BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF023J01

Length=644
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783807.1|  PREDICTED: 60S ribosomal protein L18-2-like        319   2e-107   Nicotiana sylvestris
ref|XP_009625475.1|  PREDICTED: 60S ribosomal protein L18-2-like        318   3e-107   Nicotiana tomentosiformis
ref|XP_009629074.1|  PREDICTED: 60S ribosomal protein L18-2             317   6e-107   Nicotiana tomentosiformis
ref|XP_009630920.1|  PREDICTED: 60S ribosomal protein L18-2-like        317   9e-107   Nicotiana tomentosiformis
gb|KDP28183.1|  hypothetical protein JCGZ_13954                         316   2e-106   Jatropha curcas
ref|XP_009772706.1|  PREDICTED: 60S ribosomal protein L18-2-like        314   1e-105   Nicotiana sylvestris
gb|KJB41867.1|  hypothetical protein B456_007G127300                    313   3e-105   Gossypium raimondii
ref|XP_009796134.1|  PREDICTED: 60S ribosomal protein L18-2-like        313   4e-105   Nicotiana sylvestris
ref|XP_008450608.1|  PREDICTED: 60S ribosomal protein L18-2             313   4e-105   Cucumis melo [Oriental melon]
gb|KJB41866.1|  hypothetical protein B456_007G127300                    314   5e-105   Gossypium raimondii
ref|XP_002301485.1|  60S ribosomal protein L18                          313   5e-105   Populus trichocarpa [western balsam poplar]
gb|KGN66048.1|  hypothetical protein Csa_1G569250                       314   7e-105   Cucumis sativus [cucumbers]
ref|XP_007031040.1|  Ribosomal protein L18                              312   9e-105   Theobroma cacao [chocolate]
gb|KJB45330.1|  hypothetical protein B456_007G301700                    312   1e-104   Gossypium raimondii
ref|XP_006344694.1|  PREDICTED: 60S ribosomal protein L18-2-like        311   1e-104   Solanum tuberosum [potatoes]
ref|XP_010025256.1|  PREDICTED: 60S ribosomal protein L18-2             311   1e-104   Eucalyptus grandis [rose gum]
ref|NP_001237789.1|  uncharacterized protein LOC100500164               311   1e-104   Glycine max [soybeans]
ref|XP_010088293.1|  60S ribosomal protein L18-3                        311   3e-104   
ref|XP_011036896.1|  PREDICTED: 60S ribosomal protein L18-2             310   4e-104   Populus euphratica
ref|XP_006382454.1|  60S ribosomal protein L18                          310   4e-104   Populus trichocarpa [western balsam poplar]
ref|XP_002523106.1|  60S ribosomal protein L18, putative                310   5e-104   Ricinus communis
gb|KHN43503.1|  60S ribosomal protein L18-2                             310   5e-104   Glycine soja [wild soybean]
ref|XP_010313195.1|  PREDICTED: 60S ribosomal protein L18-2-like        310   6e-104   Solanum lycopersicum
ref|XP_006359857.1|  PREDICTED: 60S ribosomal protein L18-2-like        310   6e-104   Solanum tuberosum [potatoes]
ref|XP_008454015.1|  PREDICTED: 60S ribosomal protein L18-3             310   6e-104   Cucumis melo [Oriental melon]
gb|KJB82632.1|  hypothetical protein B456_013G206100                    310   7e-104   Gossypium raimondii
ref|XP_004144773.1|  PREDICTED: 60S ribosomal protein L18-3-like        310   7e-104   Cucumis sativus [cucumbers]
ref|XP_007050974.1|  Ribosomal protein L18 isoform 1                    310   7e-104   Theobroma cacao [chocolate]
gb|KJB23303.1|  hypothetical protein B456_004G091200                    310   8e-104   Gossypium raimondii
ref|XP_011042004.1|  PREDICTED: 60S ribosomal protein L18-2-like        310   8e-104   Populus euphratica
gb|KHN20393.1|  60S ribosomal protein L18-2                             313   9e-104   Glycine soja [wild soybean]
ref|XP_002320999.1|  60S ribosomal protein L18                          309   1e-103   Populus trichocarpa [western balsam poplar]
gb|KHF98574.1|  60S ribosomal L18-2 -like protein                       309   2e-103   Gossypium arboreum [tree cotton]
ref|XP_006433453.1|  hypothetical protein CICLE_v10002597mg             309   2e-103   Citrus clementina [clementine]
ref|NP_001236701.1|  uncharacterized protein LOC100306301               309   2e-103   
ref|XP_010528904.1|  PREDICTED: 60S ribosomal protein L18-2             308   3e-103   Tarenaya hassleriana [spider flower]
ref|NP_001236071.1|  uncharacterized protein LOC100499789               308   3e-103   Glycine max [soybeans]
ref|XP_004135776.1|  PREDICTED: uncharacterized protein LOC101207642    315   3e-103   
ref|XP_003556523.1|  PREDICTED: 60S ribosomal protein L18-2-like        308   3e-103   Glycine max [soybeans]
ref|XP_010094463.1|  60S ribosomal protein L18-2                        308   4e-103   
gb|KHN20252.1|  60S ribosomal protein L18-3                             308   4e-103   Glycine soja [wild soybean]
ref|XP_007163123.1|  hypothetical protein PHAVU_001G208200g             308   5e-103   Phaseolus vulgaris [French bean]
ref|XP_009630742.1|  PREDICTED: 60S ribosomal protein L18-2-like        307   6e-103   Nicotiana tomentosiformis
ref|XP_010104147.1|  60S ribosomal protein L18-2                        308   7e-103   
gb|KDP23459.1|  hypothetical protein JCGZ_23292                         307   8e-103   Jatropha curcas
ref|XP_010043043.1|  PREDICTED: 60S ribosomal protein L18-2             307   8e-103   Eucalyptus grandis [rose gum]
gb|KHG07157.1|  60S ribosomal L18-2 -like protein                       307   2e-102   Gossypium arboreum [tree cotton]
ref|XP_010659657.1|  PREDICTED: 60S ribosomal protein L18-2-like        305   3e-102   Vitis vinifera
ref|XP_004495692.1|  PREDICTED: 60S ribosomal protein L18-like          305   3e-102   Cicer arietinum [garbanzo]
gb|KHN03962.1|  60S ribosomal protein L18-2                             305   6e-102   Glycine soja [wild soybean]
ref|XP_010546736.1|  PREDICTED: 60S ribosomal protein L18-3             305   7e-102   Tarenaya hassleriana [spider flower]
ref|XP_010544997.1|  PREDICTED: 60S ribosomal protein L18-2-like        304   1e-101   Tarenaya hassleriana [spider flower]
ref|XP_002319502.1|  60S ribosomal protein L18                          304   1e-101   Populus trichocarpa [western balsam poplar]
ref|XP_002270635.1|  PREDICTED: 60S ribosomal protein L18-2             304   1e-101   Vitis vinifera
emb|CDP17112.1|  unnamed protein product                                305   2e-101   Coffea canephora [robusta coffee]
emb|CDO98841.1|  unnamed protein product                                305   2e-101   Coffea canephora [robusta coffee]
ref|XP_003554636.2|  PREDICTED: 60S ribosomal protein L18-2-like        304   2e-101   Glycine max [soybeans]
gb|AFK49563.1|  unknown                                                 303   3e-101   Lotus japonicus
ref|XP_007144959.1|  hypothetical protein PHAVU_007G197900g             303   3e-101   Phaseolus vulgaris [French bean]
ref|XP_010559185.1|  PREDICTED: 60S ribosomal protein L18-2-like        303   3e-101   Tarenaya hassleriana [spider flower]
ref|XP_010523956.1|  PREDICTED: 60S ribosomal protein L18-2-like        303   3e-101   Tarenaya hassleriana [spider flower]
ref|XP_008386678.1|  PREDICTED: 60S ribosomal protein L18-2-like        303   4e-101   
ref|XP_007050976.1|  Ribosomal protein L18 isoform 3                    303   5e-101   
emb|CBI39539.3|  unnamed protein product                                305   6e-101   Vitis vinifera
ref|XP_011023716.1|  PREDICTED: 60S ribosomal protein L18-2             302   7e-101   Populus euphratica
ref|XP_010931680.1|  PREDICTED: 60S ribosomal protein L18-2             302   7e-101   Elaeis guineensis
ref|XP_009338229.1|  PREDICTED: 60S ribosomal protein L18-2-like        302   8e-101   Pyrus x bretschneideri [bai li]
gb|ABK92688.1|  unknown                                                 302   8e-101   Populus trichocarpa [western balsam poplar]
ref|XP_008388515.1|  PREDICTED: 60S ribosomal protein L18-2-like        302   1e-100   Malus domestica [apple tree]
ref|XP_007147006.1|  hypothetical protein PHAVU_006G088800g             301   1e-100   Phaseolus vulgaris [French bean]
ref|XP_006444385.1|  hypothetical protein CICLE_v10022435mg             301   1e-100   Citrus clementina [clementine]
ref|XP_009335702.1|  PREDICTED: 60S ribosomal protein L18-2             301   2e-100   Pyrus x bretschneideri [bai li]
ref|XP_010684349.1|  PREDICTED: 60S ribosomal protein L18-2-like        301   2e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007201344.1|  hypothetical protein PRUPE_ppa012001mg             301   2e-100   Prunus persica
ref|XP_010674074.1|  PREDICTED: 60S ribosomal protein L18-2             301   2e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008370417.1|  PREDICTED: 60S ribosomal protein L18-2             301   2e-100   Malus domestica [apple tree]
ref|XP_006386732.1|  hypothetical protein POPTR_0002s20400g             301   2e-100   
ref|XP_007205962.1|  hypothetical protein PRUPE_ppa012012mg             301   3e-100   Prunus persica
ref|XP_008369026.1|  PREDICTED: 60S ribosomal protein L18-2             301   3e-100   
emb|CBI22977.3|  unnamed protein product                                303   3e-100   Vitis vinifera
ref|XP_009134833.1|  PREDICTED: 60S ribosomal protein L18-2             300   4e-100   Brassica rapa
ref|NP_187210.1|  60S ribosomal protein L18-2                           300   5e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010259492.1|  PREDICTED: 60S ribosomal protein L18-3             300   5e-100   Nelumbo nucifera [Indian lotus]
ref|XP_010938374.1|  PREDICTED: 60S ribosomal protein L18-2-like        300   6e-100   Elaeis guineensis
ref|XP_008775991.1|  PREDICTED: 60S ribosomal protein L18-2             299   9e-100   Phoenix dactylifera
emb|CDX74138.1|  BnaA03g29090D                                          300   1e-99    
ref|NP_001235897.1|  uncharacterized protein LOC100527681               299   1e-99    
ref|XP_002271179.1|  PREDICTED: 60S ribosomal protein L18-2             299   1e-99    Vitis vinifera
gb|AAA69928.1|  cytoplasmic ribosomal protein L18                       299   1e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011079632.1|  PREDICTED: 60S ribosomal protein L18-2             299   1e-99    Sesamum indicum [beniseed]
