMLQDDTATASSATHDVSTTVNRYFTAADAADLVANSNATFGSQP  626

Query  177  TGDVSLTLGLRHPEN------SVTITNFGAY  103
             GDVSLTLGLRH EN         + +FGAY
Sbjct  627  AGDVSLTLGLRHSENVPRKTTQFQLRDFGAY  657



>ref|XP_009614985.1| PREDICTED: BEL1-like homeodomain protein 4 [Nicotiana tomentosiformis]
Length=659

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 124/211 (59%), Gaps = 20/211 (9%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VNVLR+WLFEHFL+PYPSEADK LLSRQTGLSKNQVSNWFINARVRLWKPMVEEMY+QET
Sbjct  453  VNVLRAWLFEHFLHPYPSEADKHLLSRQTGLSKNQVSNWFINARVRLWKPMVEEMYQQET  512

Query  507  keeENAQTPMPRDDDDDNSKEItattsttptttttlpsaa-aTKRCQFNATENDSSRTni  331
            KE E  Q     + +   S + +     +   T+   +    + R +FNA E D S+  I
Sbjct  513  KEVETDQDQEEEEQEKQLSAQTSMHDKISNMATSATTTTMPLSVRSEFNANERDPSKNII  572

Query  330  innyaaqyaASGNQVTMINGNTAA-------VPPPVSLSFAAAAAP--VVDCGGGFGTPA  178
                 A     GNQ+ M+  +TA        V   V+  F AA A   V +    FG+  
Sbjct  573  NYRQYAL----GNQLIMLQDDTATGSSATHDVSTTVNHYFTAADAADLVANSNTAFGSQP  628

Query  177  TGDVSLTLGLRHPEN------SVTITNFGAY  103
             GDVSLTLGLRH EN         + +FGAY
Sbjct  629  AGDVSLTLGLRHSENVPRKTTQFQLRDFGAY  659



>ref|XP_006366455.1| PREDICTED: BEL1-like homeodomain protein 4-like [Solanum tuberosum]
Length=624

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 97/224 (43%), Positives = 121/224 (54%), Gaps = 46/224 (21%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeq--  514
            VNVLR+WLFEHFL+PYPSEADK LLSRQTGLSKNQVSNWFINARVRLWKPMVEEMY+Q  
Sbjct  418  VNVLRAWLFEHFLHPYPSEADKHLLSRQTGLSKNQVSNWFINARVRLWKPMVEEMYQQET  477

Query  513  --------------etkeeENAQTPMPRDDDDDNSKEItattsttptttttlpsaaaTKR  376
                          + ++E+ AQ PM      D +  +  +++TT   ++         R
Sbjct  478  KEEETDQEEDQEQQQQQQEKQAQIPM-----HDKTTNMATSSATTMPLSSV--------R  524

Query  375  CQFNATENDSSRTniinnyaaqyaASGNQVTMINGNTAAVPPPVSLSFAAAAAPV-----  211
             +FNA E D S+  I           GNQ+ M+  +  A     +  +  A   V     
Sbjct  525  SEFNANERDPSKNIINYRQYPL----GNQLVMLQSDDTATASTSNHHYFTAVDAVDLVAN  580

Query  210  --VDCGGGFGTPATGDVSLTLGLRHPEN------SVTITNFGAY  103
              V     FG+   GDVSLTLGLRH EN         + +FGAY
Sbjct  581  SNVANTAAFGSQQAGDVSLTLGLRHSENVPRKPAQFQLRDFGAY  624



>gb|KJB43577.1| hypothetical protein B456_007G207200 [Gossypium raimondii]
 gb|KJB43578.1| hypothetical protein B456_007G207200 [Gossypium raimondii]
Length=800

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 127/233 (55%), Gaps = 46/233 (20%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVEEMY+QET
Sbjct  574  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQET  633

Query  507  keeENAQTPM-----PRDDDDDNSKEItattsttptttttlpsaaaTKRCQFNATENDSS  343
            KEE + +         R+ + +N+     +T +T    TT  + +  K  Q NATEND S
Sbjct  634  KEEGDHKNNNNNNHTERERNPNNNNNAQTSTPSTTAAPTTTTTTSVGKGSQINATENDPS  693

Query  342  RTniinnyaaqyaASGNQVTMINGNTAAVPPPVSLSF------------------AAAAA  217
                +         S NQ    N N A V PP+S  F                    AAA
Sbjct  694  ----LIAINTPQCFSENQA---NPNAAEVAPPISQPFTTSIPHDSDIHHQRIAGTTVAAA  746

Query  216  PVVDCGGG----------FGTPATGDVSLTLGLRH----PEN--SVTITNFGA  106
                  GG           GT   GDVSLTLGLRH    PEN  S ++ +FG 
Sbjct  747  DYGTTAGGNTDIGSSLIRLGTTTAGDVSLTLGLRHAGNMPENTSSFSVRDFGG  799



>ref|XP_008338177.1| PREDICTED: BEL1-like homeodomain protein 2 [Malus domestica]
Length=368

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 95/224 (42%), Positives = 113/224 (50%), Gaps = 46/224 (21%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVEEMY+QE 
Sbjct  124  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQEA  183

Query  507  --------------keeENAQTPMPRDDDDDNSKEItattsttptttttlpsaaaTKRCQ  370
                               A     R+++   S +    T TT TT     ++   KR  
Sbjct  184  NEEEEEVGGGGGGGAVSATADQERERNBNAGFSAQTPTPTMTTATTPPPTTNSPTGKRSD  243

Query  369  FNATENDSSRTniinnyaaqyaASGNQVTMINGNTAAVPPPVSLSFAAAAAPVVDCGGG-  193
             NA+ENDSS    +           +   M    ++AV PP S  F AAAA       G 
Sbjct  244  INASENDSS----LIAINRHQQQQQHHPMMATTTSSAVAPPASQCFTAAAADDTCRSYGT  299

Query  192  --------------------------FG-TPATGDVSLTLGLRH  142
                                      FG T A GDVSLTLGLRH
Sbjct  300  TSGNANIAAHHDHPNSSNIGSSKLTSFGTTTAAGDVSLTLGLRH  343



>ref|XP_006283200.1| hypothetical protein CARUB_v10004235mg [Capsella rubella]
 gb|EOA16098.1| hypothetical protein CARUB_v10004235mg [Capsella rubella]
Length=663

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 123/221 (56%), Gaps = 26/221 (12%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVEEMY+QE+
Sbjct  443  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQES  502

Query  507  ke-------------eENAQTPMPRDDDDDN---SKEItattsttptttttlpsaaaTKR  376
            KE               N ++  P D+++ N   ++  ++ T  T        +     R
Sbjct  503  KERERERERDQETKNSNNDKSTKPNDNNESNFTAARTTSSQTPITTAPDAAAVATGHRLR  562

Query  375  CQFNATENDSSRTniinnyaaqyaASGNQVTMINGNTAAVPPPVSLSFAAAAAPVVDCGG  196
               NA END S   + ++Y+   AAS +  +   G +AA     +           D  G
Sbjct  563  SDINAYENDPSSPLLPSSYSNAAAASADLGSRYGGGSAAFSAVATCQQGVGGFVDADMAG  622

Query  195  ----GFGTPATGDVSLTLGLRHPEN------SVTITNFGAY  103
                 FGT  TGDVSLTLGLRH  N      S  + +FG +
Sbjct  623  VSVIRFGTNPTGDVSLTLGLRHAGNMPDKDPSFCVRDFGGF  663



>ref|XP_006283201.1| hypothetical protein CARUB_v10004235mg [Capsella rubella]
 gb|EOA16099.1| hypothetical protein CARUB_v10004235mg [Capsella rubella]
Length=727

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 123/221 (56%), Gaps = 26/221 (12%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVEEMY+QE+
Sbjct  507  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQES  566

Query  507  ke-------------eENAQTPMPRDDDDDN---SKEItattsttptttttlpsaaaTKR  376
            KE               N ++  P D+++ N   ++  ++ T  T        +     R
Sbjct  567  KERERERERDQETKNSNNDKSTKPNDNNESNFTAARTTSSQTPITTAPDAAAVATGHRLR  626

Query  375  CQFNATENDSSRTniinnyaaqyaASGNQVTMINGNTAAVPPPVSLSFAAAAAPVVDCGG  196
               NA END S   + ++Y+   AAS +  +   G +AA     +           D  G
Sbjct  627  SDINAYENDPSSPLLPSSYSNAAAASADLGSRYGGGSAAFSAVATCQQGVGGFVDADMAG  686

Query  195  ----GFGTPATGDVSLTLGLRHPEN------SVTITNFGAY  103
                 FGT  TGDVSLTLGLRH  N      S  + +FG +
Sbjct  687  VSVIRFGTNPTGDVSLTLGLRHAGNMPDKDPSFCVRDFGGF  727



>ref|XP_004238216.1| PREDICTED: BEL1-like homeodomain protein 4 [Solanum lycopersicum]
Length=692

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 120/213 (56%), Gaps = 22/213 (10%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VNVLR+WLFEHFL+PYPSEADK LLSRQTGLSKNQVSNWFINARVRLWKPMVEEMY+QET
Sbjct  484  VNVLRAWLFEHFLHPYPSEADKHLLSRQTGLSKNQVSNWFINARVRLWKPMVEEMYQQET  543

Query  507  keeENAQTPMPRDDDDDNSKEI-----tattsttptttttlpsaaaTKRCQFNATENDSS  343
            KE E  Q    ++      +        AT+    TT TT  S +++ R + NA E D S
Sbjct  544  KEAETDQEEEEQEQQQQEKQAQIPMHNMATSPAAATTKTTTMSLSSSVRSKLNANERDPS  603

Query  342  RTniinnyaaqyaASGNQVTMINGNTAAVPPPVSLSFAAA-------AAPVVDCGGGFGT  184
               I     A     GNQ+ M+  +        +  +  A       A P       FG+
Sbjct  604  ENIINYRQYAL----GNQLVMLQSDDTTTASTSTHHYFTAVNAVDLVADPNAVNTAAFGS  659

Query  183  PATGDVSLTLGLRHPEN------SVTITNFGAY  103
               GDVSLTLGLRH EN         + +FGAY
Sbjct  660  QQAGDVSLTLGLRHSENVPRKPAQFQLRDFGAY  692



>emb|CDX69252.1| BnaC01g02010D [Brassica napus]
Length=667

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 91/250 (36%), Positives = 112/250 (45%), Gaps = 88/250 (35%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVEEMY+   
Sbjct  451  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQ---  507

Query  507  keeENAQTPMPRDDDDDNSKEItattsttptttttlpsaaaTKRCQFNATENDSSRTnii  328
                  Q    R++++   +E                          N + ND S  +  
Sbjct  508  ------QESKEREENEQEDQETK------------------------NNSSNDKSTKSNN  537

Query  327  nnyaaqyaASGNQVTMINGNTAAVPP------------------PVSLSFAAAAAPVVDC  202
            N        + +Q       +AA PP                  P S S + AAA VV  
Sbjct  538  NESNFTAVRTTSQTPTTAAQSAATPPDAGHRLRSAADINAYENDPSSFSHSNAAAAVVSS  597

Query  201  GGG------------------------------FGTP-ATGDVSLTLGLRHPEN------  133
             GG                              FGT   TGDVSLTLGLRH  N      
Sbjct  598  YGGSTAFSAIATCQQGVGGFDDADMDGDNNVIRFGTTNPTGDVSLTLGLRHAGNIPDKNA  657

Query  132  SVTITNFGAY  103
            S  + +FG +
Sbjct  658  SFCVRDFGGF  667



>ref|XP_010029855.1| PREDICTED: BEL1-like homeodomain protein 4 [Eucalyptus grandis]
 ref|XP_010029856.1| PREDICTED: BEL1-like homeodomain protein 4 [Eucalyptus grandis]
 ref|XP_010029858.1| PREDICTED: BEL1-like homeodomain protein 4 [Eucalyptus grandis]
 ref|XP_010029859.1| PREDICTED: BEL1-like homeodomain protein 4 [Eucalyptus grandis]
 ref|XP_010029860.1| PREDICTED: BEL1-like homeodomain protein 4 [Eucalyptus grandis]
 ref|XP_010029861.1| PREDICTED: BEL1-like homeodomain protein 4 [Eucalyptus grandis]
 gb|KCW56821.1| hypothetical protein EUGRSUZ_I02488 [Eucalyptus grandis]
Length=815

 Score =   119 bits (299),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 93/238 (39%), Positives = 121/238 (51%), Gaps = 56/238 (24%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVEEMY+   
Sbjct  589  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQ---  645

Query  507  keeENAQTPMPRDDDDDNSKEItattsttptttttlpsaaa-------------------  385
                  Q     D+DDD+  E + ++    +T+    +                      
Sbjct  646  ------QESKEGDEDDDHQAERSESSRNNLSTSGHAQTPTPSSFTPPPINNNTNSNNAST  699

Query  384  -TKRCQFNATENDSSRTniinnyaaqyaASGNQVTMINGNTAAVPPPV------------  244
             T+R + NA E+D S T  IN +      +    T++   TA +   V            
Sbjct  700  PTRRSEINAPESDPSLTPAINRHPFSETQA---TTLLQATTAMISSAVQVAGPAHIDDPC  756

Query  243  --SLSFAAAAAPVVDCGGG---FGT--PATGDVSLTLGLRHPEN-----SVTITNFGA  106
              S+  +       D G     FGT   ATGDVSLTLGLRH  N     S ++T+ G 
Sbjct  757  RRSIGGSTGLGGATDIGSALIRFGTAAAATGDVSLTLGLRHAGNVPEKSSFSVTDLGG  814



>ref|XP_011099269.1| PREDICTED: BEL1-like homeodomain protein 4 [Sesamum indicum]
Length=765

 Score =   119 bits (297),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 126/212 (59%), Gaps = 24/212 (11%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVEEMY+QE 
Sbjct  559  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQEA  618

Query  507  keeENAQTPMPRDDDDDNSKEItatt-----sttptttttlpsaaaTKRCQFNATENDSS  343
            K+E  A T   RD    +++  T        +TT  T+ T  + +  KR + NA END S
Sbjct  619  KDEA-ASTEQDRDQSSTSAQTPTLNANPPATTTTTATSATAITPSPAKRSEINAPENDPS  677

Query  342  RTniinnyaaqyaASGNQVTMINGNTAAVPPPVSLSFAAAAAPVVDCGGG--------FG  187
                          S NQ  + + +TA V  P + + A + + V     G        FG
Sbjct  678  ----FVAINNNQCFSDNQPKLHHHSTANVSLPPAPAVAQSFSVVHPSNDGIHESTLIRFG  733

Query  186  TPATGDVSLTLGLRH----PENS-VTITNFGA  106
            T A GDVSLTLGLRH    PE S  ++ +FG 
Sbjct  734  TNA-GDVSLTLGLRHAGNLPEKSPFSVRDFGG  764



>emb|CBI19630.3| unnamed protein product [Vitis vinifera]
Length=349

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 94/220 (43%), Positives = 119/220 (54%), Gaps = 33/220 (15%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK LLSRQTGLS+NQVSNWFINARVRLWKPMVEEMY+Q+ 
Sbjct  136  VNILRAWLFEHFLHPYPSDADKHLLSRQTGLSRNQVSNWFINARVRLWKPMVEEMYQQDA  195