ref|XP_011079633.1|  PREDICTED: 60S ribosomal protein L18-2-like        298   2e-99    Sesamum indicum [beniseed]
ref|XP_009402513.1|  PREDICTED: 60S ribosomal protein L18-2-like        298   2e-99    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB82634.1|  hypothetical protein B456_013G206100                    298   3e-99    Gossypium raimondii
ref|XP_002882427.1|  hypothetical protein ARALYDRAFT_477850             298   3e-99    Arabidopsis lyrata subsp. lyrata
ref|XP_004984437.1|  PREDICTED: 60S ribosomal protein L18-2-like        298   3e-99    
ref|XP_010273829.1|  PREDICTED: 60S ribosomal protein L18-2-like        298   3e-99    Nelumbo nucifera [Indian lotus]
gb|KFK26512.1|  hypothetical protein AALP_AA8G258600                    298   3e-99    Arabis alpina [alpine rockcress]
ref|XP_009417724.1|  PREDICTED: 60S ribosomal protein L18-2             298   4e-99    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY18813.1|  BnaAnng02780D                                          300   5e-99    Brassica napus [oilseed rape]
ref|XP_009384409.1|  PREDICTED: 60S ribosomal protein L18-2             297   5e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002465302.1|  hypothetical protein SORBIDRAFT_01g035860          297   5e-99    Sorghum bicolor [broomcorn]
ref|XP_002512455.1|  60S ribosomal protein L18, putative                305   5e-99    
ref|XP_009124870.1|  PREDICTED: 60S ribosomal protein L18-2-like        297   5e-99    Brassica rapa
ref|XP_004494383.1|  PREDICTED: 60S ribosomal protein L18-like          296   9e-99    Cicer arietinum [garbanzo]
ref|XP_009411663.1|  PREDICTED: 60S ribosomal protein L18-3-like        296   1e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008810211.1|  PREDICTED: 60S ribosomal protein L18-2-like        296   1e-98    Phoenix dactylifera
ref|XP_002874343.1|  60S ribosomal protein L18                          296   2e-98    Arabidopsis lyrata subsp. lyrata
ref|XP_010914484.1|  PREDICTED: 60S ribosomal protein L18-3             296   2e-98    Elaeis guineensis
emb|CDY40718.1|  BnaC03g34340D                                          297   2e-98    Brassica napus [oilseed rape]
ref|XP_002461201.1|  hypothetical protein SORBIDRAFT_02g042750          296   2e-98    Sorghum bicolor [broomcorn]
ref|XP_008784768.1|  PREDICTED: 60S ribosomal protein L18-2-like        295   3e-98    Phoenix dactylifera
ref|NP_198137.1|  60S ribosomal protein L18-3                           295   3e-98    Arabidopsis thaliana [mouse-ear cress]
emb|CBI36879.3|  unnamed protein product                                299   3e-98    Vitis vinifera
gb|AFK45456.1|  unknown                                                 295   3e-98    Lotus japonicus
ref|XP_009151179.1|  PREDICTED: 60S ribosomal protein L18-2             295   4e-98    Brassica rapa
emb|CDY66803.1|  BnaAnng22990D                                          295   6e-98    Brassica napus [oilseed rape]
ref|XP_006408052.1|  hypothetical protein EUTSA_v10021598mg             295   7e-98    Eutrema salsugineum [saltwater cress]
gb|EMS45435.1|  60S ribosomal protein L18-2                             294   8e-98    Triticum urartu
ref|XP_010269589.1|  PREDICTED: 60S ribosomal protein L18-3             294   1e-97    Nelumbo nucifera [Indian lotus]
ref|XP_009129884.1|  PREDICTED: 60S ribosomal protein L18-2-like        295   2e-97    Brassica rapa
ref|XP_009111741.1|  PREDICTED: 60S ribosomal protein L18-2-like        293   2e-97    Brassica rapa
emb|CDY19736.1|  BnaA09g03890D                                          294   2e-97    Brassica napus [oilseed rape]
ref|XP_006298640.1|  hypothetical protein CARUB_v10014730mg             293   2e-97    Capsella rubella
ref|XP_010429374.1|  PREDICTED: 60S ribosomal protein L18-3-like        293   2e-97    Camelina sativa [gold-of-pleasure]
ref|NP_001131538.1|  uncharacterized protein LOC100192878               293   3e-97    Zea mays [maize]
ref|XP_010486014.1|  PREDICTED: 60S ribosomal protein L18-3             293   3e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010464086.1|  PREDICTED: 60S ribosomal protein L18-3-like        293   4e-97    Camelina sativa [gold-of-pleasure]
ref|XP_009381102.1|  PREDICTED: 60S ribosomal protein L18-2-like        293   4e-97    
emb|CDX99969.1|  BnaC09g03320D                                          293   4e-97    
ref|XP_006855263.1|  hypothetical protein AMTR_s00183p00048560          292   4e-97    Amborella trichopoda
gb|EMT12638.1|  60S ribosomal protein L18-2                             292   7e-97    
ref|XP_004494578.1|  PREDICTED: 60S ribosomal protein L18-like          292   8e-97    
ref|XP_006394935.1|  hypothetical protein EUTSA_v10004865mg             293   1e-96    
ref|XP_006288739.1|  hypothetical protein CARUB_v10002048mg             290   3e-96    Capsella rubella
ref|XP_010455077.1|  PREDICTED: 60S ribosomal protein L18-3-like ...    290   4e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010421566.1|  PREDICTED: 60S ribosomal protein L18-2-like        290   4e-96    Camelina sativa [gold-of-pleasure]
ref|XP_007050975.1|  Ribosomal protein L18 isoform 2                    290   4e-96    
gb|KFK37967.1|  hypothetical protein AALP_AA3G053100                    290   6e-96    Arabis alpina [alpine rockcress]
ref|XP_003562459.1|  PREDICTED: 60S ribosomal protein L18-3-like        289   7e-96    
emb|CDX80616.1|  BnaC07g28280D                                          291   8e-96    
emb|CDY25018.1|  BnaC02g39900D                                          289   1e-95    Brassica napus [oilseed rape]
ref|NP_001050069.1|  Os03g0341100                                       288   2e-95    
ref|XP_010228645.1|  PREDICTED: 60S ribosomal protein L18-2-like        288   2e-95    Brachypodium distachyon [annual false brome]
ref|XP_004958675.1|  PREDICTED: 60S ribosomal protein L18-3-like        288   2e-95    Setaria italica
gb|AFC88843.1|  60S ribosomal protein L18-3-like protein                286   5e-95    Miscanthus sinensis
gb|ABK26318.1|  unknown                                                 287   5e-95    Picea sitchensis
ref|XP_006650060.1|  PREDICTED: 60S ribosomal protein L18-3-like        286   9e-95    Oryza brachyantha
ref|XP_009629121.1|  PREDICTED: 60S ribosomal protein L18-2             286   2e-94    Nicotiana tomentosiformis
ref|XP_010921627.1|  PREDICTED: uncharacterized protein LOC105045157    293   2e-94    
gb|ABK21809.1|  unknown                                                 285   3e-94    Picea sitchensis
ref|XP_004247404.1|  PREDICTED: 60S ribosomal protein L18-2             285   4e-94    Solanum lycopersicum
ref|NP_001132852.1|  uncharacterized protein LOC100194344               285   4e-94    Zea mays [maize]
ref|XP_003591163.1|  Ribosomal protein L18                              285   4e-94    Medicago truncatula
ref|XP_008656150.1|  PREDICTED: 60S ribosomal protein L18-3-like        286   6e-94    
emb|CDY05183.1|  BnaC05g46200D                                          285   8e-94    
gb|ADD54595.1|  putative ribosomal protein L18                          283   8e-94    Linum usitatissimum
gb|EPS67068.1|  hypothetical protein M569_07709                         284   9e-94    Genlisea aurea
emb|CDY05559.1|  BnaA02g31320D                                          295   1e-93    
ref|XP_006658116.1|  PREDICTED: 60S ribosomal protein L18-3-like        284   1e-93    Oryza brachyantha
ref|XP_002439318.1|  hypothetical protein SORBIDRAFT_09g004290          283   1e-93    Sorghum bicolor [broomcorn]
gb|AFC88838.1|  60S ribosomal protein L18-like protein                  283   2e-93    Miscanthus sinensis
gb|EMT18368.1|  60S ribosomal protein L18-2                             283   2e-93    
ref|XP_010524859.1|  PREDICTED: 60S ribosomal protein L18-3             283   2e-93    Tarenaya hassleriana [spider flower]
dbj|BAJ90421.1|  predicted protein                                      283   2e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK22247.1|  unknown                                                 282   7e-93    Picea sitchensis
pdb|3J61|Q  Chain Q, Localization Of The Large Subunit Ribosomal ...    281   9e-93    Triticum aestivum [Canadian hard winter wheat]
ref|XP_003626231.1|  60S ribosomal protein L18                          281   1e-92    Medicago truncatula
gb|AGV54741.1|  60S ribosomal protein L18-3-like protein                283   1e-92    Phaseolus vulgaris [French bean]
ref|XP_006654064.1|  PREDICTED: 60S ribosomal protein L18-2-like        281   2e-92    Oryza brachyantha
ref|XP_010550997.1|  PREDICTED: 60S ribosomal protein L18-3-like ...    281   2e-92    Tarenaya hassleriana [spider flower]
ref|XP_003568896.1|  PREDICTED: 60S ribosomal protein L18-2-like        280   3e-92    Brachypodium distachyon [annual false brome]
ref|XP_004977069.1|  PREDICTED: 60S ribosomal protein L18-2-like        280   4e-92    Setaria italica
ref|NP_001060617.1|  Os07g0674700                                       280   6e-92    
gb|EMS65848.1|  60S ribosomal protein L18-2                             281   8e-92    Triticum urartu
ref|NP_001054688.1|  Os05g0155100                                       278   1e-91    
ref|XP_009611670.1|  PREDICTED: 60S ribosomal protein L18-2-like        278   2e-91    Nicotiana tomentosiformis
ref|XP_001781485.1|  predicted protein                                  278   2e-91    
gb|KEH24393.1|  60S ribosomal protein L18-3                             278   2e-91    Medicago truncatula
ref|XP_001760902.1|  predicted protein                                  277   4e-91    
gb|AFK34017.1|  unknown                                                 276   7e-91    Medicago truncatula
ref|XP_008789961.1|  PREDICTED: uncharacterized protein LOC103707302    298   7e-91    
dbj|BAJ93091.1|  predicted protein                                      277   8e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001751734.1|  predicted protein                                  276   1e-90    