Query  507  keeENAQTPMPRDDDDDNSKEItattsttptttttlpsaaaTKRCQFNATENDSS-----  343
            KEEE A +   R+ +  N ++     ++    T    +  A++R Q NA END S     
Sbjct  196  KEEEAAASSEDREANPQNHQK-----NSISAQTPRSSTPPASQRSQINAQENDPSLDTIN  250

Query  342  ----------------RTniinnyaaqyaASGNQVTMINGNTAAVPPPVSLSFAAAAAPV  211
                             T       +Q   + ++  M     AA       S        
Sbjct  251  YRNCFSGTQAITQATTTTTTTTTTISQRFPTTHEAGMHQRTVAADDTWCRGSVFGGEYGT  310

Query  210  VDCGGGFGTPATGDVSLTLGLRHPEN-----SVTITNFGA  106
             D     GTPA GDVSLTLGLRH  N      +++ +FGA
Sbjct  311  TD-AASLGTPA-GDVSLTLGLRHAGNLPDKGRLSLRDFGA  348



>ref|XP_003611874.1| BEL1-like homeodomain protein [Medicago truncatula]
 gb|AES94832.1| BEL1-related homeotic protein [Medicago truncatula]
Length=751

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 111/211 (53%), Gaps = 31/211 (15%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VNVLR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVEEMY+QE 
Sbjct  536  VNVLRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQEL  595

Query  507  keeENAQTPMPRDDDDDNSKEItattsttptttttlpsaaa----TKRCQFNATENDSSR  340
                  +  +  +D + N      +   T T  T+  +A       KR   NA END S 
Sbjct  596  N-----EAEVEAEDREMNQSNSNNSGHQTQTPPTSTATATEPPPPQKRSDINAAENDPSL  650

Query  339  TniinnyaaqyaASGNQVTMINGNTAAV---------PPPVSLS------FAAAAAPVVD  205
              I          +    T IN   + V         PP  S++      + +  A   +
Sbjct  651  VAINRQQDFSENQAMQSTTTINTTVSEVVVPPFDSDLPPHRSMAMDDTCRYGSLVAEDYE  710

Query  204  CGGGFGT-------PATGDVSLTLGLRHPEN  133
             G   G+         TGDVSLTLGLRH  N
Sbjct  711  TGSDIGSSTLIRFGSTTGDVSLTLGLRHAGN  741



>emb|CDY46061.1| BnaA09g41850D [Brassica napus]
Length=608

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 92/216 (43%), Positives = 113/216 (52%), Gaps = 40/216 (19%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeq--  514
            VN+LR+WLFEHFLNPYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVEEMY+Q  
Sbjct  412  VNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQEA  471

Query  513  ----etkeeENAQTPMPRDDDDDNSKEItattsttptttttlpsaaaTKRCQFNATENDS  346
                E + EEN +    + ++  N+ +     S      T       T        ENDS
Sbjct  472  KEREEKELEENQKEDYHQTNNSSNNSDTKPNESNFTLVQTITAQTPTTTMMTPTPHENDS  531

Query  345  SRTniinnyaaqyaASGNQVTMINGNTAAVPPPVSLSFAAAAA--------PVVDCGGGF  190
            S                    + +    A P  VS +F AA           V D    F
Sbjct  532  S-------------------FLPSSVVTAAPHSVSDAFTAATCQQDVSDHFQVNDGVIRF  572

Query  189  GTPATGDVSLTLGLRH----PEN---SVTITNFGAY  103
            GT   GDVSLTLGLRH    P+N   S ++ +FG +
Sbjct  573  GTKQAGDVSLTLGLRHTGNMPDNKNPSFSVRDFGDF  608



>gb|KJB48477.1| hypothetical protein B456_008G070800 [Gossypium raimondii]
Length=793

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 95/245 (39%), Positives = 120/245 (49%), Gaps = 66/245 (27%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN LR+WLFEHFL+PYPS+ADK+LL+RQTGLSKNQVSNWFINARVRLWKPMVE+MY    
Sbjct  551  VNTLRAWLFEHFLHPYPSDADKLLLARQTGLSKNQVSNWFINARVRLWKPMVEDMY----  606

Query  507  keeENAQTPMPRDDDDDNSKEItattsttptttttlpsaaa------------TKRCQFN  364
                  Q  +  +D+D+N    + +   +  +TT   +A+              KR + N
Sbjct  607  ------QQEIKEEDEDNNEGHNSNSAQKSTPSTTAGAAASTPSEPPPTTAAAGGKRSEIN  660

Query  363  ATENDSSRTniin---nyaaqyaASGNQVTMINGNTAAVPPPVSLSFAAAAAPV------  211
            A END S   I     +       + +  +  N    A  PP   +F A A  V      
Sbjct  661  AMENDPSLIAINRQDFSENQAKQCTHHDTSATNTTIIATGPPPPTTFKATATEVAPPFSY  720

Query  210  -VD----CGGG-------------------------FGTPATGDVSLTLGLRH----PEN  133
             VD    C  G                         FGT  TGDVSLTLGLRH    PEN
Sbjct  721  GVDGTTTCRRGSIVSADYGTTTRPGNDSDIGSTLIRFGT-TTGDVSLTLGLRHAGNMPEN  779

Query  132  SVTIT  118
            + + +
Sbjct  780  TSSFS  784



>gb|KHG14356.1| BEL1-like homeodomain protein 2 [Gossypium arboreum]
Length=785

 Score =   116 bits (291),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 120/245 (49%), Gaps = 66/245 (27%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK+LL+RQTGLSKNQVSNWFINARVRLWKPMVE+MY    
Sbjct  543  VNILRAWLFEHFLHPYPSDADKLLLARQTGLSKNQVSNWFINARVRLWKPMVEDMY----  598

Query  507  keeENAQTPMPRDDDDDNSKEItattsttptttttlpsaaa------------TKRCQFN  364
                  Q  +  +D+D+N      +   +  +TT   +A+              KR + N
Sbjct  599  ------QQEIKEEDEDNNEGHNGNSAQKSTPSTTAGAAASTPSEPPPTTAAAGGKRSEIN  652

Query  363  ATENDSSRTniin---nyaaqyaASGNQVTMINGNTAAVPPPVSLSFAAAAAPV------  211
            A +ND S   I     +       + +  +  N    A  PP   +F A A  V      
Sbjct  653  AMKNDPSLIAINRQGFSENQAKQCTNHDTSATNTTIIATGPPPPTTFKATATEVAPPFSY  712

Query  210  -VD----CGGG-------------------------FGTPATGDVSLTLGLRH----PEN  133
             VD    C  G                         FGT  TGDVSLTLGLRH    PEN
Sbjct  713  GVDGTTTCRRGSIVSADYGTTTRPGNDSDIGSTLIRFGT-TTGDVSLTLGLRHAGNMPEN  771

Query  132  SVTIT  118
            + + +
Sbjct  772  TSSFS  776



>ref|XP_006344823.1| PREDICTED: BEL1-related homeotic protein 22 [Solanum tuberosum]
Length=672

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 115/211 (55%), Gaps = 29/211 (14%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQV+NWFINARVRLWKPMVEEMY    
Sbjct  470  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVANWFINARVRLWKPMVEEMY----  525

Query  507  keeENAQTPMPRDDDDD--------NSKE------ItattsttptttttlpsaaaTKRCQ  370
                  Q  +  DDDDD        N++       IT  ++ T T +    + A+ K+ Q
Sbjct  526  ------QREVNEDDDDDMLENQNRTNTQTPTPNIIITTNSNITETKSAATATIASDKKPQ  579

Query  369  FNATENDSSRTniinnyaaqyaASGNQVTMINGNTAAV-----PPPVSLSFAAAAAPVVD  205
             N +END S   +  +Y++         + I   +  +           +  A+ + +  
Sbjct  580  INVSENDPSIVAMNTHYSSSMPTQLTNFSTIQDESDHILYRRSGAEYGTTNMASNSEIGS  639

Query  204  CGGGFGTPATGDVSLTLGLRHPENSVTITNF  112
                FGT    DVSLTLGLRH  N    T+F
Sbjct  640  NMITFGTTTASDVSLTLGLRHAGNLPENTHF  670



>gb|EPS62050.1| hypothetical protein M569_12744, partial [Genlisea aurea]
Length=194

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LRSWLFEHFL+PYPSEADK LLSRQTGLSKNQVSNWFINARVRLWKPMV
Sbjct  133  VNLLRSWLFEHFLHPYPSEADKHLLSRQTGLSKNQVSNWFINARVRLWKPMV  184



>ref|XP_009140492.1| PREDICTED: BEL1-like homeodomain protein 4 [Brassica rapa]
Length=645

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 117/219 (53%), Gaps = 43/219 (20%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFLNPYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVEEMY+QE 
Sbjct  446  VNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQEA  505

Query  507  keeENAQTPMPRDDDDDNSKEItattsttptttttlpsaaaTKRCQFNATENDSSRTnii  328
            KE E  +    + +D  + +    T +                    +   N+S+ T + 
Sbjct  506  KEREEEELGENKKEDYQHQRRHQQTNNK-------------------DTKPNESNFTLVQ  546

Query  327  nnyaaqyaASGNQVTMINGNTAAVPPPVSLSFA-----AAAAPVVDCGGG----------  193
               A     +    T    + +++PP  S++ A     + A  V  C             
Sbjct  547  TITAQTPTTTMMTSTPHENDRSSLPPSTSVANAPSLGVSGAFTVSTCQQDVSDFHVEDGV  606

Query  192  --FGTPATGDVSLTLGLRH----PEN---SVTITNFGAY  103
              FGT   GDVSLTLGLRH    P+N   S ++ +FG +
Sbjct  607  IRFGTKQAGDVSLTLGLRHTGNMPDNKNPSFSVRDFGDF  645



>ref|XP_009376500.1| PREDICTED: BEL1-like homeodomain protein 2 [Pyrus x bretschneideri]
Length=767

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 98/224 (44%), Positives = 119/224 (53%), Gaps = 49/224 (22%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVEEMY+QE 
Sbjct  527  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQEA  586

Query  507  keeENAQTP-----------MPRDDDDDNSKEItattsttptttttlpsaaaTKRCQFNA  361
             EEE                  R+  ++N+     T + T TTTTT  ++ A+KR   NA
Sbjct  587  NEEEEEIGGGGGGAASATADQEREQRNNNAGLAAQTPTPTTTTTTTTTNSPASKRSDINA  646

Query  360  TENDSSRTniinnyaaqyaASGNQVTMINGNTAAVPPPVSLSFAAAAAPVVDCGGGFG--  187
            +END S   I  +   Q     +   M    + AV PP    F  AA+   D G  +G  
Sbjct  647  SENDPSLAAINRHQQQQ-----HHPMMATTTSTAVAPPAYQCFPPAASD--DTGRSYGTT  699

Query  186  -----------------------------TPATGDVSLTLGLRH  142
                                         T A GDVSLTLGLRH
Sbjct  700  SANANIAAHHDHQNSSNIDSSTTLISFGTTTAAGDVSLTLGLRH  743



>ref|XP_002281889.1| PREDICTED: BEL1-like homeodomain protein 4 [Vitis vinifera]
Length=676

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 94/220 (43%), Positives = 119/220 (54%), Gaps = 33/220 (15%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK LLSRQTGLS+NQVSNWFINARVRLWKPMVEEMY+Q+ 
Sbjct  463  VNILRAWLFEHFLHPYPSDADKHLLSRQTGLSRNQVSNWFINARVRLWKPMVEEMYQQDA  522

Query  507  keeENAQTPMPRDDDDDNSKEItattsttptttttlpsaaaTKRCQFNATENDSS-----  343
            KEEE A +   R+ +  N ++     ++    T    +  A++R Q NA END S     
Sbjct  523  KEEEAAASSEDREANPQNHQK-----NSISAQTPRSSTPPASQRSQINAQENDPSLDTIN  577

Query  342  ----------------RTniinnyaaqyaASGNQVTMINGNTAAVPPPVSLSFAAAAAPV  211
                             T       +Q   + ++  M     AA       S        
Sbjct  578  YRNCFSGTQAITQATTTTTTTTTTISQRFPTTHEAGMHQRTVAADDTWCRGSVFGGEYGT  637

Query  210  VDCGGGFGTPATGDVSLTLGLRHPEN-----SVTITNFGA  106
             D     GTPA GDVSLTLGLRH  N      +++ +FGA
Sbjct  638  TDA-ASLGTPA-GDVSLTLGLRHAGNLPDKGRLSLRDFGA  675



>emb|CDY39669.1| BnaA04g13860D [Brassica napus]
Length=645

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 88/223 (39%), Positives = 116/223 (52%), Gaps = 51/223 (23%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFLNPYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVEEMY+QE 
Sbjct  446  VNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQEA  505

Query  507  keeENAQTPMPRDDDDDNSKEItattsttptttttlpsaaaTKRCQFNATENDSSRTnii  328
            KE E  +    + +D  + +    T +                    +   N+S+ T + 
Sbjct  506  KEREEEELGENKKEDYQHQRRHQQTNNK-------------------DTKPNESNFTLVQ  546

Query  327  nnyaaqyaASGNQVTMINGNTAAVPPPVSLSFAAAAAPVVDCGGGF--------------  190
               A     +    T    + +++PP  S+    A AP +   G F              
Sbjct  547  TITAQTPTTTMMTSTPHENDPSSLPPSTSV----ANAPSLGVSGAFTVSTCQQDVSDFHV  602

Query  189  -------GTPATGDVSLTLGLRH----PEN---SVTITNFGAY  103
                   GT   GDVSLTLGLRH    P+N   S ++ +FG +
Sbjct  603  EDGVIRFGTKQAGDVSLTLGLRHTGNMPDNKNPSFSVRDFGDF  645



>ref|XP_004509227.1| PREDICTED: BEL1-like homeodomain protein 2-like [Cicer arietinum]
Length=772

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 116/221 (52%), Gaps = 39/221 (18%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVE+MY++E 
Sbjct  540  VNILRAWLFEHFLHPYPSDADKQLLARQTGLSRNQVSNWFINARVRLWKPMVEDMYQEEL  599

Query  507  keeENAQT-------PMPRDDDDDNSKEItattsttptttttlpsaaaTKRCQFNATEND  349
            KE E + T          ++ +  N+       +TT   T T  S   +KR   NA END
Sbjct  600  KEAEGSDTEEDNNNNNKEKNQNSSNNTSGHNNIATTIAQTPTPSSTTTSKRSNINANEND  659

Query  348  SSRTniinnyaaqyaASGNQVTMINGNTAAVPPPVS------------------------  241
             S T  IN        +    T      + V PP+S                        
Sbjct  660  VSLTTAINRQGFSENQAITSATKT--TVSEVAPPISDTDLSPQNNNRSMVVDDTCRHGSF  717

Query  240  --LSFAAAAAPVVDCGGG---FGTPATGDVSLTLGLRHPEN  133
                +  A+A   D G     FGT  +GDVSLTLGLRH  N
Sbjct  718  VTAEYGTASAATSDIGSTLIRFGT-TSGDVSLTLGLRHAGN  757



>ref|XP_009396457.1| PREDICTED: BEL1-like homeodomain protein 4 [Musa acuminata subsp. 
malaccensis]
Length=703

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 103/193 (53%), Gaps = 17/193 (9%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVEEMY QE+
Sbjct  510  VNILRGWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYTQES  569

Query  507  keeENAQTPMPRDDDDDNSKEItattsttptttttlpsaaaTKRCQFNATENDSSRTnii  328
                        +D ++   E +   + +P               +  A+ + SS T   
Sbjct  570  ------------EDKEERESETSQQRTQSPMQQQQGLRPETNAASESEASPSTSSITQRN  617