gb|EYU46738.1|  hypothetical protein MIMGU_mgv1a014520mg                275   2e-90    Erythranthe guttata [common monkey flower]
gb|KIZ05100.1|  60S ribosomal protein L18-3                             275   4e-90    Monoraphidium neglectum
sp|O65729.1|RL18_CICAR  RecName: Full=60S ribosomal protein L18         274   7e-90    Cicer arietinum [garbanzo]
ref|XP_004290808.1|  PREDICTED: 60S ribosomal protein L18-2             271   1e-88    Fragaria vesca subsp. vesca
emb|CEF99132.1|  Ribosomal protein L18e, conserved site                 271   1e-88    Ostreococcus tauri
ref|XP_001785869.1|  predicted protein                                  268   3e-87    
ref|XP_001690885.1|  ribosomal protein L18, component of cytosoli...    266   8e-87    Chlamydomonas reinhardtii
ref|XP_002948325.1|  component of cytosolic 80S ribosome and 60S ...    265   3e-86    Volvox carteri f. nagariensis
ref|XP_005843726.1|  hypothetical protein CHLNCDRAFT_37334              265   3e-86    Chlorella variabilis
ref|XP_001419602.1|  Ribosomal protein L18, component of cytosoli...    265   3e-86    Ostreococcus lucimarinus CCE9901
ref|XP_001760959.1|  predicted protein                                  265   4e-86    
ref|XP_002985888.1|  hypothetical protein SELMODRAFT_181978             263   1e-85    Selaginella moellendorffii
ref|XP_002976425.1|  hypothetical protein SELMODRAFT_267976             263   1e-85    Selaginella moellendorffii
ref|XP_007510670.1|  predicted protein                                  265   2e-85    Bathycoccus prasinos
gb|EYU21621.1|  hypothetical protein MIMGU_mgv1a014504mg                262   4e-85    Erythranthe guttata [common monkey flower]
gb|ACJ85943.1|  unknown                                                 259   2e-84    Medicago truncatula
sp|O22254.3|RL181_ARATH  RecName: Full=Putative 60S ribosomal pro...    259   8e-84    Arabidopsis thaliana [mouse-ear cress]
gb|KFK32338.1|  hypothetical protein AALP_AA6G228700                    258   3e-83    Arabis alpina [alpine rockcress]
ref|XP_003081305.1|  ribosomal protein L18 (ISS)                        254   4e-82    
ref|XP_005643635.1|  ribosomal protein L18 component of cytosolic...    254   5e-82    Coccomyxa subellipsoidea C-169
ref|XP_009775352.1|  PREDICTED: 60S ribosomal protein L18-2             251   4e-81    Nicotiana sylvestris
gb|KJB82633.1|  hypothetical protein B456_013G206100                    249   1e-80    Gossypium raimondii
gb|KJB23305.1|  hypothetical protein B456_004G091200                    248   1e-80    Gossypium raimondii
ref|XP_001745439.1|  hypothetical protein                               250   2e-80    Monosiga brevicollis MX1
ref|XP_010550998.1|  PREDICTED: 60S ribosomal protein L18-2-like ...    248   5e-80    Tarenaya hassleriana [spider flower]
gb|KJB22517.1|  hypothetical protein B456_004G052100                    247   5e-80    Gossypium raimondii
ref|XP_011255380.1|  PREDICTED: 60S ribosomal protein L18               248   1e-79    Camponotus floridanus
gb|AAO46881.1|  60S ribosomal protein                                   246   2e-79    Medicago sativa [alfalfa]
ref|XP_968042.1|  PREDICTED: 60S ribosomal protein L18                  247   3e-79    Tribolium castaneum [rust-red flour beetle]
ref|XP_011351685.1|  PREDICTED: 60S ribosomal protein L18               246   5e-79    Ooceraea biroi
ref|XP_001640445.1|  predicted protein                                  246   5e-79    Nematostella vectensis
ref|XP_006677675.1|  hypothetical protein BATDEDRAFT_87003              246   8e-79    Batrachochytrium dendrobatidis JAM81
ref|XP_003707499.1|  PREDICTED: 60S ribosomal protein L18-like          246   2e-78    
gb|ABR23470.1|  60s ribosomal protein L18                               245   2e-78    Ornithodoros parkeri
ref|XP_011135288.1|  PREDICTED: 60S ribosomal protein L18               245   2e-78    Harpegnathos saltator
gb|EFN87206.1|  60S ribosomal protein L18                               244   3e-78    Harpegnathos saltator
ref|XP_002400316.1|  ribosomal protein L18, putative                    244   3e-78    Ixodes scapularis [blacklegged tick]
ref|XP_003056676.1|  predicted protein                                  244   3e-78    Micromonas pusilla CCMP1545
ref|XP_006561192.1|  PREDICTED: 60S ribosomal protein L18-like          244   5e-78    Apis mellifera [bee]
ref|XP_003691391.1|  PREDICTED: 60S ribosomal protein L18-like          244   6e-78    Apis florea [dwarf honeybee]
gb|AAX48850.1|  L18                                                     244   6e-78    Suberites domuncula
ref|XP_004991895.1|  ribosomal protein l18                              243   8e-78    Salpingoeca rosetta
ref|XP_011497333.1|  PREDICTED: 60S ribosomal protein L18               243   1e-77    Ceratosolen solmsi marchali
gb|KDR14978.1|  60S ribosomal protein L18                               242   3e-77    Zootermopsis nevadensis
ref|XP_011062886.1|  PREDICTED: 60S ribosomal protein L18               243   4e-77    Acromyrmex echinatior
ref|XP_009012591.1|  hypothetical protein HELRODRAFT_156470             241   4e-77    Helobdella robusta
emb|CAJ17294.1|  ribosomal protein L18e                                 241   5e-77    Hister sp. APV-2005
emb|CBK21900.2|  Ribosomal protein L18e                                 241   5e-77    Blastocystis hominis
emb|CBK22442.2|  unnamed protein product                                241   6e-77    Blastocystis hominis
ref|XP_011351645.1|  PREDICTED: 60S ribosomal protein L18-like          241   7e-77    Ooceraea biroi
ref|XP_008546759.1|  PREDICTED: 60S ribosomal protein L18               241   9e-77    Microplitis demolitor
emb|CBK22327.2|  unnamed protein product                                241   1e-76    Blastocystis hominis
gb|AAN73381.1|  ribosomal protein L18                                   240   1e-76    Branchiostoma lanceolatum [common lancelet]
gb|KHG01788.1|  60S ribosomal L18-2 -like protein                       239   2e-76    Gossypium arboreum [tree cotton]
ref|XP_008201914.1|  PREDICTED: 60S ribosomal protein L18               240   2e-76    Nasonia vitripennis
ref|XP_002506220.1|  ribosomal protein L18                              246   2e-76    Micromonas commoda
ref|XP_004345091.2|  ribosomal protein L18e                             239   3e-76    Capsaspora owczarzaki ATCC 30864
gb|EFZ15690.1|  hypothetical protein SINV_04174                         239   4e-76    
gb|KJE95959.1|  ribosomal protein L18e                                  239   6e-76    Capsaspora owczarzaki ATCC 30864
ref|XP_003393579.1|  PREDICTED: hypothetical protein LOC100643724       246   8e-76    
ref|XP_003485273.1|  PREDICTED: hypothetical protein LOC100746406       245   1e-75    
gb|ABW90395.1|  putative ribosomal protein L18                          238   1e-75    Barentsia elongata
ref|XP_011313252.1|  PREDICTED: 60S ribosomal protein L18               238   1e-75    Fopius arisanus
ref|XP_011163555.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    239   2e-75    
gb|ACR35483.1|  unknown                                                 236   2e-75    Zea mays [maize]
sp|Q4GXG7.1|RL18_TIMBA  RecName: Full=60S ribosomal protein L18         237   2e-75    Timarcha balearica
ref|XP_002161036.1|  PREDICTED: 60S ribosomal protein L18-like          237   2e-75    
ref|XP_006298641.1|  hypothetical protein CARUB_v10014730mg             235   2e-75    
ref|XP_011396696.1|  60S ribosomal protein L18-3                        237   3e-75    Auxenochlorella protothecoides
emb|CAD91422.1|  ribosomal protein L18                                  236   6e-75    Crassostrea gigas
ref|XP_011449585.1|  PREDICTED: 60S ribosomal protein L18-like          236   6e-75    
gb|EKC43150.1|  60S ribosomal protein L18                               236   7e-75    Crassostrea gigas
gb|KJB26287.1|  hypothetical protein B456_004G239000                    237   1e-74    Gossypium raimondii
ref|XP_008547226.1|  PREDICTED: 60S ribosomal protein L18-like          235   1e-74    Microplitis demolitor
gb|ESA23412.1|  hypothetical protein GLOINDRAFT_342179                  235   1e-74    
ref|XP_002595537.1|  hypothetical protein BRAFLDRAFT_275280             235   2e-74    Branchiostoma floridae
sp|Q0PXY6.1|RL18_DIACI  RecName: Full=60S ribosomal protein L18         235   2e-74    Diaphorina citri
ref|XP_010455078.1|  PREDICTED: 60S ribosomal protein L18-2-like ...    232   5e-74    Camelina sativa [gold-of-pleasure]
gb|EPZ37075.1|  60S ribosomal protein L18-2                             233   6e-74    Rozella allomycis CSF55
ref|XP_005787945.1|  hypothetical protein EMIHUDRAFT_433854             233   7e-74    Emiliania huxleyi CCMP1516
dbj|BAN21088.1|  ribosomal protein L18                                  233   8e-74    Riptortus pedestris
gb|EFX65754.1|  hypothetical protein DAPPUDRAFT_303528                  233   8e-74    Daphnia pulex
emb|CBJ25909.1|  cytoplasmic ribosomal protein L18                      233   1e-73    Ectocarpus siliculosus
ref|XP_007143771.1|  hypothetical protein PHAVU_007G100200g             230   3e-73    Phaseolus vulgaris [French bean]
ref|XP_002733428.1|  PREDICTED: 60S ribosomal protein L18-like          231   5e-73    Saccoglossus kowalevskii
ref|XP_009036910.1|  hypothetical protein AURANDRAFT_37496              231   6e-73    Aureococcus anophagefferens
gb|ACN41161.1|  unknown                                                 229   7e-73    Picea sitchensis
ref|XP_002130217.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    231   9e-73    Ciona intestinalis [sea vase]
gb|AAW25981.1|  SJCHGC06655 protein                                     230   1e-72    Schistosoma japonicum
gb|ADV03016.1|  ribosomal protein L18                                   230   1e-72    Karlodinium veneficum
ref|XP_007722189.1|  large subunit ribosomal protein L18e               230   2e-72    Capronia coronata CBS 617.96
emb|CAX79061.1|  ribosomal protein L18                                  229   3e-72    Schistosoma japonicum
ref|XP_009158973.1|  50S ribosomal protein L18e                         229   3e-72    Exophiala dermatitidis NIH/UT8656
gb|ACF83096.1|  unknown                                                 227   3e-72    Zea mays [maize]
ref|XP_003385450.1|  PREDICTED: 60S ribosomal protein L18-like          229   4e-72    Amphimedon queenslandica
ref|XP_007779084.1|  60S ribosomal protein L18-B                        229   4e-72    Coniosporium apollinis CBS 100218
emb|CAX72134.1|  ribosomal protein L18                                  229   5e-72    
emb|CCD58684.1|  60S ribosomal protein L18, putative                    229   5e-72    
ref|XP_003977661.1|  PREDICTED: 60S ribosomal protein L18-like          229   5e-72    
ref|XP_009834317.1|  hypothetical protein H257_09702                    229   5e-72    
sp|Q56FG8.1|RL18_LYSTE  RecName: Full=60S ribosomal protein L18         228   7e-72    
gb|ACD65168.1|  putative 60S ribosomal protein RPL18                    227   1e-71    
ref|XP_002423194.1|  60S ribosomal protein L18, putative                228   1e-71    
emb|CBN08626.1|  ribosomal protein L18                                  228   1e-71    
ref|XP_003626232.1|  60S ribosomal protein L18                          226   1e-71    
ref|XP_008876054.1|  hypothetical protein H310_11242                    228   1e-71    
ref|XP_001209532.1|  60S ribosomal protein L18                          226   3e-71    
emb|CEI89354.1|  Putative 60S ribosomal protein L18-A                   227   3e-71    
gb|AEE61752.1|  unknown                                                 226   4e-71    
emb|CEG66137.1|  Putative 60S ribosomal protein L18-A                   226   4e-71    
ref|XP_001550924.1|  60S ribosomal protein L18                          226   4e-71    
ref|NP_648091.1|  ribosomal protein L18, isoform A                      226   5e-71    
ref|XP_008085192.1|  Ribosomal proteins L15p and L18e                   226   5e-71    
ref|XP_004526749.1|  PREDICTED: 60S ribosomal protein L18-like          226   6e-71    
gb|EMR82472.1|  putative 60s ribosomal protein l18 protein              226   6e-71    
ref|XP_005822438.1|  large subunit ribosomal protein L18e, cytopl...    226   7e-71    
gb|KIY03022.1|  60S ribosomal protein L18-A                             226   7e-71    
gb|KIW75160.1|  60S ribosomal protein L18-A                             226   7e-71    
gb|AGH70165.1|  60S ribosomal protein L18                               226   7e-71    
ref|XP_002047296.1|  GJ13360                                            225   1e-70    
ref|XP_005190752.1|  PREDICTED: 60S ribosomal protein L18               225   1e-70    
gb|KIW89279.1|  60S ribosomal protein L18-A                             225   1e-70    
ref|XP_007742086.1|  large subunit ribosomal protein L18e               225   1e-70    
gb|EYE97298.1|  ribosomal protein L18e                                  226   1e-70    
ref|XP_002035667.1|  GM13785                                            225   1e-70    
gb|EJD73862.1|  hypothetical protein, variant                           225   1e-70    
gb|KIV82136.1|  60S ribosomal protein L18-A                             225   2e-70    
ref|XP_008714847.1|  hypothetical protein HMPREF1541_02269              224   2e-70    
gb|KIN06517.1|  hypothetical protein OIDMADRAFT_24819                   224   2e-70    
gb|KIW11507.1|  60S ribosomal protein L18-A                             224   2e-70    
sp|Q4PM04.1|RL18_IXOSC  RecName: Full=60S ribosomal protein L18         224   2e-70    
gb|EPS29111.1|  hypothetical protein PDE_04060                          224   2e-70    
gb|KIW69267.1|  hypothetical protein PV04_05151                         224   2e-70    
ref|XP_002094010.1|  GE20435                                            224   2e-70    
emb|CEJ01696.1|  Putative 50S ribosomal protein L18e                    224   3e-70    
gb|KIW61527.1|  hypothetical protein PV05_01638                         224   3e-70    
ref|XP_007804599.1|  hypothetical protein EPUS_07572                    234   3e-70    
ref|XP_008607735.1|  60S ribosomal protein                              224   3e-70    
ref|XP_011184309.1|  PREDICTED: 60S ribosomal protein L18               224   4e-70    
gb|KDN61013.1|  putative eukaryotic ribosomal protein L18               224   4e-70    
gb|ADV03044.1|  ribosomal protein L18                                   224   4e-70    
ref|XP_010786834.1|  PREDICTED: 60S ribosomal protein L18               224   5e-70    
gb|ABZ04231.1|  ribosomal protein rpl18                                 224   5e-70    
ref|XP_001588139.1|  60S ribosomal protein L18                          223   5e-70    
gb|ELT99918.1|  hypothetical protein CAPTEDRAFT_159560                  223   6e-70    
gb|KIW43484.1|  60S ribosomal protein L18-B                             225   6e-70    
emb|CCU77907.1|  putative 60S ribosomal protein L18                     223   7e-70    
gb|KIW28110.1|  60S ribosomal protein L18-A                             223   7e-70    
ref|XP_008727056.1|  hypothetical protein G647_04492                    223   9e-70    
ref|XP_001971483.1|  GG14989                                            223   1e-69    
ref|XP_002109185.1|  expressed hypothetical protein                     223   1e-69    
dbj|GAA55611.1|  large subunit ribosomal protein L18e                   224   1e-69    
emb|CCQ18599.1|  60S ribosomal protein L18                              223   1e-69    
gb|EJW88057.1|  50S ribosomal protein L18                               223   1e-69    
ref|XP_009176548.1|  hypothetical protein T265_11593                    222   2e-69    
gb|EFQ34059.1|  eukaryotic ribosomal protein L18                        222   2e-69    
ref|XP_004358287.1|  eukaryotic ribosomal protein L18, putative         222   2e-69    
ref|XP_006735598.1|  PREDICTED: ribosomal protein L18-like              224   2e-69    
ref|XP_005312106.1|  PREDICTED: 60S ribosomal protein L18               222   2e-69    
ref|XP_003142248.1|  hypothetical protein LOAG_06664                    223   2e-69    
gb|ELW47918.1|  60S ribosomal protein L18                               222   3e-69    
ref|XP_001897286.1|  60S ribosomal protein L18                          221   3e-69    
ref|XP_008843215.1|  PREDICTED: 60S ribosomal protein L18 isoform X2    221   3e-69    
gb|KFM61778.1|  60S ribosomal protein L18                               221   4e-69    
gb|AEE62646.1|  unknown                                                 221   4e-69    
gb|AAN73382.1|  ribosomal protein L18                                   221   4e-69    
ref|XP_008843214.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    221   4e-69    
ref|XP_002722941.1|  PREDICTED: 60S ribosomal protein L18               221   4e-69    
gb|ABW23172.1|  ribosomal protein rpl18                                 221   4e-69    
ref|XP_007756404.1|  60S ribosomal protein L18-B                        221   5e-69    
ref|NP_001011030.1|  60S ribosomal protein L18                          221   5e-69    
ref|XP_005336693.1|  PREDICTED: 60S ribosomal protein L18               221   6e-69    
ref|XP_011015181.1|  PREDICTED: 60S ribosomal protein L18-2-like        219   6e-69    
emb|CCX32543.1|  Similar to 60S ribosomal protein L18-B; acc. no....    221   6e-69    
gb|ELR09673.1|  hypothetical protein GMDG_04159                         221   7e-69    
ref|XP_006229223.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    221   7e-69    
ref|NP_112364.1|  60S ribosomal protein L18                             221   8e-69    
ref|XP_004061142.1|  PREDICTED: 60S ribosomal protein L18               220   9e-69    
gb|KHN77912.1|  60S ribosomal protein L18                               221   9e-69    
gb|AAS49555.1|  ribosomal protein L18                                   219   1e-68    
ref|XP_008567503.1|  PREDICTED: 60S ribosomal protein L18               219   2e-68    
ref|XP_003801570.1|  PREDICTED: ribosomal protein L18-like              219   2e-68    
gb|KIJ70376.1|  hypothetical protein HYDPIDRAFT_143674                  219   2e-68    
ref|NP_001003432.1|  60S ribosomal protein L18                          219   2e-68    
gb|KHJ35313.1|  putative 60s ribosomal protein l18                      219   2e-68    
ref|XP_002771969.1|  60S ribosomal protein L18, putative                219   2e-68    
ref|XP_006160253.1|  PREDICTED: 60S ribosomal protein L18               219   2e-68    
emb|CEP17694.1|  hypothetical protein                                   219   3e-68    
gb|KEF62683.1|  large subunit ribosomal protein L18e                    219   3e-68    
ref|XP_007074184.1|  PREDICTED: ribosomal protein L18-like              219   3e-68    
gb|EWM27599.1|  Ribosomal protein L18e/L15P                             219   3e-68    
ref|XP_010385886.1|  PREDICTED: 60S ribosomal protein L18               219   4e-68    
ref|XP_002558988.1|  Pc13g05540                                         219   4e-68    
emb|CDP94036.1|  Protein BM-RPL-18, isoform b                           220   4e-68    
ref|NP_001018228.1|  60S ribosomal protein L18                          218   5e-68    
ref|XP_004089423.1|  PREDICTED: 60S ribosomal protein L18               218   5e-68    
ref|NP_000970.1|  60S ribosomal protein L18 isoform 1                   218   5e-68    
ref|NP_001182442.1|  60S ribosomal protein L18                          218   5e-68    
ref|XP_006157526.1|  PREDICTED: 60S ribosomal protein L18-like          219   5e-68    
gb|KIL00482.1|  hypothetical protein PAXRUDRAFT_821678                  218   5e-68    
gb|EFB23978.1|  hypothetical protein PANDA_006316                       218   6e-68    
ref|XP_005589842.1|  PREDICTED: uncharacterized LOC101867006 isof...    218   6e-68    
dbj|GAN04379.1|  60S ribosomal protein L18                              218   6e-68    