Query  327  nnyaaqyaASGNQVTMINGNTAAVPPPVSLS-----FAAAAAPVVDCGGGFGTPATGDVS  163
            +   +        ++  + +T AV   V +      +  AA   +    G    A GDVS
Sbjct  618  HRLVSSDDNPPPGLSATHQSTGAVDDSVLIGDMYHHYGVAATSALGPAAGMRFGAAGDVS  677

Query  162  LTLGLRHPENSVT  124
            LTLGLRH   S +
Sbjct  678  LTLGLRHAGGSTS  690



>emb|CDY62523.1| BnaC04g56300D [Brassica napus]
Length=648

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 88/224 (39%), Positives = 115/224 (51%), Gaps = 52/224 (23%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFLNPYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVEEMY+QE 
Sbjct  448  VNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQEA  507

Query  507  keeENAQTPMPRDDDDDNSKEItattsttptttttlpsaaaTKRCQFNATENDSSRTnii  328
            KE E  +    + +D  + +    T +                    +   N+S+ T + 
Sbjct  508  KEREEEELGENKKEDYQHQRRHQQTNNK-------------------DTKPNESNFTLVQ  548

Query  327  nnyaaqyaASGNQVTMINGNTAAVPPPVSLSFAAAAAPVVDCGGGF--------------  190
               A     +    T    + + +PP  S+    A AP +   G F              
Sbjct  549  TITAQTPTTTMMTSTPHENDPSFLPPSTSV----ATAPSLGVSGAFTVSTCQQDVSDFHV  604

Query  189  -------GTPATGDVSLTLGLRH----PEN----SVTITNFGAY  103
                   GT   GDVSLTLGLRH    P+N    S ++ +FG +
Sbjct  605  EDGVIRFGTKQAGDVSLTLGLRHTGNMPDNNKNPSFSVRDFGDF  648



>ref|XP_002310774.2| hypothetical protein POPTR_0007s12170g [Populus trichocarpa]
 ref|XP_006380743.1| hypothetical protein POPTR_0007s12170g [Populus trichocarpa]
 gb|EEE91224.2| hypothetical protein POPTR_0007s12170g [Populus trichocarpa]
 gb|ERP58540.1| hypothetical protein POPTR_0007s12170g [Populus trichocarpa]
Length=824

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 98/241 (41%), Positives = 124/241 (51%), Gaps = 47/241 (20%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVE+MY+QE+
Sbjct  583  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEDMYQQES  642

Query  507  keeENAQTPMPRDDDDDNS--------KEItattsttptttttlpsaaaTKRCQFNATEN  352
            KE+E       R   ++NS           T TT+ +     T  +  + KR + NA EN
Sbjct  643  KEDEPGAEDRERKQANNNSNNSGLAQTPTPTTTTTGSSAPAATTTTIPSGKRSEINANEN  702

Query  351  DSS------------RTniinnyaaqyaASGNQVTMINGNTAAVPPPVSLSFAAAAAPVV  208
            D S            +T +  + +         + + +   AA PP     F   A    
Sbjct  703  DPSLLAINRQCFSENQTKLSTSSSTTTTTIITPINITSATEAAPPPHAGQPFHDFADDTC  762

Query  207  DCG----------------GG-----FGTPATGDVSLTLGLRH----PENSVTIT--NFG  109
              G                GG     FGT   GDVSLTLGLRH    PE S T +  +FG
Sbjct  763  RHGSIVTADYGTTSSNANAGGSTLIRFGTTTAGDVSLTLGLRHAGNMPEKSPTFSMRDFG  822

Query  108  A  106
             
Sbjct  823  G  823



>ref|XP_009379163.1| PREDICTED: BEL1-like homeodomain protein 2 [Pyrus x bretschneideri]
 ref|XP_009379164.1| PREDICTED: BEL1-like homeodomain protein 2 [Pyrus x bretschneideri]
Length=809

 Score =   113 bits (283),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 120/223 (54%), Gaps = 48/223 (22%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVEEMY+QE 
Sbjct  570  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQEA  629

Query  507  keeENAQ-------TPMPRDDD---DDNSKEItattsttptttttlpsaaaTKRCQFNAT  358
             EEE          T    D +   ++N+     T + T TTTTT  ++ A+KR   NA+
Sbjct  630  NEEEEVGQGGVGGATSAAADQERERNNNAGLAAQTPTPTTTTTTTTTNSPASKRSDINAS  689

Query  357  ENDSSRTniinnyaaqyaASGNQVTMINGNTAAVPPPVSLSFAAAAAPVVDCGGGFG---  187
            END S   I  +   Q     +   M    + AV PP    F  AA+   D G  +G   
Sbjct  690  ENDPSLAAINRHQQQQ-----HHPMMATTTSTAVAPPAYQCFPPAASD--DTGRSYGTTS  742

Query  186  ----------------------------TPATGDVSLTLGLRH  142
                                        T A GDVSLTLGLRH
Sbjct  743  ANANIAAHHDHQNSSNIDSSTTLISFGTTTAAGDVSLTLGLRH  785



>ref|XP_006425771.1| hypothetical protein CICLE_v10024897mg [Citrus clementina]
 ref|XP_006466698.1| PREDICTED: BEL1-like homeodomain protein 2-like [Citrus sinensis]
 gb|ESR39011.1| hypothetical protein CICLE_v10024897mg [Citrus clementina]
Length=831

 Score =   113 bits (282),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 100/239 (42%), Positives = 126/239 (53%), Gaps = 47/239 (20%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVEEMY+QE 
Sbjct  592  VNILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQEA  651

Query  507  keeENAQTPMPRDDDDDNSKEItattsttptttttlpsaa-----aTKRCQFNATENDSS  343
            KE E +Q       + +N+  I  T + + TTT    +++       KR + N  E+  S
Sbjct  652  KEAEESQEREINQSNGNNNNGIAQTPTPSTTTTAAAAASSTTITPTGKRSEINEPESSPS  711

Query  342  ------RTniinnyaaqyaASGNQVTMINGNTAAVPPPVSLSF-----------------  232
                  +     +     A+S N +T  N     V PP+S SF                 
Sbjct  712  LIAINRQCFSETHAKQSGASSTNIITPNNSTDHEVAPPISPSFPVTHIVDDTCRRGSVMA  771

Query  231  ---------AAAAAPVVDCGG---GFGTPATGDVSLTLGLRHPEN------SVTITNFG  109
                       AAA  +  G     FGT A GDVSLTLGL H  N      S ++ +FG
Sbjct  772  TDHNYGTTAGIAAADHIAAGSTLISFGTTA-GDVSLTLGLHHAGNMPDHTSSFSVRDFG  829



>ref|XP_006425770.1| hypothetical protein CICLE_v10024897mg [Citrus clementina]
 gb|ESR39010.1| hypothetical protein CICLE_v10024897mg [Citrus clementina]
Length=822

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 100/239 (42%), Positives = 126/239 (53%), Gaps = 47/239 (20%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVEEMY+QE 
Sbjct  583  VNILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQEA  642

Query  507  keeENAQTPMPRDDDDDNSKEItattsttptttttlpsaa-----aTKRCQFNATENDSS  343
            KE E +Q       + +N+  I  T + + TTT    +++       KR + N  E+  S
Sbjct  643  KEAEESQEREINQSNGNNNNGIAQTPTPSTTTTAAAAASSTTITPTGKRSEINEPESSPS  702

Query  342  ------RTniinnyaaqyaASGNQVTMINGNTAAVPPPVSLSF-----------------  232
                  +     +     A+S N +T  N     V PP+S SF                 
Sbjct  703  LIAINRQCFSETHAKQSGASSTNIITPNNSTDHEVAPPISPSFPVTHIVDDTCRRGSVMA  762

Query  231  ---------AAAAAPVVDCGG---GFGTPATGDVSLTLGLRHPEN------SVTITNFG  109
                       AAA  +  G     FGT A GDVSLTLGL H  N      S ++ +FG
Sbjct  763  TDHNYGTTAGIAAADHIAAGSTLISFGTTA-GDVSLTLGLHHAGNMPDHTSSFSVRDFG  820



>ref|XP_004233410.1| PREDICTED: BEL1-like homeodomain protein 2 [Solanum lycopersicum]
 ref|XP_010317146.1| PREDICTED: BEL1-like homeodomain protein 2 [Solanum lycopersicum]
Length=633

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 102/188 (54%), Gaps = 30/188 (16%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLSKNQV+NWFINARVRLWKPMVEEMY++E 
Sbjct  467  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSKNQVANWFINARVRLWKPMVEEMYQREA  526

Query  507  keeENAQTPMPRDDDDDNSKEItattsttptttttlpsaaaTKRCQFNATENDSSRTnii  328
                        +DDD NS+     T    TT + +    +       ATEND S     
Sbjct  527  -----------NEDDDMNSRNTQRPTPDITTTNSKITETKSAA-----ATENDPS-----  565

Query  327  nnyaaqyaASGNQVTMINGNTAAVPPPVSLSFAAAAAPVVDCGGG---FGTPATGDVSLT  157
                     S +  T +N N+  +      S  A      D G     FGT    DVSLT
Sbjct  566  ----MNTHYSSSMQTQLN-NSPTIQHESHRS-GAEYDGTTDIGSKIMTFGTTTPADVSLT  619

Query  156  LGLRHPEN  133
            LGL H  N
Sbjct  620  LGLHHAGN  627



>ref|XP_009605852.1| PREDICTED: BEL1-like homeodomain protein 4 isoform X1 [Nicotiana 
tomentosiformis]
Length=747

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 121/222 (55%), Gaps = 36/222 (16%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            V +LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVE+MY++E 
Sbjct  522  VTILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEDMYQKEA  581

Query  507  keeEN-------------AQTPMPRDDDDDNSKEItattsttptttttlpsaaaTKRCQF  367
            KEEE+             AQTP P    +  +      T T  T   T+ + A+ KR + 
Sbjct  582  KEEEDDEMEKSQNSSNNIAQTPTPNSSTNTITTGTGTETKTAATVAATILTVASDKRSEI  641

Query  366  NATENDSSRTniinnyaaqyaASGNQVT------MINGNTAAVPPPVSLSFAAAAAPV--  211
            N  END S   +     ++  A  ++ +      M + N  A+     +S   A + V  
Sbjct  642  NVLENDPSIVAMNRLCFSENQAQHHESSSMATHEMAHNNFPAIQDSDDMSRREAVSGVEY  701

Query  210  ------VDCGGG-----FGTPATGDVSLTLGLRH----PENS  130
                   +   G     FGT   GDVSLTLGL H    PENS
Sbjct  702  GTTNIMANSDNGTRVIRFGTSVAGDVSLTLGLHHAGNLPENS  743



>ref|XP_008808897.1| PREDICTED: BEL1-like homeodomain protein 4 [Phoenix dactylifera]
Length=566

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 99/198 (50%), Gaps = 41/198 (21%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ DK  L+RQ GLS+NQVSNWFINARVRLWKPMVEEMY    
Sbjct  388  VNILRAWLFEHFLHPYPSDVDKQQLARQAGLSRNQVSNWFINARVRLWKPMVEEMY----  443

Query  507  keeENAQTPMPRDDDDDNSKEItattsttptttttlpsaaaTKRCQFNATENDSSRTnii  328
                  Q  +  D++D N +E                   A  R   + + N+S +    
Sbjct  444  ------QQEVKEDEEDVNERE------------------EANHRRPLSPSHNNSPQGQGP  479

Query  327  nnyaaqyaASGNQVTMINGNT--AAVPPPVS-----------LSFAAAAAPVVDCGGGFG  187
               A +   +G  V   N +T    +  P S           +     AA     G G  
Sbjct  480  EANATEGPGAGAGVHQSNDDTILMGIDAPTSAMDVCGTDMEPMDDLCGAAANAALGSGMR  539

Query  186  TPATGDVSLTLGLRHPEN  133
              ATGDVSLTLGLRH  N
Sbjct  540  LGATGDVSLTLGLRHAGN  557



>ref|XP_009605853.1| PREDICTED: BEL1-like homeodomain protein 4 isoform X2 [Nicotiana 
tomentosiformis]
Length=724

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 121/222 (55%), Gaps = 36/222 (16%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            V +LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVE+MY++E 
Sbjct  499  VTILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEDMYQKEA  558

Query  507  keeEN-------------AQTPMPRDDDDDNSKEItattsttptttttlpsaaaTKRCQF  367
            KEEE+             AQTP P    +  +      T T  T   T+ + A+ KR + 
Sbjct  559  KEEEDDEMEKSQNSSNNIAQTPTPNSSTNTITTGTGTETKTAATVAATILTVASDKRSEI  618

Query  366  NATENDSSRTniinnyaaqyaASGNQVT------MINGNTAAVPPPVSLSFAAAAAPV--  211
            N  END S   +     ++  A  ++ +      M + N  A+     +S   A + V  
Sbjct  619  NVLENDPSIVAMNRLCFSENQAQHHESSSMATHEMAHNNFPAIQDSDDMSRREAVSGVEY  678

Query  210  ------VDCGGG-----FGTPATGDVSLTLGLRH----PENS  130
                   +   G     FGT   GDVSLTLGL H    PENS
Sbjct  679  GTTNIMANSDNGTRVIRFGTSVAGDVSLTLGLHHAGNLPENS  720



>ref|XP_011085539.1| PREDICTED: BEL1-like homeodomain protein 4 [Sesamum indicum]
 ref|XP_011085540.1| PREDICTED: BEL1-like homeodomain protein 4 [Sesamum indicum]
Length=738

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 111/215 (52%), Gaps = 30/215 (14%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFLNPYPS+ADK+LL+RQTGLS+NQVSNWFINARVRLWKPMV      E 
Sbjct  518  VNILRAWLFEHFLNPYPSDADKLLLARQTGLSRNQVSNWFINARVRLWKPMV------EE  571

Query  507  keeENAQTPMPRDDDDDNSKEItattsttptttttlpsaaaTK--------------RCQ  370
              ++ A+    + + D +S       +    T     +   T               R +
Sbjct  572  MYQQEAKEDTEQRERDQSSTSTGPAHNAQTPTPPHPSTTTTTTTTTGAAAFTPPPGGRSE  631

Query  369  FNATENDSSRTniinnyaaqyaASGNQVTMINGNTAAVPPPVSLSFAAAAAP----VVDC  202
             NA E+D S   I  +  ++  A    V   N +  A   P++ + +  A P     ++ 
Sbjct  632  INAHESDPSFVAINAHCFSENQAKLQHVAKNNDSLPAGATPLAAASSTTAQPASRAALNA  691

Query  201  G-----GGFGTPATGDVSLTLGLRHPENSVTITNF  112
            G       FGT A GDVSLTLGLRH  N     +F
Sbjct  692  GIESRVMRFGTGA-GDVSLTLGLRHAGNPTEKGSF  725



>dbj|BAD94844.1| putative homeodomain transcription factor [Arabidopsis thaliana]
Length=208

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFLNPYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  17   VNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  68



>gb|EYU45099.1| hypothetical protein MIMGU_mgv1a003541mg [Erythranthe guttata]
Length=579

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFLNPYPSEADK LLSRQTGLSKNQVSNWFINARVRLWKPMV
Sbjct  401  VNILRAWLFEHFLNPYPSEADKHLLSRQTGLSKNQVSNWFINARVRLWKPMV  452