ref|XP_007536290.1|  PREDICTED: 60S ribosomal protein L18               218   6e-68    
ref|XP_006266602.1|  PREDICTED: 60S ribosomal protein L18               220   6e-68    
emb|CEP15166.1|  hypothetical protein                                   219   7e-68    
ref|XP_004451162.1|  PREDICTED: ribosomal protein L18-like              218   7e-68    
ref|XP_002371723.1|  60S ribosomal protein L18, putative                218   7e-68    
gb|ESZ97529.1|  60S ribosomal protein L18                               218   7e-68    
gb|KEQ70149.1|  ribosomal protein L18e                                  218   7e-68    
ref|XP_004694311.1|  PREDICTED: 60S ribosomal protein L18               218   8e-68    
ref|XP_008888411.1|  ribosomal protein RPL18                            218   8e-68    
ref|XP_007879935.1|  hypothetical protein PFL1_04221                    218   9e-68    
gb|KCW85063.1|  hypothetical protein EUGRSUZ_B01908                     216   9e-68    
ref|XP_011211055.1|  PREDICTED: 60S ribosomal protein L18               218   1e-67    
ref|XP_007677109.1|  hypothetical protein BAUCODRAFT_122987             218   1e-67    
emb|CCI45423.1|  unnamed protein product                                218   1e-67    
ref|XP_006109734.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    218   1e-67    
ref|XP_011125411.1|  hypothetical protein AOL_s00112g79                 217   1e-67    
emb|CCV00013.1|  unnamed protein product                                218   1e-67    
emb|CEP19927.1|  hypothetical protein                                   217   1e-67    
gb|EPB81859.1|  50S ribosomal protein L18e                              218   1e-67    
ref|XP_010366954.1|  PREDICTED: 60S ribosomal protein L18               217   1e-67    
dbj|GAN01748.1|  60S ribosomal protein L18                              219   1e-67    
gb|EPB85693.1|  50S ribosomal protein L18e                              218   2e-67    
gb|KIJ19828.1|  hypothetical protein PAXINDRAFT_166053                  217   2e-67    
ref|NP_001015556.1|  60S ribosomal protein L18                          217   2e-67    
gb|EMD40971.1|  hypothetical protein CERSUDRAFT_80614                   217   2e-67    
ref|XP_008046837.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    217   2e-67    
ref|XP_007862613.1|  60S ribosomal protein L18                          217   2e-67    
gb|KIK20716.1|  hypothetical protein PISMIDRAFT_576002                  217   2e-67    
ref|XP_008152619.1|  PREDICTED: 60S ribosomal protein L18               217   2e-67    
ref|NP_001187045.1|  60S ribosomal protein L18                          217   2e-67    
gb|EPB87658.1|  60S ribosomal protein L18-A                             217   2e-67    
gb|ELR56635.1|  60S ribosomal protein L18                               217   2e-67    
gb|ERG80123.1|  60s ribosomal protein l18                               218   3e-67    
ref|XP_011372891.1|  PREDICTED: 60S ribosomal protein L18               217   3e-67    
gb|AAH21743.1|  Ribosomal protein L18                                   216   3e-67    
gb|KIO03112.1|  hypothetical protein M404DRAFT_15806                    216   3e-67    
gb|ERG81080.1|  60s ribosomal protein l18                               217   3e-67    
gb|ABD77159.1|  ribosomal protein L18                                   216   3e-67    
emb|CCA16204.1|  60S ribosomal protein L182 putative                    216   4e-67    
gb|KIV96156.1|  60S ribosomal protein L18-B                             216   4e-67    
ref|NP_001082683.1|  60S ribosomal protein L18-B                        216   4e-67    
ref|XP_009543935.1|  hypothetical protein HETIRDRAFT_472767             216   5e-67    
ref|XP_011387324.1|  ribosomal 60S subunit protein L18                  216   5e-67    
ref|XP_004271135.1|  PREDICTED: 60S ribosomal protein L18 isoform 1     216   5e-67    
emb|CCF75175.1|  unnamed protein product                                216   5e-67    
gb|EHH30225.1|  hypothetical protein EGK_10844                          216   5e-67    
ref|XP_006026818.1|  PREDICTED: 60S ribosomal protein L18               216   5e-67    
dbj|GAN11649.1|  60S ribosomal protein L18                              217   6e-67    
ref|XP_003886070.1|  Ribosomal protein L18, related                     216   6e-67    
gb|EST06100.1|  armadillo                                               216   7e-67    
gb|KJB41868.1|  hypothetical protein B456_007G127300                    214   1e-66    
ref|XP_006868227.1|  PREDICTED: ribosomal protein L18-like              215   1e-66    
gb|KDD74971.1|  hypothetical protein H632_c955p1                        214   1e-66    
ref|XP_004619784.1|  PREDICTED: 60S ribosomal protein L18               217   1e-66    
gb|ACO51847.1|  60S ribosomal protein L18                               215   1e-66    
gb|EPY50895.1|  60S ribosomal protein L18                               215   1e-66    
ref|XP_002007966.1|  GI12089                                            215   1e-66    
emb|CDO74156.1|  hypothetical protein BN946_scf185043.g207              214   2e-66    
gb|ABD77165.1|  ribosomal protein L18                                   214   2e-66    
ref|XP_006894610.1|  PREDICTED: ribosomal protein L18-like              214   2e-66    
ref|XP_005798872.1|  PREDICTED: 60S ribosomal protein L18-like          214   2e-66    
ref|NP_001082681.1|  60S ribosomal protein L18-A                        214   2e-66    
ref|XP_009519518.1|  hypothetical protein PHYSODRAFT_284882             214   2e-66    
gb|ABD77169.1|  ribosomal protein L18                                   214   2e-66    
dbj|BAJ97000.1|  predicted protein                                      214   2e-66    
gb|ABD77157.1|  ribosomal protein L18                                   213   2e-66    
ref|XP_001082813.1|  PREDICTED: 60S ribosomal protein L18-like is...    214   2e-66    
ref|XP_001092745.1|  PREDICTED: 60S ribosomal protein L18-like          214   2e-66    
gb|AGG55290.1|  ribosomal protein L18                                   214   2e-66    
ref|XP_008429815.1|  PREDICTED: 60S ribosomal protein L18               214   2e-66    
emb|CDI57167.1|  probable 60S ribosomal protein L18                     214   2e-66    
sp|P02412.4|RL18B_XENLA  RecName: Full=60S ribosomal protein L18-...    214   3e-66    
ref|XP_007847122.1|  60s ribosomal protein l18                          214   4e-66    
ref|XP_007392123.1|  hypothetical protein PHACADRAFT_181562             214   4e-66    
ref|XP_007550032.1|  PREDICTED: 60S ribosomal protein L18               214   4e-66    
ref|XP_005875781.1|  PREDICTED: 60S ribosomal protein L18-like          214   4e-66    
gb|KJB45331.1|  hypothetical protein B456_007G301700                    214   4e-66    
gb|EPT03125.1|  hypothetical protein FOMPIDRAFT_1022488                 213   4e-66    
ref|XP_008891573.1|  hypothetical protein PPTG_02269                    214   4e-66    
sp|Q962Y8.1|RL18_SPOFR  RecName: Full=60S ribosomal protein L18         213   4e-66    
gb|ABD77175.1|  ribosomal protein L18                                   213   5e-66    
ref|XP_004780465.1|  PREDICTED: ribosomal protein L18-like              213   5e-66    
emb|CCF54530.1|  probable 60S ribosomal protein L18                     214   5e-66    
gb|AAN73352.1|  ribosomal protein L18                                   212   6e-66    
gb|ADD38370.1|  60S ribosomal protein L18                               213   6e-66    
gb|ABO26684.1|  ribosomal protein l18                                   213   6e-66    
ref|XP_010883138.1|  PREDICTED: 60S ribosomal protein L18               213   6e-66    
ref|XP_008815721.1|  60S ribosomal protein L18                          213   6e-66    
ref|XP_001614193.1|  60S ribosomal protein L18                          213   7e-66    
gb|ABD77172.1|  ribosomal protein L18                                   212   7e-66    
ref|XP_007381758.1|  60S ribosomal protein L18                          213   7e-66    
ref|XP_007315262.1|  hypothetical protein SERLADRAFT_381487             213   8e-66    
ref|XP_308294.3|  AGAP007580-PB                                         213   8e-66    
gb|KII96054.1|  hypothetical protein PLICRDRAFT_48977                   213   8e-66    
ref|XP_007364417.1|  60S ribosomal protein L18                          213   8e-66    
ref|XP_005561217.1|  PREDICTED: 60S ribosomal protein L18-like          213   9e-66    
ref|XP_004223602.1|  60S ribosomal protein L18                          213   9e-66    
ref|XP_002901873.1|  60S ribosomal protein L18-2                        213   9e-66    
gb|KJB23304.1|  hypothetical protein B456_004G091200                    211   1e-65    
ref|XP_001956062.1|  GF24783                                            213   1e-65    
gb|ABD77171.1|  ribosomal protein L18                                   212   1e-65    
gb|ABD77168.1|  ribosomal protein L18                                   211   1e-65    
ref|XP_006138489.1|  PREDICTED: 60S ribosomal protein L18-like          213   1e-65    
gb|KIL67232.1|  hypothetical protein M378DRAFT_22860                    212   1e-65    
gb|KIP09821.1|  hypothetical protein PHLGIDRAFT_18483                   212   1e-65    
dbj|GAK64966.1|  60S ribosomal protein L18                              218   1e-65    
ref|XP_007833554.1|  60S ribosomal protein L18-B                        213   2e-65    
gb|AFJ91753.1|  ribosomal protein L18                                   211   2e-65    
emb|CAB40827.1|  unnamed protein product                                212   2e-65    
ref|XP_001984175.1|  GH15152                                            212   2e-65    
ref|XP_001260260.1|  60S ribosomal protein L18                          211   2e-65    
gb|KFZ15448.1|  hypothetical protein V502_05612                         222   2e-65    
ref|XP_755074.1|  60S ribosomal protein L18                             211   2e-65    
ref|XP_002068278.1|  GK13159                                            211   2e-65    



>ref|XP_009783807.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score =   319 bits (817),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLIS+T GKEDKIAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISYTKGKEDKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG++TDDVRAYEVP L VCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGSVTDDVRAYEVPTLMVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAV+HFGPAPGVPHSHTKPYVR+KGRKFERARG+R SRGYKV
Sbjct  142  KNAREAVRHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGYKV  187



>ref|XP_009625475.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   318 bits (815),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLIS+  GKEDKIAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISYAKGKEDKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDDVRAY+VP LKVCAL+FTKTARARIEKAGGECLTFDQLALRAPLGQNT+LLRGP
Sbjct  82   VGTITDDVRAYDVPTLKVCALKFTKTARARIEKAGGECLTFDQLALRAPLGQNTLLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R SRGYKV
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGYKV  187



>ref|XP_009629074.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana tomentosiformis]
 ref|XP_009788537.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana sylvestris]
Length=187

 Score =   317 bits (813),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 153/165 (93%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLIS+  GKEDK+ V+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKPPLSLSRLISYAKGKEDKVVVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNT+LLRGP
Sbjct  82   VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTLLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            KN+REAVKHFGPAPGVPHSHTKP+VR+KGRKFERARG+RNSRGYK
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPFVRSKGRKFERARGRRNSRGYK  186



>ref|XP_009630920.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   317 bits (812),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKFN VILKRLFMSKTNKPPLSLSRLIS+T GKEDKIAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSKFNTVILKRLFMSKTNKPPLSLSRLISYTKGKEDKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG++TDDVRAYEVP L VCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGSVTDDVRAYEVPTLMVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAV+HFGPAPGVPHSHTKPYVR+KGRKFERARG+R SRGYKV
Sbjct  142  KNAREAVRHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGYKV  187



>gb|KDP28183.1| hypothetical protein JCGZ_13954 [Jatropha curcas]
Length=187

 Score =   316 bits (810),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLISFT GKEDKIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKPPLSLSRLISFTKGKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>ref|XP_009772706.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
 ref|XP_009772708.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score =   314 bits (805),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTG KFNAVILKRLFMSKTNKPPLSLSRLIS+  GKE KIAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGCKFNAVILKRLFMSKTNKPPLSLSRLISYAKGKEGKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDDVRAY+VP LKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNT+LLRGP
Sbjct  82   VGTITDDVRAYDVPTLKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTLLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R SRGYKV
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGYKV  187



>gb|KJB41867.1| hypothetical protein B456_007G127300 [Gossypium raimondii]
Length=187

 Score =   313 bits (802),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLI F  GKEDKIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLIQFMKGKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+RNS+G++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSKGFRV  187



>ref|XP_009796134.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score =   313 bits (801),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKL+VKLYRFLV+RTGSKFN VILK LFMSKTNKPPLSLSRLIS+  GKEDKI V+
Sbjct  22   DDVYLKLIVKLYRFLVQRTGSKFNTVILKWLFMSKTNKPPLSLSRLISYAKGKEDKIVVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDDVRAY+VP LKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNT+LLRGP
Sbjct  82   VGTITDDVRAYDVPTLKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTILLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R SRGYKV
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGYKV  187



>ref|XP_008450608.1| PREDICTED: 60S ribosomal protein L18-2 [Cucumis melo]
Length=187

 Score =   313 bits (801),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI F  GKE KIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIQFMKGKESKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTITDDIRVYEVPALKVAALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSH+KPYVR+KGRKFERARGKRNSRGY+V
Sbjct  142  KNSREAVKHFGPAPGVPHSHSKPYVRSKGRKFERARGKRNSRGYRV  187



>gb|KJB41866.1| hypothetical protein B456_007G127300, partial [Gossypium raimondii]
Length=227

 Score =   314 bits (805),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLI F  GKEDKIAV+
Sbjct  62   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLIQFMKGKEDKIAVV  121

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  122  VGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  181

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+RNS+G++V
Sbjct  182  KNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSKGFRV  227



>ref|XP_002301485.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|EEE80758.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   313 bits (801),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI+F  GKEDKIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKPPLSLSRLITFMKGKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTITDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPY+R+KGRKFE+ARGKRNS+G++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYIRSKGRKFEKARGKRNSKGFRV  187



>gb|KGN66048.1| hypothetical protein Csa_1G569250 [Cucumis sativus]
Length=244

 Score =   314 bits (805),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI FT GKE KIAV+
Sbjct  79   DDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIQFTKGKESKIAVV  138

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  139  VGTITDDIRVYEVPALKVAALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  198

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSH+KPYVR+KGRKFERARGKRNSRGY+V
Sbjct  199  KNSREAVKHFGPAPGVPHSHSKPYVRSKGRKFERARGKRNSRGYRV  244



>ref|XP_007031040.1| Ribosomal protein L18 [Theobroma cacao]
 gb|EOY11542.1| Ribosomal protein L18 [Theobroma cacao]
Length=187

 Score =   312 bits (799),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GKEDKIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKGKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+RNS+G++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSKGFRV  187



>gb|KJB45330.1| hypothetical protein B456_007G301700 [Gossypium raimondii]
Length=187

 Score =   312 bits (799),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GKEDKIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKGKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSHTKPYVR+KGRK+ERARG+RNS+G++V
Sbjct  142  KNSREAVKHFGPAPGVPHSHTKPYVRSKGRKYERARGRRNSKGFRV  187



>ref|XP_006344694.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum tuberosum]
Length=187

 Score =   311 bits (798),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFL RRTGSKFNAVILKRLFMSK NKPPLSLSRLIS+  GK DK  VL
Sbjct  22   DDVYLKLLVKLYRFLARRTGSKFNAVILKRLFMSKINKPPLSLSRLISYAEGKGDKTVVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDDVRAYEVP LKVCAL+FTKTARARIEKAGGECLTFDQLALRAPLGQNT+LLRGP
Sbjct  82   VGTVTDDVRAYEVPKLKVCALKFTKTARARIEKAGGECLTFDQLALRAPLGQNTLLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR SRGYKV
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRKSRGYKV  187



>ref|XP_010025256.1| PREDICTED: 60S ribosomal protein L18-2 [Eucalyptus grandis]
 gb|KCW61872.1| hypothetical protein EUGRSUZ_H04551 [Eucalyptus grandis]
Length=187

 Score =   311 bits (798),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAV+LKRLFMSK NKPPLSLSRLI +T GKEDKIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVVLKRLFMSKVNKPPLSLSRLIRYTQGKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +EVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTITDDIRVHEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>ref|NP_001237789.1| uncharacterized protein LOC100500164 [Glycine max]
 gb|ACU15099.1| unknown [Glycine max]
 gb|KHN16096.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score =   311 bits (798),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI +T GKEDKIAV+
Sbjct  22   NDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIKYTKGKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG ITDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGNITDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  187



>ref|XP_010088293.1| 60S ribosomal protein L18-3 [Morus notabilis]
 gb|EXB33518.1| 60S ribosomal protein L18-3 [Morus notabilis]
Length=197