>ref|XP_011074481.1| PREDICTED: BEL1-like homeodomain protein 4 [Sesamum indicum]
Length=625

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LRSWLFEHFL+PYPSEADK LLSRQTGLSKNQVSNWFINARVRLWKPMV
Sbjct  456  VNILRSWLFEHFLHPYPSEADKHLLSRQTGLSKNQVSNWFINARVRLWKPMV  507



>gb|ABF98710.1| homeodomain protein JUBEL1, putative, expressed [Oryza sativa 
Japonica Group]
Length=321

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPM+
Sbjct  104  VNILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMI  155



>ref|XP_004232087.1| PREDICTED: BEL1-like homeodomain protein 2 [Solanum lycopersicum]
Length=726

 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 123/228 (54%), Gaps = 48/228 (21%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVE+MY+QE 
Sbjct  509  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEDMYQQEA  568

Query  507  keeEN------------AQTPMPRDDDDDNSKEItattsttptttttlp-----------  397
            K+E+             AQTP P    + +S  IT  T+   TTT               
Sbjct  569  KDEDENSQSQNSGNNIIAQTPTPNSLTNSSSTNITTATAAATTTTAPTTTTALAAAETGT  628

Query  396  -----saaaTKRCQFNATENDSSRTniinnyaaqyaASGNQVTMINGNTAAVPPPVSL--  238
                 +  ++KR Q NAT++D S         A  + S NQ T     T  +  P +   
Sbjct  629  AATPITVTSSKRSQINATDSDPSLV-------AINSFSENQATF----TTNIHDPDACRR  677

Query  237  -SFAAAAAPVVDCGGG-----FGTPATGDVSLTLGLRHPENSVTITNF  112
             +F+           G     FGT A GDVSLTLGLRH  N    T+F
Sbjct  678  GNFSGDDGTTTHDHMGSTMIRFGTTA-GDVSLTLGLRHAGNLPENTHF  724



>ref|XP_004511995.1| PREDICTED: BEL1-like homeodomain protein 2-like [Cicer arietinum]
Length=723

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 89/222 (40%), Positives = 116/222 (52%), Gaps = 52/222 (23%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVEEMY+QE 
Sbjct  523  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQEL  582

Query  507  keeENAQTPMPRDDDDDNSKEItattsttptttttlpsaaaTKRCQFNATENDSSRTnii  328
             E E     + ++++++N+  +   T      TT              + END +     
Sbjct  583  NEAECGDKQISQENNNNNNNSVGDQTPPQQPPTTPTTKI---------SEENDQA-----  628

Query  327  nnyaaqyaASGNQVTMINGNTAAVPPPVSLSFAAAAAPVVD--CGGG-------------  193
                       N +T IN   + V PP     +   +  +D  C  G             
Sbjct  629  --------IQSNSITAINTTVSEVAPPFDSDMSPQRSMAMDDTCRYGSLVAEDYETASDI  680

Query  192  -------FGTPATGDVSLTLGLRH----PENSVT---ITNFG  109
                   FG+  +GDVSLTLGLRH    P+N  T   I +FG
Sbjct  681  GSSTLIRFGS-TSGDVSLTLGLRHAGNMPDNKTTTFSIRDFG  721



>ref|XP_009419344.1| PREDICTED: BEL1-like homeodomain protein 4 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009419353.1| PREDICTED: BEL1-like homeodomain protein 4 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009419362.1| PREDICTED: BEL1-like homeodomain protein 4 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009419368.1| PREDICTED: BEL1-like homeodomain protein 4 [Musa acuminata subsp. 
malaccensis]
Length=683

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 52/52 (100%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK+LLSRQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  520  VNILRAWLFEHFLHPYPSDADKLLLSRQTGLSRNQVSNWFINARVRLWKPMV  571



>gb|ACN29213.1| unknown [Zea mays]
 tpg|DAA51177.1| TPA: putative POX domain/homeobox DNA-binding domain family protein 
[Zea mays]
Length=302

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPM+
Sbjct  104  VNILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMI  155



>ref|XP_010936123.1| PREDICTED: BEL1-like homeodomain protein 4 isoform X2 [Elaeis 
guineensis]
Length=350

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  125  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  176



>ref|XP_010936122.1| PREDICTED: BEL1-like homeodomain protein 4 isoform X1 [Elaeis 
guineensis]
Length=355

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  130  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  181



>ref|XP_010429329.1| PREDICTED: BEL1-like homeodomain protein 4 isoform X2 [Camelina 
sativa]
Length=641

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFLNPYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  451  VNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  502



>ref|XP_010417119.1| PREDICTED: BEL1-like homeodomain protein 4 [Camelina sativa]
Length=645

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFLNPYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  452  VNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  503



>ref|NP_179956.1| BEL1-like homeodomain 4 [Arabidopsis thaliana]
 ref|NP_850044.1| BEL1-like homeodomain 4 [Arabidopsis thaliana]
 ref|NP_001031404.1| BEL1-like homeodomain 4 [Arabidopsis thaliana]
 sp|Q94KL5.2|BLH4_ARATH RecName: Full=BEL1-like homeodomain protein 4; Short=BEL1-like 
protein 4; AltName: Full=Protein SAWTOOTH 2 [Arabidopsis thaliana]
 gb|AAC17087.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AAL25593.1| At2g23760/F27L4.6 [Arabidopsis thaliana]
 gb|AAM98283.1| At2g23760/F27L4.6 [Arabidopsis thaliana]
 gb|AEC07486.1| BEL1-like homeodomain 4 [Arabidopsis thaliana]
 gb|AEC07487.1| BEL1-like homeodomain 4 [Arabidopsis thaliana]
 gb|AEC07488.1| BEL1-like homeodomain 4 [Arabidopsis thaliana]
Length=627

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFLNPYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  436  VNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  487



>gb|AAK43834.1|AF353092_1 BEL1-like homeobox 4 [Arabidopsis thaliana]
Length=627

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFLNPYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  436  VNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  487



>ref|XP_002880524.1| hypothetical protein ARALYDRAFT_900861 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56783.1| hypothetical protein ARALYDRAFT_900861 [Arabidopsis lyrata subsp. 
lyrata]
Length=614

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFLNPYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  424  VNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  475



>emb|CDP02423.1| unnamed protein product [Coffea canephora]
Length=378

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  131  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  182



>emb|CDX76849.1| BnaC08g34350D [Brassica napus]
Length=601

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFLNPYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  410  VNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  461



>ref|XP_009117270.1| PREDICTED: BEL1-like homeodomain protein 4 [Brassica rapa]
Length=608

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFLNPYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  412  VNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  463



>ref|XP_006293804.1| hypothetical protein CARUB_v10022787mg [Capsella rubella]
 ref|XP_006293805.1| hypothetical protein CARUB_v10022787mg [Capsella rubella]
 gb|EOA26702.1| hypothetical protein CARUB_v10022787mg [Capsella rubella]
 gb|EOA26703.1| hypothetical protein CARUB_v10022787mg [Capsella rubella]
Length=671

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFLNPYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  465  VNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  516



>ref|XP_011025689.1| PREDICTED: BEL1-like homeodomain protein 4 [Populus euphratica]
Length=828

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 98/250 (39%), Positives = 123/250 (49%), Gaps = 61/250 (24%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVE+MY+QE+
Sbjct  583  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEDMYQQES  642

Query  507  keeENAQTPMPRDDDDDNS--------KEItattsttptttttlpsaaaTKRCQFNATEN  352
            KEEE       R   ++NS           T TT+ +     T  +  + KR + NA EN
Sbjct  643  KEEEPGAEDRERKQANNNSNNSGLAQTPTPTTTTTGSSAPAATTTTIPSGKRSEINANEN  702

Query  351  DSSRTniinnyaaqyaASGNQVTMINGN----------------TAAVPPP---------  247
            D S          +   S NQ  +   +                T A PPP         
Sbjct  703  DPS-----LLAINRQCFSENQTKLSTSSSTTTTTIITPINITSATEAAPPPHAGQPFHDF  757

Query  246  ----------VSLSFAAAAAPVVDCGGGFG-------TPATGDVSLTLGLRH----PENS  130
                      V+  +   ++      G  G       T   GDVSLTLGLRH    PE S
Sbjct  758  ADDTCRHGSIVTADYGTTSSNANAGAGHIGSTLIRFGTTTAGDVSLTLGLRHAGNMPEKS  817

Query  129  VT--ITNFGA  106
             T  + +FG 
Sbjct  818  PTFSVRDFGG  827



>ref|XP_004981881.1| PREDICTED: BEL1-like homeodomain protein 2-like isoform X1 [Setaria 
italica]
Length=748

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPM+
Sbjct  546  VNILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMI  597



>ref|XP_010472371.1| PREDICTED: BEL1-like homeodomain protein 4 [Camelina sativa]
Length=642

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFLNPYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  452  VNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  503



>ref|XP_009629330.1| PREDICTED: BEL1-like homeodomain protein 4 [Nicotiana tomentosiformis]
Length=771

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 117/232 (50%), Gaps = 53/232 (23%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVEEMY+QE 
Sbjct  551  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQEA  610

Query  507  k----------------eeENAQTPMPRDDDDDNSKEItattsttptttttlpsaaaT--  382
            K                   NAQTP P   +  ++   T TT+          +AA T  
Sbjct  611  KEEEEEDDERENSQNQNSGNNAQTPTPNMSNSSSTNMTTTTTALGAAAAAETGTAATTAT  670

Query  381  ------KRCQFNATENDSSRTniinnyaaqyaASGNQVTMINGNTAAVPPPVSLSFAAAA  220
                  KR + NA END S   I            N     + N A  P  +  S AAA 
Sbjct  671  AASTLGKRSEINAPENDPSLVAI------------NSHISFSENQATFPTNIHDSDAAAC  718

Query  219  APVVDCGGG----------------FGTPATGDVSLTLGLRHPENSVTITNF  112
                +  G                 FGT A GDVSLTLGLRH  N    T+F
Sbjct  719  HRGGNFSGDDYGTTTNADVGSTMIRFGTTA-GDVSLTLGLRHAGNLPENTHF  769



>ref|XP_006404859.1| hypothetical protein EUTSA_v10000076mg [Eutrema salsugineum]
 dbj|BAJ33897.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46312.1| hypothetical protein EUTSA_v10000076mg [Eutrema salsugineum]
Length=651

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFLNPYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  446  VNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  497



>ref|XP_006651784.1| PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 
2-like [Oryza brachyantha]
Length=710

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPM+
Sbjct  552  VNILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMI  603



>ref|XP_008797003.1| PREDICTED: BEL1-like homeodomain protein 4 [Phoenix dactylifera]
Length=543

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 102/186 (55%), Gaps = 15/186 (8%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK  L+RQTGLS+NQVSNWFINARVRLWKPMV    E+  
Sbjct  365  VNILRAWLFEHFLHPYPSDADKQQLARQTGLSRNQVSNWFINARVRLWKPMV----EEIY  420

Query  507  keeENAQTPMPRDDDDDNSKEItattsttptttttlpsaaaTKRCQFNATENDSSRTnii  328
            ++E   +    R+D  D               +    ++   +  + N T++ ++     
Sbjct  421  QQEAKEKVATRREDKKDGQ--------GVRPQSPPQNNSPQGQGPEANLTDSPAAAAAHQ  472

Query  327  nnyaaqyaASGNQVTMINGNTAAVPPPVSLSFAAAAAPVVDCGGGFGTPATGDVSLTLGL  148
            +N  A    +    + ++   A + P   L   AAA  +   G G    A GDVSLTLGL
Sbjct  473  SNDDAILIGTDTPASAMDLCGADMEPMDDLCGTAAATAL---GSGVRLGAAGDVSLTLGL  529

Query  147  RHPENS  130
            RH  NS
Sbjct  530  RHSGNS  535



>ref|XP_002466514.1| hypothetical protein SORBIDRAFT_01g009130 [Sorghum bicolor]
 gb|EER93512.1| hypothetical protein SORBIDRAFT_01g009130 [Sorghum bicolor]
Length=770

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPM+
Sbjct  565  VNILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMI  616



>ref|XP_009400050.1| PREDICTED: BEL1-like homeodomain protein 4 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=732

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  523  VNILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  574



>emb|CAN64299.1| hypothetical protein VITISV_034918 [Vitis vinifera]
Length=262

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM  535
            VN+LR+WLFEHFL+PYPS+ADK LLSRQTGLS+NQVSNWFINARVRLWKPM
Sbjct  103  VNILRAWLFEHFLHPYPSDADKHLLSRQTGLSRNQVSNWFINARVRLWKPM  153



>ref|NP_001148063.1| homeodomain protein JUBEL1 [Zea mays]
 gb|ACG29619.1| homeodomain protein JUBEL1 [Zea mays]
Length=755

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPM+
Sbjct  557  VNILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMI  608



>ref|XP_010243287.1| PREDICTED: BEL1-like homeodomain protein 2 [Nelumbo nucifera]
Length=809

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  566  VNILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  617



>tpg|DAA51178.1| TPA: putative POX domain/homeobox DNA-binding domain family protein 
[Zea mays]
Length=755

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPM+
Sbjct  557  VNILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMI  608



>gb|KHN44516.1| BEL1-like homeodomain protein 2 [Glycine soja]
Length=600

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  386  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  437



>ref|XP_009109344.1| PREDICTED: BEL1-like homeodomain protein 2 [Brassica rapa]
 ref|XP_009109345.1| PREDICTED: BEL1-like homeodomain protein 2 [Brassica rapa]
Length=661

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  453  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  504



>ref|XP_006574714.1| PREDICTED: BEL1-like homeodomain protein 2-like [Glycine max]
Length=766

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVE+MY+QE 
Sbjct  552  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEDMYQQEL  611

Query  507  keeENAQTPMPRDDDDDN  454
            KE E A+    R+    N
Sbjct  612  KEAEGAEEDRERNQSSSN  629



>ref|XP_011083914.1| PREDICTED: BEL1-like homeodomain protein 4 [Sesamum indicum]
Length=618

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLF+HFL+PYPSEADK +LSRQTGLSKNQVSNWFINARVRLWKPMV
Sbjct  441  VNILRAWLFDHFLHPYPSEADKHMLSRQTGLSKNQVSNWFINARVRLWKPMV  492



>emb|CDY22463.1| BnaC03g61760D [Brassica napus]
Length=670

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  462  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  513



>emb|CDY24765.1| BnaA08g15450D [Brassica napus]
Length=667

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  453  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  504



>gb|AAN03623.1|AF406699_1 BEL1-related homeotic protein 13 [Solanum tuberosum]
Length=567

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  353  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  404



>ref|XP_008440170.1| PREDICTED: BEL1-like homeodomain protein 4 [Cucumis melo]
Length=692

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 52/52 (100%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK+LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  494  VNILRAWLFEHFLHPYPSDADKLLLARQTGLSRNQVSNWFINARVRLWKPMV  545



>ref|XP_004142028.1| PREDICTED: homeobox protein BEL1 homolog [Cucumis sativus]
Length=657

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 52/52 (100%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK+LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  498  VNILRAWLFEHFLHPYPSDADKLLLARQTGLSRNQVSNWFINARVRLWKPMV  549



>gb|KGN48456.1| hypothetical protein Csa_6G487770 [Cucumis sativus]
Length=696

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 52/52 (100%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK+LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  498  VNILRAWLFEHFLHPYPSDADKLLLARQTGLSRNQVSNWFINARVRLWKPMV  549



>ref|XP_006411954.1| hypothetical protein EUTSA_v10024509mg [Eutrema salsugineum]
 gb|ESQ53407.1| hypothetical protein EUTSA_v10024509mg [Eutrema salsugineum]
Length=739

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  510  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  561



>gb|EAY91758.1| hypothetical protein OsI_13400 [Oryza sativa Indica Group]
Length=803

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPM+
Sbjct  601  VNILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMI  652



>ref|XP_006599397.1| PREDICTED: BEL1-like homeodomain protein 2-like [Glycine max]
Length=777

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  563  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  614



>ref|XP_007204284.1| hypothetical protein PRUPE_ppa001286mg [Prunus persica]
 gb|EMJ05483.1| hypothetical protein PRUPE_ppa001286mg [Prunus persica]
Length=862

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  594  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  645



>gb|KHN36166.1| BEL1-like homeodomain protein 2 [Glycine soja]
Length=701

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 3/78 (4%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMVEEMY+QE 
Sbjct  459  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQEL  518

Query  507  keeENAQTPMPRDDDDDN  454
            KE E+A+    R+ D  N
Sbjct  519  KEAESAEE---REKDQSN  533



>gb|ABF98709.1| homeodomain protein JUBEL1, putative, expressed [Oryza sativa 
Japonica Group]
Length=790

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPM+
Sbjct  573  VNILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMI  624



>ref|XP_008241607.1| PREDICTED: BEL1-like homeodomain protein 4 [Prunus mume]
Length=862

 Score =   108 bits (269),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  594  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  645



>emb|CBI17588.3| unnamed protein product [Vitis vinifera]
Length=678

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  479  VNILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  530



>gb|KDP31824.1| hypothetical protein JCGZ_12285 [Jatropha curcas]
Length=812

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  573  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  624



>emb|CDX75604.1| BnaA01g00980D [Brassica napus]
Length=669

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  449  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  500



>emb|CAB16801.2| BEL1-like homeobox 2 protein (BLH2) [Arabidopsis thaliana]
 emb|CAB80353.1| BEL1-like homeobox 2 protein (BLH2) [Arabidopsis thaliana]
Length=638

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  509  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  560



>ref|XP_008778978.1| PREDICTED: BEL1-like homeodomain protein 4 isoform X1 [Phoenix 
dactylifera]
Length=732

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VNVLR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  518  VNVLRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  569



>ref|XP_010446733.1| PREDICTED: BEL1-like homeodomain protein 2 [Camelina sativa]
Length=747

 Score =   107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  516  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  567



>dbj|BAJ04685.1| BEL1-type homeodomain protein [Triticum aestivum]
Length=767

 Score =   107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPM+
Sbjct  553  VSILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMI  604



>dbj|BAJ88032.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=757

 Score =   107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPM+
Sbjct  545  VSILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMI  596



>ref|XP_007156003.1| hypothetical protein PHAVU_003G250500g [Phaseolus vulgaris]
 ref|XP_007156004.1| hypothetical protein PHAVU_003G250500g [Phaseolus vulgaris]
 gb|ESW27997.1| hypothetical protein PHAVU_003G250500g [Phaseolus vulgaris]
 gb|ESW27998.1| hypothetical protein PHAVU_003G250500g [Phaseolus vulgaris]
Length=778

 Score =   107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  550  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  601



>dbj|BAJ04686.1| BEL1-type homeodomain protein [Triticum aestivum]
Length=771

 Score =   107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPM+
Sbjct  557  VSILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMI  608



>ref|XP_004300584.1| PREDICTED: BEL1-like homeodomain protein 2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011465451.1| PREDICTED: BEL1-like homeodomain protein 2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011465452.1| PREDICTED: BEL1-like homeodomain protein 2 [Fragaria vesca subsp. 
vesca]
Length=824

 Score =   107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  556  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  607



>ref|XP_002269670.2| PREDICTED: BEL1-like homeodomain protein 2 [Vitis vinifera]
Length=798

 Score =   107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  559  VNILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  610



>ref|XP_009141155.1| PREDICTED: BEL1-like homeodomain protein 2 [Brassica rapa]
 ref|XP_009141221.1| PREDICTED: BEL1-like homeodomain protein 2 [Brassica rapa]
Length=667

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  447  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  498



>ref|XP_007156875.1| hypothetical protein PHAVU_002G024800g [Phaseolus vulgaris]
 gb|ESW28869.1| hypothetical protein PHAVU_002G024800g [Phaseolus vulgaris]
Length=732

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  492  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  543



>ref|NP_195405.4| BEL1-like homeodomain protein 2 [Arabidopsis thaliana]
 ref|NP_001031797.4| BEL1-like homeodomain protein 2 [Arabidopsis thaliana]
 sp|Q9SW80.3|BLH2_ARATH RecName: Full=BEL1-like homeodomain protein 2; Short=BEL1-like 
protein 2; AltName: Full=Protein SAWTOOTH 1 [Arabidopsis thaliana]
 gb|AEE86711.1| BEL1-like homeodomain protein 2 [Arabidopsis thaliana]
 gb|AEE86712.1| BEL1-like homeodomain protein 2 [Arabidopsis thaliana]
Length=739

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  510  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  561



>gb|AAD51349.1| bel1-like homeodomain 2 [Arabidopsis thaliana]
 gb|AAK91472.1| AT4g36870/C7A10_490 [Arabidopsis thaliana]
Length=739

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  510  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  561



>gb|KHN42028.1| BEL1-like homeodomain protein 2 [Glycine soja]
Length=700

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  464  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  515



>ref|XP_003538830.1| PREDICTED: BEL1-like homeodomain protein 2-like [Glycine max]
Length=705

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  463  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  514



>gb|EEE59870.1| hypothetical protein OsJ_12461 [Oryza sativa Japonica Group]
Length=816

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPM+
Sbjct  591  VNILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMI  642



>gb|AAK38645.1|AF334758_1 homeodomain protein JUBEL1 [Hordeum vulgare subsp. vulgare]
Length=759

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPM+
Sbjct  545  VSILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMI  596



>gb|AET04003.2| BEL1-related homeotic protein [Medicago truncatula]
Length=839

 Score =   107 bits (268),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  588  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  639



>dbj|BAJ04684.1| BEL1-type homeodomain protein [Triticum aestivum]
Length=765

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPM+
Sbjct  551  VSILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMI  602



>ref|XP_006338267.1| PREDICTED: BEL1-related homeotic protein 13 isoform X1 [Solanum 
tuberosum]
 ref|XP_006338268.1| PREDICTED: BEL1-related homeotic protein 13 isoform X2 [Solanum 
tuberosum]
Length=738

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  522  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  573



>ref|XP_008813264.1| PREDICTED: BEL1-like homeodomain protein 4 [Phoenix dactylifera]
Length=748

 Score =   107 bits (267),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  531  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  582



>ref|XP_008344278.1| PREDICTED: BEL1-like homeodomain protein 2 [Malus domestica]
Length=809

 Score =   107 bits (267),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  568  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  619



>gb|AAF43095.1|AF053769_1 homeodomain protein [Malus domestica]
Length=809

 Score =   107 bits (267),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  568  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  619



>ref|XP_010254984.1| PREDICTED: BEL1-like homeodomain protein 4 [Nelumbo nucifera]
Length=813

 Score =   107 bits (267),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  568  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  619



>gb|ACA61780.1| BIPINNATA [Solanum lycopersicum]
Length=675

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  509  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  560



>ref|XP_002869016.1| hypothetical protein ARALYDRAFT_328081 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45275.1| hypothetical protein ARALYDRAFT_328081 [Arabidopsis lyrata subsp. 
lyrata]
Length=726

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  500  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  551



>ref|XP_011009913.1| PREDICTED: BEL1-like homeodomain protein 4 [Populus euphratica]
 ref|XP_011009914.1| PREDICTED: BEL1-like homeodomain protein 4 [Populus euphratica]
Length=826

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  577  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  628



>gb|KHG13966.1| BEL1-like homeodomain protein 2 [Gossypium arboreum]
Length=674

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  459  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  510



>gb|KJB17836.1| hypothetical protein B456_003G018100 [Gossypium raimondii]
Length=680

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  467  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  518



>ref|XP_010230386.1| PREDICTED: BEL1-like homeodomain protein 4 [Brachypodium distachyon]
Length=797

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPM+
Sbjct  569  VSILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMI  620



>ref|XP_002306443.2| hypothetical protein POPTR_0005s13780g [Populus trichocarpa]
 gb|EEE93439.2| hypothetical protein POPTR_0005s13780g [Populus trichocarpa]
Length=825

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  576  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  627



>ref|XP_004148064.1| PREDICTED: uncharacterized protein LOC101212977 [Cucumis sativus]
Length=644

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  447  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  498



>gb|KGN62029.1| hypothetical protein Csa_2G287110 [Cucumis sativus]
Length=655

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  447  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  498



>emb|CBI34373.3| unnamed protein product [Vitis vinifera]
Length=445

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            V+VLR+WLFEHFL+PYPS+ DK +L+RQTGLS++QVSNWFINARVRLWKPMVEEMY +ET
Sbjct  259  VSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEET  318

Query  507  keeENAQTPMPRDDDDDNSK  448
            KE++N  +P    D DDN +
Sbjct  319  KEQDNLGSPDGATDPDDNGR  338



>ref|XP_007047070.1| BEL1-like homeodomain protein 2 isoform 1 [Theobroma cacao]
 gb|EOX91227.1| BEL1-like homeodomain protein 2 isoform 1 [Theobroma cacao]
Length=824

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  564  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  615



>gb|EYU44317.1| hypothetical protein MIMGU_mgv1a001716mg [Erythranthe guttata]
Length=769

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  567  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  618



>ref|XP_010680937.1| PREDICTED: BEL1-like homeodomain protein 4 [Beta vulgaris subsp. 
vulgaris]
Length=817

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VNVLR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPM+
Sbjct  582  VNVLRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMI  633



>ref|XP_008457795.1| PREDICTED: BEL1-like homeodomain protein 4 [Cucumis melo]
 ref|XP_008457796.1| PREDICTED: BEL1-like homeodomain protein 4 [Cucumis melo]
Length=674

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  449  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  500



>gb|AAN03625.1|AF406701_1 BEL1-related homeotic protein 22, partial [Solanum tuberosum]
Length=620

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQV+NWFINARVRLWKPMV
Sbjct  418  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVANWFINARVRLWKPMV  469



>ref|XP_010097899.1| BEL1-like homeodomain protein 2 [Morus notabilis]
 gb|EXB72726.1| BEL1-like homeodomain protein 2 [Morus notabilis]
Length=970

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  676  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  727



>ref|XP_009776283.1| PREDICTED: BEL1-like homeodomain protein 2 [Nicotiana sylvestris]
Length=771

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  546  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  597



>ref|XP_009411323.1| PREDICTED: BEL1-like homeodomain protein 4 [Musa acuminata subsp. 
malaccensis]
Length=687

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  495  VHILRGWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  546



>gb|AFK36785.1| unknown [Lotus japonicus]
Length=274

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFLNPYP +++K++L+RQTGLS+NQV+NWFINARVRLWKPMV
Sbjct  16   VSILRAWLFEHFLNPYPKDSEKIMLARQTGLSRNQVANWFINARVRLWKPMV  67



>ref|XP_002279230.2| PREDICTED: homeobox protein BEL1 homolog [Vitis vinifera]
Length=672

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            V+VLR+WLFEHFL+PYPS+ DK +L+RQTGLS++QVSNWFINARVRLWKPMVEEMY +ET
Sbjct  425  VSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEET  484

Query  507  keeENAQTPMPRDDDDDNSK  448
            KE++N  +P    D DDN +
Sbjct  485  KEQDNLGSPDGATDPDDNGR  504



>ref|XP_009395654.1| PREDICTED: BEL1-like homeodomain protein 4 [Musa acuminata subsp. 
malaccensis]
Length=701

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  502  VSILRGWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  553



>dbj|BAE98691.1| putative homeodomain protein BELL1 [Arabidopsis thaliana]
Length=431

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP E++K++LS+QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  358  VSILRAWLFEHFLHPYPKESEKIMLSKQTGLSKNQVANWFINARVRLWKPMI  409



>ref|XP_009769608.1| PREDICTED: BEL1-like homeodomain protein 4 [Nicotiana sylvestris]
Length=752

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V +LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  521  VTILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  572



>ref|XP_010938938.1| PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 
4 [Elaeis guineensis]
Length=747

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS++QVSNWFINARVRLWKPMV
Sbjct  530  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRSQVSNWFINARVRLWKPMV  581



>dbj|BAJ95083.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=807

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LRSWLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNW INARVRLWKPM+
Sbjct  595  VSILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWLINARVRLWKPMI  646



>gb|EMS53609.1| BEL1-like homeodomain protein 2 [Triticum urartu]
Length=288

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V +LR+WLFEHFLNPYPS+ DK +L+RQTGLS++QVSNWFINARVRLWKPMV
Sbjct  215  VTILRAWLFEHFLNPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMV  266



>ref|XP_010531191.1| PREDICTED: BEL1-like homeodomain protein 4 [Tarenaya hassleriana]
Length=746

 Score =   104 bits (259),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  531  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  582



>tpg|DAA43039.1| TPA: putative POX domain/homeobox DNA-binding domain family protein 
[Zea mays]
Length=297

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V +LR+WLFEHFL+PYPS+ DK +L+RQTGLS++QVSNWFINARVRLWKPMV
Sbjct  45   VTILRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMV  96



>ref|XP_010428562.1| PREDICTED: BEL1-like homeodomain protein 3 [Camelina sativa]
Length=537

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP E++K++LS+QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  372  VSILRAWLFEHFLHPYPKESEKIMLSKQTGLSKNQVANWFINARVRLWKPMI  423



>ref|NP_177674.1| BEL1-like homeodomain 3 [Arabidopsis thaliana]
 ref|NP_001077827.1| BEL1-like homeodomain 3 [Arabidopsis thaliana]
 sp|Q9FWS9.1|BLH3_ARATH RecName: Full=BEL1-like homeodomain protein 3; Short=BEL1-like 
protein 3 [Arabidopsis thaliana]
 gb|AAG13065.1|AC023754_3 Similar to homeodomain proteins [Arabidopsis thaliana]
 gb|AAK43835.1|AF353093_1 BEL1-like homeodomain 3 [Arabidopsis thaliana]
 gb|AAM62510.1| homeodomain protein BELL1, putative [Arabidopsis thaliana]
 gb|AAT09418.1| BEL1-like homeodomain 3 protein [Arabidopsis thaliana]
 gb|AEE35716.1| BEL1-like homeodomain 3 [Arabidopsis thaliana]
 gb|AEE35717.1| BEL1-like homeodomain 3 [Arabidopsis thaliana]
Length=524

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP E++K++LS+QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  358  VSILRAWLFEHFLHPYPKESEKIMLSKQTGLSKNQVANWFINARVRLWKPMI  409



>gb|AAL32623.1| Similar to homeodomain proteins [Arabidopsis thaliana]
 gb|AAN15452.1| Similar to homeodomain proteins [Arabidopsis thaliana]
Length=524

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP E++K++LS+QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  358  VSILRAWLFEHFLHPYPKESEKIMLSKQTGLSKNQVANWFINARVRLWKPMI  409



>ref|XP_006302135.1| hypothetical protein CARUB_v10020140mg [Capsella rubella]
 gb|EOA35033.1| hypothetical protein CARUB_v10020140mg [Capsella rubella]
Length=524