 Score =   311 bits (796),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGS FNAV+LKRLFMSK NKPPLSLSRLI F  GKEDK+AV+
Sbjct  32   DDIYLKLLVKLYRFLVRRTGSNFNAVVLKRLFMSKVNKPPLSLSRLIRFMKGKEDKVAVV  91

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  92   VGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  151

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARGKRNSRG++V
Sbjct  152  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGKRNSRGFRV  197



>ref|XP_011036896.1| PREDICTED: 60S ribosomal protein L18-2 [Populus euphratica]
Length=187

 Score =   310 bits (795),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK NK PLSLSRLI+F  GKEDKIAVL
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSRFNAVILKRLFMSKINKAPLSLSRLITFMKGKEDKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKP+VRAKGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPFVRAKGRKFERARGRRNSRGFRV  187



>ref|XP_006382454.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|ABK93398.1| unknown [Populus trichocarpa]
 gb|ABK93783.1| unknown [Populus trichocarpa]
 gb|ERP60251.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   310 bits (795),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK NK PLSLSRLI+F  GKEDKIAVL
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSRFNAVILKRLFMSKINKAPLSLSRLITFMKGKEDKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKP+VRAKGRKFE+ARGKRNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPFVRAKGRKFEKARGKRNSRGFRV  187



>ref|XP_002523106.1| 60S ribosomal protein L18, putative [Ricinus communis]
 gb|EEF39291.1| 60S ribosomal protein L18, putative [Ricinus communis]
Length=187

 Score =   310 bits (794),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKL+VKLYRFLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI+F  GKE+KIAV+
Sbjct  22   DDIYLKLIVKLYRFLVRRTGSKFNAVILKRLFMSKINKAPLSLSRLITFMKGKENKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDDVR YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDVRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  187



>gb|KHN43503.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score =   310 bits (794),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGS FNAV+LKRLFMSK NKPPLSLSRLI +T GKEDKIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSNFNAVVLKRLFMSKVNKPPLSLSRLIRYTKGKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  187



>ref|XP_010313195.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum lycopersicum]
Length=187

 Score =   310 bits (794),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFL RRTGSKFNAVILKRLFMSK NKPPLSLSRLIS+  GK DK  VL
Sbjct  22   DDVYLKLLVKLYRFLARRTGSKFNAVILKRLFMSKINKPPLSLSRLISYAEGKGDKTVVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDDVRAYEVP LKVCAL+FTKTARARIEKAGGECLTFDQLALRAPLGQNT+LLRGP
Sbjct  82   VGTVTDDVRAYEVPKLKVCALKFTKTARARIEKAGGECLTFDQLALRAPLGQNTLLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR SRGYK 
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRKSRGYKA  187



>ref|XP_006359857.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum tuberosum]
Length=187

 Score =   310 bits (794),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFL RRTGSKFNAVILKRLFMSK NK PLSLSRL+++ +GKED IAV+
Sbjct  22   DDVYLKLLVKLYRFLARRTGSKFNAVILKRLFMSKINKAPLSLSRLVTYMTGKEDNIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDDVRAYEVP +KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDVRAYEVPKIKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFG APGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV
Sbjct  142  KNSREAVKHFGKAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  187



>ref|XP_008454015.1| PREDICTED: 60S ribosomal protein L18-3 [Cucumis melo]
Length=187

 Score =   310 bits (793),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKPP+SLSRLI +  GKE KIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKPPISLSRLIKYMKGKEAKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSHTKPYVR+KGRKFERARGKRNSRGY+V
Sbjct  142  KNSREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGKRNSRGYRV  187



>gb|KJB82632.1| hypothetical protein B456_013G206100 [Gossypium raimondii]
Length=187

 Score =   310 bits (793),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVK+YRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GKEDKIAV+
Sbjct  22   DDIYLKLLVKIYRFLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKGKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR++GRKFERARG+RNS+G++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSRGRKFERARGRRNSKGFRV  187



>ref|XP_004144773.1| PREDICTED: 60S ribosomal protein L18-3-like [Cucumis sativus]
 ref|XP_004158733.1| PREDICTED: 60S ribosomal protein L18-3-like [Cucumis sativus]
 gb|KGN60965.1| hypothetical protein Csa_2G032220 [Cucumis sativus]
Length=187

 Score =   310 bits (793),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKPP+SLSRLI + +GKE +IAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKPPISLSRLIKYMNGKEGRIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSHTKPYVR+KGRKFERARGKRNSRGY+V
Sbjct  142  KNSREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGKRNSRGYRV  187



>ref|XP_007050974.1| Ribosomal protein L18 isoform 1 [Theobroma cacao]
 gb|EOX95131.1| Ribosomal protein L18 isoform 1 [Theobroma cacao]
Length=187

 Score =   310 bits (793),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F   KEDKIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKCKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+RNS+G++V
Sbjct  142  KNSREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSKGFRV  187



>gb|KJB23303.1| hypothetical protein B456_004G091200 [Gossypium raimondii]
Length=187

 Score =   310 bits (793),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKL+VKLYRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GKEDKIAV+
Sbjct  22   DDIYLKLIVKLYRFLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKGKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARI+KAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDIRVYEVPALKVTALRFTETARARIDKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+RNS+G++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSKGFRV  187



>ref|XP_011042004.1| PREDICTED: 60S ribosomal protein L18-2-like [Populus euphratica]
Length=187

 Score =   310 bits (793),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLI++  GKE KIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLITYMKGKEGKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R YEVPA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTITDDIRVYEVPAIKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPY+R+KGRKFE+ARGKRNS+G++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYIRSKGRKFEKARGKRNSKGFRV  187



>gb|KHN20393.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=274

 Score =   313 bits (801),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GKEDKIAV+
Sbjct  109  NDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIRYTKGKEDKIAVV  168

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  169  VGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  228

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRG++V
Sbjct  229  KNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGFRV  274



>ref|XP_002320999.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|ABK93820.1| unknown [Populus trichocarpa]
 gb|EEE99314.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   309 bits (791),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPL+LSRLI++  GKE KIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLALSRLITYMKGKEGKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTITDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPY+R+KGRKFE+ARGKRNS+G++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYIRSKGRKFEKARGKRNSKGFRV  187



>gb|KHF98574.1| 60S ribosomal L18-2 -like protein [Gossypium arboreum]
 gb|KJB22518.1| hypothetical protein B456_004G052100 [Gossypium raimondii]
Length=187

 Score =   309 bits (791),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI +  GKEDKIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIQYMKGKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+ GRKFERARG+RNS+G++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSNGRKFERARGRRNSKGFRV  187



>ref|XP_006433453.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
 ref|XP_006472133.1| PREDICTED: 60S ribosomal protein L18-3-like [Citrus sinensis]
 gb|ESR46693.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
Length=187

 Score =   309 bits (791),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKPPLSLSRLI+F  GKEDKIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTDSNFNKVILKRLFMSKVNKPPLSLSRLINFMKGKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+RAYEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDIRAYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>ref|NP_001236701.1| uncharacterized protein LOC100306301 [Glycine max]
 gb|ACU14418.1| unknown [Glycine max]
Length=187

 Score =   309 bits (791),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGS FNAV+LKRLFMSK NKPPLSLSRLI +T GKEDKIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSNFNAVVLKRLFMSKVNKPPLSLSRLIRYTKGKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG++NSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRKNSRGFRV  187



>ref|XP_010528904.1| PREDICTED: 60S ribosomal protein L18-2 [Tarenaya hassleriana]
Length=187

 Score =   308 bits (789),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NK P+SLSRL+ F  GKEDK+AV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSSFNAVILKRLFMSKVNKAPISLSRLVRFMQGKEDKVAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDLRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+RNSRG+KV
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSRGFKV  187



>ref|NP_001236071.1| uncharacterized protein LOC100499789 [Glycine max]
 gb|ACU13660.1| unknown [Glycine max]
Length=187

 Score =   308 bits (789),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +  GKEDKIAV+
Sbjct  22   NDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIRYAKGKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGFRV  187



>ref|XP_004135776.1| PREDICTED: uncharacterized protein LOC101207642 [Cucumis sativus]
 ref|XP_004169487.1| PREDICTED: uncharacterized protein LOC101228164 [Cucumis sativus]
Length=389

 Score =   315 bits (808),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI FT GKE KIAV+
Sbjct  224  DDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIQFTKGKESKIAVV  283

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  284  VGTITDDIRVYEVPALKVAALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  343

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSH+KPYVR+KGRKFERARGKRNSRGY+V
Sbjct  344  KNSREAVKHFGPAPGVPHSHSKPYVRSKGRKFERARGKRNSRGYRV  389



>ref|XP_003556523.1| PREDICTED: 60S ribosomal protein L18-2-like [Glycine max]
Length=187

 Score =   308 bits (789),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GKEDKIAV+
Sbjct  22   NDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIKYTKGKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG+ITDD+R YEVP LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGSITDDIRVYEVPPLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  187



>ref|XP_010094463.1| 60S ribosomal protein L18-2 [Morus notabilis]
 gb|EXB56096.1| 60S ribosomal protein L18-2 [Morus notabilis]
Length=198

 Score =   308 bits (790),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GKE KIAV+
Sbjct  33   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIRFMQGKESKIAVV  92

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R Y+VPALKV ALRFT+TARARIEKAGGECLTFDQLAL+APLGQNTVLLRGP
Sbjct  93   VGTVTDDIRVYDVPALKVTALRFTETARARIEKAGGECLTFDQLALKAPLGQNTVLLRGP  152

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARGKRNSRG++V
Sbjct  153  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGKRNSRGFRV  198



>gb|KHN20252.1| 60S ribosomal protein L18-3, partial [Glycine soja]
Length=187

 Score =   308 bits (788),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GKEDKIAV+
Sbjct  22   NDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIKYTKGKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG+ITDD+R YEVP LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGSITDDIRVYEVPPLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  187