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP E++K++LS+QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  360  VSILRAWLFEHFLHPYPKESEKIMLSKQTGLSKNQVANWFINARVRLWKPMI  411



>ref|XP_002889024.1| hypothetical protein ARALYDRAFT_476691 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65283.1| hypothetical protein ARALYDRAFT_476691 [Arabidopsis lyrata subsp. 
lyrata]
Length=522

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP E++K++LS+QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  358  VSILRAWLFEHFLHPYPKESEKIMLSKQTGLSKNQVANWFINARVRLWKPMI  409



>gb|ACU01965.1| bell1-like protein [Santalum album]
Length=285

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLRSWLFEHFL+PYPS+ DK +L+RQTGLS++QVSNWFINARVRLWKPMV
Sbjct  68   VSVLRSWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMV  119



>ref|XP_010941926.1| PREDICTED: BEL1-like homeodomain protein 4 [Elaeis guineensis]
Length=558

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VNVLR+WLFEHFL+PYPS+ADK  L++QTGLS+NQVSNWFINARVRLWKPMV
Sbjct  382  VNVLRAWLFEHFLHPYPSDADKQQLAKQTGLSRNQVSNWFINARVRLWKPMV  433



>emb|CDY29411.1| BnaA06g13850D [Brassica napus]
Length=389

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP E++K++L++QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  229  VSVLRAWLFEHFLHPYPKESEKMMLAKQTGLSKNQVANWFINARVRLWKPMI  280



>ref|XP_006664357.1| PREDICTED: BEL1-like homeodomain protein 1-like [Oryza brachyantha]
Length=406

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP ++DKV+L++QTGL+++QVSNWFINARVRLWKPMV
Sbjct  149  VSVLRAWLFEHFLHPYPKDSDKVMLAKQTGLTRSQVSNWFINARVRLWKPMV  200



>gb|ACU01957.1| aintegumenta-like protein [Santalum album]
Length=299

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLRSWLFEHFL+PYPS+ DK +L+RQTGLS++QVSNWFINARVRLWKPMV
Sbjct  82   VSVLRSWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMV  133



>ref|XP_010416424.1| PREDICTED: BEL1-like homeodomain protein 3 [Camelina sativa]
Length=527

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP E++K++LS+QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  363  VSILRAWLFEHFLHPYPKESEKIMLSKQTGLSKNQVANWFINARVRLWKPMI  414



>ref|XP_010471651.1| PREDICTED: BEL1-like homeodomain protein 3 [Camelina sativa]
Length=537

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP E++K++LS+QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  372  VSILRAWLFEHFLHPYPKESEKIMLSKQTGLSKNQVANWFINARVRLWKPMI  423



>ref|XP_010548375.1| PREDICTED: BEL1-like homeodomain protein 4 [Tarenaya hassleriana]
 ref|XP_010548376.1| PREDICTED: BEL1-like homeodomain protein 4 [Tarenaya hassleriana]
Length=756

 Score =   103 bits (257),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  544  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  595



>ref|XP_009376501.1| PREDICTED: BEL1-like homeodomain protein 4 [Pyrus x bretschneideri]
Length=719

 Score =   103 bits (257),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct  527  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV  578



>ref|NP_173400.1| BEL1-like homeodomain 10 [Arabidopsis thaliana]
 ref|NP_001154352.1| BEL1-like homeodomain 10 [Arabidopsis thaliana]
 ref|NP_001185040.1| BEL1-like homeodomain 10 [Arabidopsis thaliana]
 sp|Q9FXG8.1|BLH10_ARATH RecName: Full=BEL1-like homeodomain protein 10; Short=BEL1-like 
protein 10 [Arabidopsis thaliana]
 gb|AAG12557.1|AC007797_17 Similar to homeodomain proteins [Arabidopsis thaliana]
 gb|AAS78200.1| BEL1-like homeodomain 5 protein [Arabidopsis thaliana]
 gb|AEE29884.1| BEL1-like homeodomain 10 [Arabidopsis thaliana]
 gb|AEE29885.1| BEL1-like homeodomain 10 [Arabidopsis thaliana]
 gb|AEE29886.1| BEL1-like homeodomain 10 [Arabidopsis thaliana]
Length=538

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP E++K++L++QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  363  VSVLRAWLFEHFLHPYPKESEKIMLAKQTGLSKNQVANWFINARVRLWKPMI  414



>ref|XP_010459643.1| PREDICTED: BEL1-like homeodomain protein 10 [Camelina sativa]
Length=541

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP E++K++L++QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  364  VSVLRAWLFEHFLHPYPKESEKIMLAKQTGLSKNQVANWFINARVRLWKPMI  415



>emb|CDY39359.1| BnaC05g15280D [Brassica napus]
Length=519

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP EA+K++L++QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  359  VSVLRAWLFEHFLHPYPKEAEKMMLAKQTGLSKNQVANWFINARVRLWKPMI  410



>tpg|DAA43544.1| TPA: putative POX domain/homeobox DNA-binding domain family protein 
[Zea mays]
Length=343

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP +++K++L+RQTGLS+ QVSNWFINARVRLWKPM+
Sbjct  102  VSVLRAWLFEHFLHPYPKDSEKLMLARQTGLSRGQVSNWFINARVRLWKPMI  153



>ref|XP_002893062.1| hypothetical protein ARALYDRAFT_472196 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69321.1| hypothetical protein ARALYDRAFT_472196 [Arabidopsis lyrata subsp. 
lyrata]
Length=531

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP E++K++L++QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  358  VSVLRAWLFEHFLHPYPKESEKIMLAKQTGLSKNQVANWFINARVRLWKPMI  409



>ref|XP_010419211.1| PREDICTED: BEL1-like homeodomain protein 11, partial [Camelina 
sativa]
Length=150

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V +LR+WLF+HFL+PYP EA+K++L+ QTGLSKNQVSNWFINARVRLWKPM+
Sbjct  74   VAILRAWLFQHFLHPYPDEAEKLVLASQTGLSKNQVSNWFINARVRLWKPMI  125



>ref|XP_010498393.1| PREDICTED: BEL1-like homeodomain protein 10 [Camelina sativa]
Length=542

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP E++K++L++QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  365  VSVLRAWLFEHFLHPYPKESEKIMLAKQTGLSKNQVANWFINARVRLWKPMI  416



>ref|XP_006307208.1| hypothetical protein CARUB_v10008805mg [Capsella rubella]
 gb|EOA40106.1| hypothetical protein CARUB_v10008805mg [Capsella rubella]
Length=536

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP E++K++L++QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  363  VSVLRAWLFEHFLHPYPKESEKIMLAKQTGLSKNQVANWFINARVRLWKPMI  414



>gb|ACF83935.1| unknown [Zea mays]
Length=308

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLRSWLFEHFL+PYP+++DK +L++QTGL++NQVSNWFINARVRLWKPMV
Sbjct  63   VSVLRSWLFEHFLHPYPTDSDKQMLAKQTGLTRNQVSNWFINARVRLWKPMV  114



>ref|XP_009798621.1| PREDICTED: BEL1-like homeodomain protein 9, partial [Nicotiana 
sylvestris]
Length=356

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V VLR+WLF+HFL+PYP+++DKV+L++QTGLS+NQVSNWFINARVRLWKPMV
Sbjct  135  VTVLRAWLFDHFLHPYPTDSDKVMLAKQTGLSRNQVSNWFINARVRLWKPMV  186



>ref|XP_010459644.1| PREDICTED: BEL1-like homeodomain protein 10 [Camelina sativa]
Length=542

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP E++K++L++QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  364  VSVLRAWLFEHFLHPYPKESEKIMLAKQTGLSKNQVANWFINARVRLWKPMI  415



>ref|XP_010477192.1| PREDICTED: BEL1-like homeodomain protein 10 [Camelina sativa]
Length=542

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP E++K++L++QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  365  VSVLRAWLFEHFLHPYPKESEKIMLAKQTGLSKNQVANWFINARVRLWKPMI  416



>ref|XP_010312363.1| PREDICTED: BEL1-like homeodomain protein 9 isoform X3 [Solanum 
lycopersicum]
Length=345

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V VLR+WLFEHFL+PYP+++DKV+L++QTGLS+NQVSNWFINARVR+WKPMV
Sbjct  230  VTVLRAWLFEHFLHPYPTDSDKVMLAKQTGLSRNQVSNWFINARVRVWKPMV  281



>ref|XP_003562164.1| PREDICTED: homeobox protein BEL1 homolog [Brachypodium distachyon]
 ref|XP_010229286.1| PREDICTED: homeobox protein BEL1 homolog [Brachypodium distachyon]
Length=609

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V VLR+WLFEHFL+PYPS+ DK +LSRQTGLS++QVSNWFINARVRLWKPMV
Sbjct  332  VTVLRAWLFEHFLHPYPSDVDKHILSRQTGLSRSQVSNWFINARVRLWKPMV  383



>ref|XP_002306891.2| hypothetical protein POPTR_0005s25350g [Populus trichocarpa]
 gb|EEE93887.2| hypothetical protein POPTR_0005s25350g [Populus trichocarpa]
Length=443

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            V +LRSWLFEHFL+PYP+E++K++L+ QTGL+KNQVSNWFINARVRLWKPM+EEMY+ E 
Sbjct  357  VAILRSWLFEHFLHPYPNESEKLMLASQTGLTKNQVSNWFINARVRLWKPMIEEMYKVEF  416

Query  507  keeENAQTPMP  475
             +      P+P
Sbjct  417  ADSSEDSNPLP  427



>ref|XP_010028619.1| PREDICTED: BEL1-like homeodomain protein 7 [Eucalyptus grandis]
 ref|XP_010028620.1| PREDICTED: BEL1-like homeodomain protein 7 [Eucalyptus grandis]
 ref|XP_010028621.1| PREDICTED: BEL1-like homeodomain protein 7 [Eucalyptus grandis]
 gb|KCW55381.1| hypothetical protein EUGRSUZ_I01293 [Eucalyptus grandis]
Length=669

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP ++DK+LL+RQTGL+++QVSNWFINARVRLWKPMV
Sbjct  406  VSILRAWLFEHFLHPYPKDSDKILLARQTGLTRSQVSNWFINARVRLWKPMV  457



>gb|ACU01963.1| bell1-like protein [Comandra umbellata]
Length=342

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYPS+ DK +L+RQTGLS++QVSNWFINARVRLWKPMV
Sbjct  82   VSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMV  133



>ref|XP_004173415.1| PREDICTED: BEL1-like homeodomain protein 6-like [Cucumis sativus]
Length=681

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 114/209 (55%), Gaps = 28/209 (13%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeq--  514
            V++LR+WLFEHFL+PYP ++DK++L+RQTGL+++QVSNWFINARVRLWKPMVEEMY++  
Sbjct  417  VSILRAWLFEHFLHPYPKDSDKIMLARQTGLTRSQVSNWFINARVRLWKPMVEEMYKEEI  476

Query  513  ------etkeeENAQTPMPRDD---DDDNSKEItattsttptttttlpsaaaTKRCQFNA  361
                       ENA      D+   DDD  +++  + S+T T   +       K  Q + 
Sbjct  477  GSVDMDSISSSENAGKATKGDNKTFDDDKEEDLQQSASSTATERCSAGDIIDLKSDQVSN  536

Query  360  TENDSSRTniinnyaaqyaASGNQVTMIN-------GNTAAVPPPVSLS-------FAAA  223
              N  S   + +     +  + N++   N        N++  P  +  S        AAA
Sbjct  537  LGNSCS-NRVASFQNGAHTEARNELAKPNDELRPNVNNSSFFPDAIVHSQGESDRFMAAA  595

Query  222  AAPVVDCGGGFGTPATGDVSLTLGLRHPE  136
            AA  +   G FGT   G VSLTLGL+H E
Sbjct  596  AAYHMSELGRFGT--VGGVSLTLGLQHCE  622



>dbj|BAJ89622.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90323.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=600

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYPS+ DK +L+RQTGLS++QVSNWFINARVRLWKPMV
Sbjct  352  VSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMV  403



>ref|XP_006384929.1| homeodomain-containing family protein [Populus trichocarpa]
 gb|ERP62726.1| homeodomain-containing family protein [Populus trichocarpa]
Length=325

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V VLR+WLFEHFL+PYP++ADK +L+ QTGLS+NQVSNWFINARVRLWKPMV
Sbjct  127  VAVLRAWLFEHFLHPYPTDADKHMLATQTGLSRNQVSNWFINARVRLWKPMV  178



>ref|XP_006341978.1| PREDICTED: BEL1-like homeodomain protein 11-like [Solanum tuberosum]
Length=423

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V +LRSWLFEHFL+PYP++++K++LS QTGLSKNQVSNWFINARVRLWKPM+
Sbjct  342  VAILRSWLFEHFLHPYPNDSEKLMLSSQTGLSKNQVSNWFINARVRLWKPMI  393



>gb|ACD39462.1| BEL14 protein [Solanum etuberosum]
Length=534

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            V+VLR+WLFEHFL+PYPS+ DK +L+RQTGLS++QVSNWFINARVRLWKPMVEEMY +ET
Sbjct  306  VSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEET  365

Query  507  keeENAQTP  481
            KEEEN  +P
Sbjct  366  KEEENVGSP  374



>ref|XP_004500978.1| PREDICTED: BEL1-like homeodomain protein 10-like [Cicer arietinum]
Length=587

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFLNPYP +++K++L+RQTGL++NQV+NWFINARVRLWKPMV
Sbjct  358  VSILRAWLFEHFLNPYPKDSEKIMLARQTGLTRNQVANWFINARVRLWKPMV  409



>gb|AAN03624.1|AF406700_1 BEL1-related homeotic protein 14 [Solanum tuberosum]
Length=532

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            V+VLR+WLFEHFL+PYPS+ DK +L+RQTGLS++QVSNWFINARVRLWKPMVEEMY +ET
Sbjct  308  VSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEET  367

Query  507  keeENAQTP  481
            KEEEN  +P
Sbjct  368  KEEENVGSP  376



>ref|XP_004983819.1| PREDICTED: homeobox protein BEL1 homolog isoform X1 [Setaria 
italica]
 ref|XP_004983820.1| PREDICTED: homeobox protein BEL1 homolog isoform X2 [Setaria 
italica]
Length=588

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYPS+ DK +L+RQTGLS++QVSNWFINARVRLWKPMV
Sbjct  338  VSILRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMV  389



>ref|XP_009372989.1| PREDICTED: BEL1-like homeodomain protein 6 [Pyrus x bretschneideri]
Length=685

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP ++DK+LL+RQTGL+++QVSNWFINARVRLWKPMV
Sbjct  416  VSILRAWLFEHFLHPYPKDSDKILLARQTGLTRSQVSNWFINARVRLWKPMV  467



>emb|CDX73170.1| BnaC06g36180D [Brassica napus]
Length=514

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP E++K++L++QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  346  VSILRAWLFEHFLHPYPKESEKIMLAKQTGLSKNQVANWFINARVRLWKPMI  397



>ref|XP_008382306.1| PREDICTED: BEL1-like homeodomain protein 6 [Malus domestica]
Length=690

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP ++DK+LL+RQTGL+++QVSNWFINARVRLWKPMV
Sbjct  419  VSILRAWLFEHFLHPYPKDSDKILLARQTGLTRSQVSNWFINARVRLWKPMV  470



>emb|CAN65696.1| hypothetical protein VITISV_001987 [Vitis vinifera]
Length=687

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            V++LR+WLFEHFL+PYP +++K++L+RQTGL+++QV+NWFINARVRLWKPMVEE+Y++E 
Sbjct  442  VSILRTWLFEHFLHPYPKDSEKIMLARQTGLTRSQVANWFINARVRLWKPMVEEIYKEEI  501

Query  507  keeENAQTPMPRDDDD  460
            +  +  Q  +PR  +D
Sbjct  502  ESSKRHQEMIPRASED  517



>ref|XP_009106194.1| PREDICTED: BEL1-like homeodomain protein 3 [Brassica rapa]
Length=519

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP E++K++L++QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  349  VSILRAWLFEHFLHPYPKESEKIMLAKQTGLSKNQVANWFINARVRLWKPMI  400



>ref|XP_004249839.1| PREDICTED: BEL1-like homeodomain protein 9 isoform X2 [Solanum 
lycopersicum]
Length=402

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V VLR+WLFEHFL+PYP+++DKV+L++QTGLS+NQVSNWFINARVR+WKPMV
Sbjct  287  VTVLRAWLFEHFLHPYPTDSDKVMLAKQTGLSRNQVSNWFINARVRVWKPMV  338



>emb|CDY47524.1| BnaAnng09220D [Brassica napus]
Length=516

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP E++K++L++QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  349  VSILRAWLFEHFLHPYPKESEKIMLAKQTGLSKNQVANWFINARVRLWKPMI  400



>ref|XP_003539486.1| PREDICTED: BEL1-like homeodomain protein 1-like, partial [Glycine 
max]
Length=526

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP ++DKV+L++QTGLS++QVSNWFINARVRLWKPMV
Sbjct  207  VSILRAWLFEHFLHPYPKDSDKVMLAKQTGLSRSQVSNWFINARVRLWKPMV  258



>ref|XP_003623151.1| BEL1-like homeodomain protein [Medicago truncatula]
 gb|AES79369.1| BEL1-like homeodomain protein [Medicago truncatula]
Length=516

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR WLFEHFL+PYPS+ DK++L++QTGLS+NQVSNWFINARVRLWKPMV
Sbjct  317  VSVLRGWLFEHFLHPYPSDTDKLMLAKQTGLSRNQVSNWFINARVRLWKPMV  368



>gb|KHN17979.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=517

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP ++DKV+L++QTGLS++QVSNWFINARVRLWKPMV
Sbjct  198  VSILRAWLFEHFLHPYPKDSDKVMLAKQTGLSRSQVSNWFINARVRLWKPMV  249



>ref|XP_010941766.1| PREDICTED: BEL1-like homeodomain protein 4 [Elaeis guineensis]
 ref|XP_010941776.1| PREDICTED: BEL1-like homeodomain protein 4 [Elaeis guineensis]
 ref|XP_010941786.1| PREDICTED: BEL1-like homeodomain protein 4 [Elaeis guineensis]
Length=560

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            VNVLR+WLFEHFL+PYPS+ADK  L+R+TGLS+NQVSNWFINARVRLWKPMV
Sbjct  390  VNVLRAWLFEHFLHPYPSDADKQQLARRTGLSRNQVSNWFINARVRLWKPMV  441



>ref|XP_008377278.1| PREDICTED: BEL1-like homeodomain protein 6 isoform X2 [Malus 
domestica]
Length=662

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP ++DK+LL+RQTGL+++QVSNWFINARVRLWKPMV
Sbjct  393  VSILRAWLFEHFLHPYPKDSDKILLARQTGLTRSQVSNWFINARVRLWKPMV  444



>ref|XP_010312362.1| PREDICTED: BEL1-like homeodomain protein 9 isoform X1 [Solanum 
lycopersicum]
Length=409

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V VLR+WLFEHFL+PYP+++DKV+L++QTGLS+NQVSNWFINARVR+WKPMV
Sbjct  294  VTVLRAWLFEHFLHPYPTDSDKVMLAKQTGLSRNQVSNWFINARVRVWKPMV  345



>ref|XP_009128099.1| PREDICTED: BEL1-like homeodomain protein 3 [Brassica rapa]
 ref|XP_009128100.1| PREDICTED: BEL1-like homeodomain protein 3 [Brassica rapa]
Length=478

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP E++K++L++QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  316  VSILRAWLFEHFLHPYPKESEKIMLAKQTGLSKNQVANWFINARVRLWKPMI  367



>ref|XP_008377277.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X1 [Malus 
domestica]
Length=689

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP ++DK+LL+RQTGL+++QVSNWFINARVRLWKPMV
Sbjct  420  VSILRAWLFEHFLHPYPKDSDKILLARQTGLTRSQVSNWFINARVRLWKPMV  471



>ref|XP_010516766.1| PREDICTED: BEL1-like homeodomain protein 7 [Camelina sativa]
Length=484

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V VLR+WLFEHFL+PYP ++DK++L+RQTGLS++QVSNWFINARVRLWKPMV
Sbjct  299  VLVLRAWLFEHFLHPYPKDSDKIMLARQTGLSRSQVSNWFINARVRLWKPMV  350



>ref|XP_009395039.1| PREDICTED: homeobox protein BEL1 homolog [Musa acuminata subsp. 
malaccensis]
Length=516

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 67/78 (86%), Gaps = 2/78 (3%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            V+VLR+WLFEHFL+PYP++ADK +L+RQTGLS+ QVSNWFINARVRLWKPMVEEMY +ET
Sbjct  306  VSVLRAWLFEHFLHPYPNDADKHILARQTGLSRGQVSNWFINARVRLWKPMVEEMYLEET  365

Query  507  keeENA--QTPMPRDDDD  460
            KE EN   Q P  R+ +D
Sbjct  366  KELENQADQAPTGREHND  383



>ref|XP_011073138.1| PREDICTED: homeobox protein BEL1 homolog [Sesamum indicum]
Length=603

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLRSWLFEHFL+PYPS+ DK +L+RQTGLS++QVSNWFINARVRLWKPMV
Sbjct  361  VSVLRSWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMV  412



>ref|XP_004515685.1| PREDICTED: BEL1-like homeodomain protein 9-like [Cicer arietinum]
Length=538

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP++ DK++L++QTGLS+NQVSNWFINARVRLWKPMV
Sbjct  338  VSVLRAWLFEHFLHPYPTDTDKIMLAKQTGLSRNQVSNWFINARVRLWKPMV  389



>ref|XP_009137061.1| PREDICTED: BEL1-like homeodomain protein 7 [Brassica rapa]
Length=426

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V +LR+WLFEHFL+PYP ++DK++L+RQTGLS+ QVSNWFINARVRLWKPMV
Sbjct  289  VLILRAWLFEHFLHPYPKDSDKIMLARQTGLSRGQVSNWFINARVRLWKPMV  340



>emb|CDY39031.1| BnaA02g17200D [Brassica napus]
Length=478

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP E++K++L++QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  316  VSILRAWLFEHFLHPYPKESEKIMLAKQTGLSKNQVANWFINARVRLWKPMI  367



>ref|XP_004978737.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Setaria 
italica]
 ref|XP_004978738.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Setaria 
italica]
 ref|XP_004978739.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Setaria 
italica]
 ref|XP_004978740.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X4 [Setaria 
italica]
 ref|XP_004978741.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X5 [Setaria 
italica]
 ref|XP_004978742.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X6 [Setaria 
italica]
 ref|XP_004978743.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X7 [Setaria 
italica]
 ref|XP_004978744.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X8 [Setaria 
italica]
Length=662

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP ++DK++L++QTGL+++QVSNWFINARVRLWKPMV
Sbjct  356  VSILRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARVRLWKPMV  407



>ref|XP_006390306.1| hypothetical protein EUTSA_v10018381mg [Eutrema salsugineum]
 ref|XP_006390307.1| hypothetical protein EUTSA_v10018381mg [Eutrema salsugineum]
 gb|ESQ27592.1| hypothetical protein EUTSA_v10018381mg [Eutrema salsugineum]
 gb|ESQ27593.1| hypothetical protein EUTSA_v10018381mg [Eutrema salsugineum]
Length=535

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP E++K++L++QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  374  VSILRAWLFEHFLHPYPKESEKIMLAKQTGLSKNQVANWFINARVRLWKPMI  425



>emb|CDY52073.1| BnaCnng21740D [Brassica napus]
Length=471

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP E++K++L++QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  310  VSILRAWLFEHFLHPYPKESEKIMLAKQTGLSKNQVANWFINARVRLWKPMI  361



>tpg|DAA56837.1| TPA: putative POX domain/homeobox DNA-binding domain family protein 
[Zea mays]
Length=311

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP++ DK +L++QTGL++NQVSNWFINARVRLWKPMV
Sbjct  78   VSVLRAWLFEHFLHPYPTDGDKQMLAKQTGLTRNQVSNWFINARVRLWKPMV  129



>ref|XP_009347845.1| PREDICTED: BEL1-like homeodomain protein 7 [Pyrus x bretschneideri]
Length=687

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP ++DK+LL+RQTGL+++QVSNWFINARVRLWKPMV
Sbjct  420  VSILRAWLFEHFLHPYPKDSDKILLARQTGLTRSQVSNWFINARVRLWKPMV  471



>ref|XP_003572007.1| PREDICTED: BEL1-like homeodomain protein 4 [Brachypodium distachyon]
Length=606

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYPS+ DK +L+RQTGLS++QVSNWFINARVRLWKPMV
Sbjct  341  VSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMV  392



>ref|XP_010093716.1| BEL1-like homeodomain protein 1 [Morus notabilis]
 gb|EXC39356.1| BEL1-like homeodomain protein 1 [Morus notabilis]
Length=422

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP  ADKV+L++QTGL+++QVSNWFINARVRLWKPMV
Sbjct  141  VSVLRAWLFEHFLHPYPKTADKVILAKQTGLTRSQVSNWFINARVRLWKPMV  192



>emb|CDX85896.1| BnaC06g22380D [Brassica napus]
Length=503

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP E++K++L++QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  329  VSILRAWLFEHFLHPYPKESEKIMLAKQTGLSKNQVANWFINARVRLWKPMI  380



>ref|XP_008355199.1| PREDICTED: BEL1-like homeodomain protein 9 [Malus domestica]
Length=311

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V VLR+WLFEHFL+PYP+++DK++L++QTGLS++QVSNWFINARVRLWKPMV
Sbjct  97   VTVLRAWLFEHFLHPYPTDSDKLMLAKQTGLSRSQVSNWFINARVRLWKPMV  148



>ref|XP_007140461.1| hypothetical protein PHAVU_008G114300g [Phaseolus vulgaris]
 gb|ESW12455.1| hypothetical protein PHAVU_008G114300g [Phaseolus vulgaris]
Length=583

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP++ DK++L++QTGLS+NQVSNWFINARVRLWKPMV
Sbjct  369  VSVLRAWLFEHFLHPYPTDTDKIMLAKQTGLSRNQVSNWFINARVRLWKPMV  420



>dbj|BAK04286.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=622

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V +LR+WLFEHFLNPYPS+ DK +L+RQTGLS++QVSNWFINARVRLWKPMV
Sbjct  361  VTILRAWLFEHFLNPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMV  412



>gb|EPS59583.1| hypothetical protein M569_15223 [Genlisea aurea]
Length=289

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 69/85 (81%), Gaps = 6/85 (7%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            V++LR+WLFEHFL+PYP +++K++L+RQTGLS++QV+NWFINARVRLWKPM+EEMY +E 
Sbjct  157  VSILRAWLFEHFLHPYPKDSEKLVLARQTGLSRSQVANWFINARVRLWKPMIEEMYREEF  216

Query  507  keeENAQTPMP------RDDDDDNS  451
             EE+   +  P      R DD+D+S
Sbjct  217  SEEDEFGSKEPNSASGFRQDDEDDS  241



>ref|NP_001066216.1| Os12g0160500 [Oryza sativa Japonica Group]
 dbj|BAF29235.1| Os12g0160500 [Oryza sativa Japonica Group]
Length=417

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP ++DKV+L++QTGL+++QVSNWFINARVRLWKPMV
Sbjct  128  VSVLRAWLFEHFLHPYPKDSDKVMLAKQTGLTRSQVSNWFINARVRLWKPMV  179



>ref|XP_002465808.1| hypothetical protein SORBIDRAFT_01g046170 [Sorghum bicolor]
 gb|EER92806.1| hypothetical protein SORBIDRAFT_01g046170 [Sorghum bicolor]
Length=590

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP +++K++L+RQTGLS+ QVSNWFINARVRLWKPM+
Sbjct  346  VSVLRAWLFEHFLHPYPKDSEKLMLARQTGLSRGQVSNWFINARVRLWKPMI  397



>ref|XP_002465020.1| hypothetical protein SORBIDRAFT_01g030620 [Sorghum bicolor]
 gb|EER92018.1| hypothetical protein SORBIDRAFT_01g030620 [Sorghum bicolor]
Length=634

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYPS+ DK +L+RQTGLS++QVSNWFINARVRLWKPMV
Sbjct  356  VSILRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMV  407



>ref|XP_010489213.1| PREDICTED: BEL1-like homeodomain protein 7 [Camelina sativa]
Length=479

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V VLR+WLFEHFL+PYP ++DK++L+RQTGLS+ QVSNWFINARVRLWKPMV
Sbjct  297  VLVLRAWLFEHFLHPYPKDSDKIMLARQTGLSRGQVSNWFINARVRLWKPMV  348



>gb|EYU32892.1| hypothetical protein MIMGU_mgv1a006708mg [Erythranthe guttata]
Length=434

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V +LR+WLFEHFL+PYPS+++K++L+ QTGLSKNQVSNWFINARVRLWKPM+
Sbjct  351  VTILRAWLFEHFLHPYPSDSEKLMLASQTGLSKNQVSNWFINARVRLWKPMI  402



>dbj|BAJ99003.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03383.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=622

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V +LR+WLFEHFLNPYPS+ DK +L+RQTGLS++QVSNWFINARVRLWKPMV
Sbjct  361  VTILRAWLFEHFLNPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMV  412



>ref|XP_009149453.1| PREDICTED: BEL1-like homeodomain protein 10 [Brassica rapa]
 ref|XP_009149454.1| PREDICTED: BEL1-like homeodomain protein 10 [Brassica rapa]
 ref|XP_009149455.1| PREDICTED: BEL1-like homeodomain protein 10 [Brassica rapa]
Length=518

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP E++K++L++QTGLSKNQV+NWFINARVRLWKPM+
Sbjct  358  VSVLRAWLFEHFLHPYPKESEKMMLAKQTGLSKNQVANWFINARVRLWKPMI  409



>ref|XP_006297524.1| hypothetical protein CARUB_v10013548mg [Capsella rubella]
 gb|EOA30422.1| hypothetical protein CARUB_v10013548mg [Capsella rubella]
Length=489

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V VLR+WLFEHFL+PYP ++DK++L+RQTGLS+ QVSNWFINARVRLWKPMV
Sbjct  304  VLVLRAWLFEHFLHPYPKDSDKIMLARQTGLSRGQVSNWFINARVRLWKPMV  355



>ref|XP_002886224.1| hypothetical protein ARALYDRAFT_480804 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62483.1| hypothetical protein ARALYDRAFT_480804 [Arabidopsis lyrata subsp. 
lyrata]
Length=480

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V VLR+WLFEHFL+PYP ++DK++L+RQTGLS+ QVSNWFINARVRLWKPMV
Sbjct  297  VLVLRAWLFEHFLHPYPKDSDKIMLARQTGLSRGQVSNWFINARVRLWKPMV  348



>dbj|BAK05542.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85858.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86297.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97739.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=666

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP ++DK++L++QTGL+++QVSNWFINARVRLWKPMV
Sbjct  358  VSILRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARVRLWKPMV  409



>ref|XP_002313027.2| hypothetical protein POPTR_0009s12360g [Populus trichocarpa]
 gb|EEE86982.2| hypothetical protein POPTR_0009s12360g [Populus trichocarpa]
Length=584

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP ++DK++L+RQTGL+++QVSNWFINARVRLWKPMV
Sbjct  317  VSILRAWLFEHFLHPYPKDSDKIMLARQTGLTRSQVSNWFINARVRLWKPMV  368



>ref|XP_003576293.1| PREDICTED: BEL1-like homeodomain protein 1 [Brachypodium distachyon]
 ref|XP_010237922.1| PREDICTED: BEL1-like homeodomain protein 1 [Brachypodium distachyon]
 ref|XP_010237923.1| PREDICTED: BEL1-like homeodomain protein 1 [Brachypodium distachyon]
Length=671

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP ++DK++L++QTGL+++QVSNWFINARVRLWKPMV
Sbjct  374  VSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARVRLWKPMV  425



>ref|XP_009619241.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X2 [Nicotiana 
tomentosiformis]
Length=562

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP ++DK++L+RQTGL+++QVSNWFINARVRLWKPMV
Sbjct  403  VSILRAWLFEHFLHPYPKDSDKIMLARQTGLTRSQVSNWFINARVRLWKPMV  454



>ref|NP_001140490.1| uncharacterized protein LOC100272551 [Zea mays]
 gb|ACN30837.1| unknown [Zea mays]
Length=486

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLRSWLFEHFL+PYP+++DK +L++QTGL++NQVSNWFINARVRLWKPMV
Sbjct  241  VSVLRSWLFEHFLHPYPTDSDKQMLAKQTGLTRNQVSNWFINARVRLWKPMV  292



>ref|XP_010467364.1| PREDICTED: BEL1-like homeodomain protein 7 [Camelina sativa]
 ref|XP_010467365.1| PREDICTED: BEL1-like homeodomain protein 7 [Camelina sativa]
 ref|XP_010467366.1| PREDICTED: BEL1-like homeodomain protein 7 [Camelina sativa]
Length=484

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V VLR+WLFEHFL+PYP ++DK++L+RQTGLS+ QVSNWFINARVRLWKPMV
Sbjct  299  VLVLRAWLFEHFLHPYPKDSDKIMLARQTGLSRGQVSNWFINARVRLWKPMV  350



>emb|CDY02261.1| BnaA03g39060D [Brassica napus]
Length=449

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V +LR+WLFEHFL+PYP ++DK++L+RQTGLS+ QVSNWFINARVRLWKPMV
Sbjct  289  VLILRAWLFEHFLHPYPKDSDKIMLARQTGLSRGQVSNWFINARVRLWKPMV  340



>ref|XP_011048824.1| PREDICTED: BEL1-like homeodomain protein 11 [Populus euphratica]
 ref|XP_011048825.1| PREDICTED: BEL1-like homeodomain protein 11 [Populus euphratica]
 ref|XP_011048826.1| PREDICTED: BEL1-like homeodomain protein 11 [Populus euphratica]
Length=466

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V +LRSWLFEHFL+PYP+E++K++L+ QTGL+KNQVSNWFINARVRLWKPM+
Sbjct  380  VAILRSWLFEHFLHPYPNESEKLMLASQTGLTKNQVSNWFINARVRLWKPMI  431



>ref|XP_009136305.1| PREDICTED: BEL1-like homeodomain protein 7 [Brassica rapa]
 ref|XP_009136306.1| PREDICTED: BEL1-like homeodomain protein 7 [Brassica rapa]
Length=450

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V +LR+WLFEHFL+PYP ++DK++L+RQTGLS+ QVSNWFINARVRLWKPMV
Sbjct  289  VLILRAWLFEHFLHPYPKDSDKIMLARQTGLSRGQVSNWFINARVRLWKPMV  340



>ref|XP_011037163.1| PREDICTED: BEL1-like homeodomain protein 6 [Populus euphratica]
Length=678

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP ++DK++L+RQTGL+++QVSNWFINARVRLWKPMV
Sbjct  411  VSILRAWLFEHFLHPYPKDSDKIMLARQTGLTRSQVSNWFINARVRLWKPMV  462



>gb|KJB79130.1| hypothetical protein B456_013G034600 [Gossypium raimondii]
 gb|KJB79131.1| hypothetical protein B456_013G034600 [Gossypium raimondii]
Length=626

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP ++DK++L+RQTGL+++QVSNWFINARVRLWKPMV
Sbjct  365  VSILRAWLFEHFLHPYPKDSDKIMLARQTGLTRSQVSNWFINARVRLWKPMV  416



>gb|AFW65587.1| putative POX domain/homeobox DNA-binding domain family protein 
[Zea mays]
Length=635

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP ++DK++L++QTGL+++QVSNWFINARVRLWKPMV
Sbjct  334  VSILRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARVRLWKPMV  385



>ref|XP_007047071.1| BEL1-like homeodomain protein 2 isoform 2 [Theobroma cacao]
 gb|EOX91228.1| BEL1-like homeodomain protein 2 isoform 2 [Theobroma cacao]
Length=825

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 51/53 (96%), Gaps = 1/53 (2%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQ-VSNWFINARVRLWKPMV  532
            VN+LR+WLFEHFL+PYPS+ADK LL+RQTGLS+NQ VSNWFINARVRLWKPMV
Sbjct  564  VNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVVSNWFINARVRLWKPMV  616



>ref|XP_008679683.1| PREDICTED: BEL1-like homeodomain protein 1 [Zea mays]
 ref|XP_008679684.1| PREDICTED: BEL1-like homeodomain protein 1 [Zea mays]
 ref|XP_008679685.1| PREDICTED: BEL1-like homeodomain protein 1 [Zea mays]
 gb|AFW65581.1| putative POX domain/homeobox DNA-binding domain family protein 
isoform 1 [Zea mays]
 gb|AFW65582.1| putative POX domain/homeobox DNA-binding domain family protein 
isoform 2 [Zea mays]
 gb|AFW65583.1| putative POX domain/homeobox DNA-binding domain family protein 
isoform 3 [Zea mays]
 gb|AFW65584.1| putative POX domain/homeobox DNA-binding domain family protein 
isoform 4 [Zea mays]
 gb|AFW65585.1| putative POX domain/homeobox DNA-binding domain family protein 
isoform 5 [Zea mays]
 gb|AFW65586.1| putative POX domain/homeobox DNA-binding domain family protein 
isoform 6 [Zea mays]
Length=671

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP ++DK++L++QTGL+++QVSNWFINARVRLWKPMV
Sbjct  370  VSILRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARVRLWKPMV  421



>ref|XP_004985591.1| PREDICTED: BEL1-like homeodomain protein 7-like isoform X1 [Setaria 
italica]
 ref|XP_004985592.1| PREDICTED: BEL1-like homeodomain protein 7-like isoform X2 [Setaria 
italica]
 ref|XP_004985593.1| PREDICTED: BEL1-like homeodomain protein 7-like isoform X3 [Setaria 
italica]
 ref|XP_004985594.1| PREDICTED: BEL1-like homeodomain protein 7-like isoform X4 [Setaria 
italica]
Length=561

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP +++K++L+RQTGLS+ QVSNWFINARVRLWKPM+
Sbjct  334  VSVLRAWLFEHFLHPYPKDSEKLMLARQTGLSRGQVSNWFINARVRLWKPMI  385



>ref|NP_001168681.1| putative POX domain/homeobox DNA-binding domain family protein 
[Zea mays]
 gb|ACN29175.1| unknown [Zea mays]
 gb|AFW81703.1| putative POX domain/homeobox DNA-binding domain family protein 
[Zea mays]
 gb|AIB05583.1| HB transcription factor, partial [Zea mays]
Length=549

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLRSWLFEHFL+PYP+++DK +L++QTGL++NQVSNWFINARVRLWKPMV
Sbjct  326  VSVLRSWLFEHFLHPYPTDSDKQMLAKQTGLTRNQVSNWFINARVRLWKPMV  377



>gb|KHN21192.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=584

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 65/80 (81%), Gaps = 5/80 (6%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            V+VLR+WLFEHFL+PYP ++DKV+L++QTGL+++QVSNWFINARVRLWKPMVEEMY +E 
Sbjct  278  VSVLRAWLFEHFLHPYPKDSDKVMLAKQTGLTRSQVSNWFINARVRLWKPMVEEMYLEEV  337

Query  507  keeENAQTPMPRDDDDDNSK  448
                  Q P     D++N+K
Sbjct  338  -----KQEPNNSSQDNNNTK  352



>ref|XP_004156658.1| PREDICTED: BEL1-like homeodomain protein 9-like [Cucumis sativus]
Length=288

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V VLR+WLFEHFL+PYPS+ DK++L++QTGLS++QVSNWFINARVRLWKPMV
Sbjct  77   VTVLRAWLFEHFLHPYPSDTDKLMLAKQTGLSRSQVSNWFINARVRLWKPMV  128



>gb|ACD39467.1| BEL30 protein [Solanum palustre]
Length=645

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP ++DK++L+RQTGL+++QVSNWFINARVRLWKPMV
Sbjct  403  VSVLRAWLFEHFLHPYPKDSDKIMLARQTGLTRSQVSNWFINARVRLWKPMV  454



>ref|XP_010428564.1| PREDICTED: BEL1-like homeodomain protein 11 [Camelina sativa]
Length=288

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            V +LR+WLF+HFL+PYP+EA+K++L+ QTGLSKNQVSNWFINARVRLWKPM+        
Sbjct  212  VAILRAWLFQHFLHPYPNEAEKLVLASQTGLSKNQVSNWFINARVRLWKPMI--EEMYRE  269

Query  507  keeENAQTPMPRDDDDDN  454
            +  +++   M R+ +DD+
Sbjct  270  EFGDSSDESMQREANDDS  287



>ref|XP_002889025.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65284.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=290

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 58/81 (72%), Gaps = 15/81 (19%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            V +LR+WLF+HFL+PYP+EA+K++L+ QTGLSKNQVSNWFINARVRLWKPM+        
Sbjct  214  VAILRAWLFQHFLHPYPNEAEKLVLASQTGLSKNQVSNWFINARVRLWKPMI--------  265

Query  507  keeENAQTPMPRDDDDDNSKE  445
                     M RD+  D+S E
Sbjct  266  -------EEMYRDEFGDSSDE  279



>ref|XP_002306123.2| hypothetical protein POPTR_0004s16660g [Populus trichocarpa]
 gb|EEE86634.2| hypothetical protein POPTR_0004s16660g [Populus trichocarpa]
Length=605

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP ++DK++L+RQTGL+++QVSNWFINARVRLWKPMV
Sbjct  392  VSILRAWLFEHFLHPYPKDSDKIMLARQTGLTRSQVSNWFINARVRLWKPMV  443



>gb|EYU37829.1| hypothetical protein MIMGU_mgv1a003764mg [Erythranthe guttata]
Length=565

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP ++DK++L+RQTGL+++QVSNWFINARVRLWKPMV
Sbjct  342  VSILRAWLFEHFLHPYPKDSDKIMLARQTGLTRSQVSNWFINARVRLWKPMV  393



>ref|XP_009761066.1| PREDICTED: BEL1-like homeodomain protein 11 isoform X2 [Nicotiana 
sylvestris]
Length=291

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V +LRSWLFEHFL+PYP++++K++L+ QTGLSKNQVSNWFINARVRLWKPM+
Sbjct  210  VAILRSWLFEHFLHPYPNDSEKLMLASQTGLSKNQVSNWFINARVRLWKPMI  261



>dbj|BAJ34230.1| unnamed protein product [Thellungiella halophila]
Length=455

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V +LR+WLFEHFL+PYP ++DK++L+RQTGLS+ QVSNWFINARVRLWKPMV
Sbjct  248  VLILRAWLFEHFLHPYPKDSDKIMLARQTGLSRGQVSNWFINARVRLWKPMV  299



>gb|KEH36201.1| BEL1-related homeotic protein [Medicago truncatula]
Length=517

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFLNPYP +++K++L+RQTGL++NQV+NWFINARVRLWKPMV
Sbjct  357  VSILRAWLFEHFLNPYPKDSEKIMLARQTGLTRNQVANWFINARVRLWKPMV  408



>gb|AFV13862.1| replumless-like protein RPL, partial [Cakile lanceolata]
Length=171

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V VLR+WLF+HFL+PYP++ DK++L++QTGLS+NQVSNWFINARVR+WKPMV
Sbjct  117  VTVLRAWLFDHFLHPYPTDTDKLMLAKQTGLSRNQVSNWFINARVRVWKPMV  168



>gb|EEE52807.1| hypothetical protein OsJ_35304 [Oryza sativa Japonica Group]
Length=591

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP ++DKV+L++QTGL+++QVSNWFINARVRLWKPMV
Sbjct  303  VSVLRAWLFEHFLHPYPKDSDKVMLAKQTGLTRSQVSNWFINARVRLWKPMV  354



>ref|XP_010416425.1| PREDICTED: BEL1-like homeodomain protein 11 [Camelina sativa]
Length=291

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVeemyeqet  508
            V +LR+WLF+HFL+PYP+EA+K++L+ QTGLSKNQVSNWFINARVRLWKPM+        
Sbjct  215  VAILRAWLFQHFLHPYPNEAEKLVLASQTGLSKNQVSNWFINARVRLWKPMI--EEMYRE  272

Query  507  keeENAQTPMPRDDDDDN  454
            +  +++   M R+ +DD+
Sbjct  273  EFGDSSDESMQREANDDS  290



>tpg|DAA43547.1| TPA: putative POX domain/homeobox DNA-binding domain family protein 
isoform 1 [Zea mays]
 tpg|DAA43548.1| TPA: putative POX domain/homeobox DNA-binding domain family protein 
isoform 2 [Zea mays]
 tpg|DAA43549.1| TPA: putative POX domain/homeobox DNA-binding domain family protein 
isoform 3 [Zea mays]
 tpg|DAA43550.1| TPA: putative POX domain/homeobox DNA-binding domain family protein 
isoform 4 [Zea mays]
 gb|AIB05988.1| HB transcription factor, partial [Zea mays]
Length=587

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V+VLR+WLFEHFL+PYP +++K++L+RQTGLS+ QVSNWFINARVRLWKPM+
Sbjct  346  VSVLRAWLFEHFLHPYPKDSEKLMLARQTGLSRGQVSNWFINARVRLWKPMI  397



>ref|XP_007042091.1| BEL1-like homeodomain protein 6 isoform 1 [Theobroma cacao]
 ref|XP_007042092.1| BEL1-like homeodomain protein 6 isoform 1 [Theobroma cacao]
 gb|EOX97922.1| BEL1-like homeodomain protein 6 isoform 1 [Theobroma cacao]
 gb|EOX97923.1| BEL1-like homeodomain protein 6 isoform 1 [Theobroma cacao]
Length=680

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  VNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV  532
            V++LR+WLFEHFL+PYP ++DK++L+RQTGL+++QVSNWFINARVRLWKPMV
Sbjct  413  VSILRAWLFEHFLHPYPKDSDKIMLARQTGLTRSQVSNWFINARVRLWKPMV  464



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1144913349700