>ref|XP_007163123.1| hypothetical protein PHAVU_001G208200g [Phaseolus vulgaris]
 gb|ESW35117.1| hypothetical protein PHAVU_001G208200g [Phaseolus vulgaris]
Length=187

 Score =   308 bits (788),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GKE+KIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIRYTKGKENKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSH+KPYVRAKGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHSKPYVRAKGRKFERARGRRNSRGFRV  187



>ref|XP_009630742.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   307 bits (787),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRF VRRT SKFNAVILKRLFMSKTNKPPLSLSRLIS+  GKE+KIAV+
Sbjct  22   DDVYLKLLVKLYRFFVRRTESKFNAVILKRLFMSKTNKPPLSLSRLISYVKGKENKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDDVRAY+VP LKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNT+LL+GP
Sbjct  82   VGTITDDVRAYDVPTLKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTLLLKGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPY+ +KGRKFERARG R SRGYKV
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYMHSKGRKFERARGIRKSRGYKV  187



>ref|XP_010104147.1| 60S ribosomal protein L18-2 [Morus notabilis]
 gb|EXB98712.1| 60S ribosomal protein L18-2 [Morus notabilis]
Length=209

 Score =   308 bits (789),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GKE KIAV+
Sbjct  44   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIRFMQGKESKIAVV  103

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R Y+VPALKV ALRFT+TARARIEKAGGECLTFDQLAL+APLGQNTVLLRGP
Sbjct  104  VGTVTDDIRVYDVPALKVTALRFTETARARIEKAGGECLTFDQLALKAPLGQNTVLLRGP  163

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARGKRNSRG++V
Sbjct  164  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGKRNSRGFRV  209



>gb|KDP23459.1| hypothetical protein JCGZ_23292 [Jatropha curcas]
Length=187

 Score =   307 bits (786),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI F  GKE KIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKTPLSLSRLIRFMKGKESKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>ref|XP_010043043.1| PREDICTED: 60S ribosomal protein L18-2 [Eucalyptus grandis]
 gb|KCW85064.1| hypothetical protein EUGRSUZ_B01908 [Eucalyptus grandis]
Length=187

 Score =   307 bits (786),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI +T GKEDKIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKAPLSLSRLIRYTQGKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R Y+VPALKV ALRFT+T RARIEKAGGECLTFDQLALRAPLGQNT+LLRGP
Sbjct  82   VGTVTDDIRVYDVPALKVTALRFTETVRARIEKAGGECLTFDQLALRAPLGQNTILLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>gb|KHG07157.1| 60S ribosomal L18-2 -like protein [Gossypium arboreum]
Length=207

 Score =   307 bits (786),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKL+VKLYRFLVRRTGSKFNAVILKRLFM K NKPPLSLSRLI F  GKEDKIAV+
Sbjct  42   DDIYLKLIVKLYRFLVRRTGSKFNAVILKRLFMCKVNKPPLSLSRLIEFMKGKEDKIAVV  101

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFTKTARARI+KAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  102  VGTVTDDIRIYEVPALKVTALRFTKTARARIDKAGGECLTFDQLALRAPLGQNTVLLRGP  161

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+K RKFERARG+RNS+G++V
Sbjct  162  KNAREAVKHFGPAPGVPHSHTKPYVRSKARKFERARGRRNSKGFRV  207



>ref|XP_010659657.1| PREDICTED: 60S ribosomal protein L18-2-like [Vitis vinifera]
 emb|CAN65685.1| hypothetical protein VITISV_022459 [Vitis vinifera]
Length=187

 Score =   305 bits (782),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRL+ +  GKE KIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLVRYMGGKEGKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFG APGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  142  KNSREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>ref|XP_004495692.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score =   305 bits (782),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GKE KIAV+
Sbjct  22   NDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIKYTKGKEGKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG ITDD+R YEVPA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGAITDDIRVYEVPAIKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFE+ARGKRNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFEKARGKRNSRGFRV  187



>gb|KHN03962.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score =   305 bits (781),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKPP+SLSRLI +T GKEDKIAV+
Sbjct  22   NDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKPPISLSRLIKYTKGKEDKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALK+ AL+FT+ ARARIEKAGGECLTFD+LALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDIRVYEVPALKITALKFTERARARIEKAGGECLTFDELALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  187



>ref|XP_010546736.1| PREDICTED: 60S ribosomal protein L18-3 [Tarenaya hassleriana]
Length=187

 Score =   305 bits (780),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NK PLSLSRL+ F  GKED+I V+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKAPLSLSRLVRFMQGKEDQIGVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDDVR YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDVRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R SRG+KV
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGFKV  187



>ref|XP_010544997.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score =   304 bits (778),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI +  GKED+I V+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIRYMQGKEDQIGVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R YEVPALK+ ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDARVYEVPALKITALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R SRG+KV
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGFKV  187



>ref|XP_002319502.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|EEE95425.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   304 bits (778),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK NK PLSLSRLI++T GKE KIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTQSKFNAVILKRLFMSKINKAPLSLSRLITYTKGKEGKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVP LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDIRVYEVPTLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFE+ARGKRNS+G++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFEKARGKRNSKGFRV  187



>ref|XP_002270635.1| PREDICTED: 60S ribosomal protein L18-2 [Vitis vinifera]
Length=187

 Score =   304 bits (778),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPP+SLSRLI +  GKEDKIAVL
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKPPMSLSRLIRYMQGKEDKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVP LKV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDLRVYEVPTLKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>emb|CDP17112.1| unnamed protein product [Coffea canephora]
Length=234

 Score =   305 bits (782),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFN VILKRLFMSK NKP LSLSRLI++T GKEDKIAV+
Sbjct  69   DDIYLKLLVKLYRFLVRRTGSKFNVVILKRLFMSKINKPALSLSRLITYTKGKEDKIAVV  128

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R YEVP+LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  129  VGTVTDDTRVYEVPSLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  188

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHS+TKPYVR+ GRKFERARG+RNSRG++V
Sbjct  189  KNSREAVKHFGPAPGVPHSNTKPYVRSSGRKFERARGRRNSRGFRV  234



>emb|CDO98841.1| unnamed protein product [Coffea canephora]
Length=243

 Score =   305 bits (782),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = -1

Query  641  DVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLV  462
            D+YLKLLVKLYRFLVRRTGS+FNAV+LKRLFMSKTNKPPLSLSRL+ F  GKEDKIAVLV
Sbjct  79   DIYLKLLVKLYRFLVRRTGSRFNAVLLKRLFMSKTNKPPLSLSRLVKFMEGKEDKIAVLV  138

Query  461  GTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPK  282
            GT+TDD R YEVP LKV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPK
Sbjct  139  GTVTDDTRVYEVPTLKVAALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPK  198

Query  281  NSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            N+REAVKHFGPAPGVPHSHTKPYVRA GRKFERARG+RNSRG++V
Sbjct  199  NAREAVKHFGPAPGVPHSHTKPYVRATGRKFERARGRRNSRGFRV  243



>ref|XP_003554636.2| PREDICTED: 60S ribosomal protein L18-2-like [Glycine max]
 gb|KHN43312.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=214

 Score =   304 bits (779),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK NKPP+SLSRLI +T GKEDKIAV+
Sbjct  49   NDIYLKLLVKLYRFLVRRTDSNFNAVILKRLFMSKVNKPPISLSRLIKYTKGKEDKIAVV  108

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALK+ AL+FT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  109  VGTVTDDIRVYEVPALKITALKFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  168

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+RNSRG++V
Sbjct  169  KNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  214



>gb|AFK49563.1| unknown [Lotus japonicus]
Length=187

 Score =   303 bits (776),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKPP+SLSRLI +  GKEDK+ V+
Sbjct  22   NDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKPPISLSRLIKYAKGKEDKVVVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE ARGKRNS+G++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEMARGKRNSKGFRV  187



>ref|XP_007144959.1| hypothetical protein PHAVU_007G197900g [Phaseolus vulgaris]
 gb|ESW16953.1| hypothetical protein PHAVU_007G197900g [Phaseolus vulgaris]
Length=187

 Score =   303 bits (776),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GKE KIAV+
Sbjct  22   NDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIKYTKGKEGKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R YEVP+LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTITDDIRVYEVPSLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHS+TKPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSNTKPYVRSKGRKFEKARGRRNSRGFRV  187



>ref|XP_010559185.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score =   303 bits (776),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI +  GK+DKI V+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIRYMQGKKDKIGVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R YEVPALK+ ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDARVYEVPALKITALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R SRG+KV
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGFKV  187



>ref|XP_010523956.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score =   303 bits (776),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI +  GKED I V+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIRYMEGKEDNIGVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R YEVPALK+ ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDARVYEVPALKITALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R SRG+KV
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGFKV  187



>ref|XP_008386678.1| PREDICTED: 60S ribosomal protein L18-2-like [Malus domestica]
Length=187

 Score =   303 bits (775),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI + +GKE KIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKAPLSLSRLIKYMTGKEGKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVP LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNT+LLRGP
Sbjct  82   VGTVTDDIRVYEVPCLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTILLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187



>ref|XP_007050976.1| Ribosomal protein L18 isoform 3 [Theobroma cacao]
 gb|EOX95133.1| Ribosomal protein L18 isoform 3 [Theobroma cacao]
Length=186

 Score =   303 bits (775),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 158/166 (95%), Gaps = 1/166 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLL +LYRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F   KEDKIAV+
Sbjct  22   DDIYLKLL-QLYRFLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKCKEDKIAVV  80

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  81   VGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  140

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+RNS+G++V
Sbjct  141  KNSREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSKGFRV  186



>emb|CBI39539.3| unnamed protein product [Vitis vinifera]
Length=249

 Score =   305 bits (780),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRL+ +  GKE KIAV+
Sbjct  84   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLVRYMGGKEGKIAVV  143

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  144  VGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  203

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFG APGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  204  KNSREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  249



>ref|XP_011023716.1| PREDICTED: 60S ribosomal protein L18-2 [Populus euphratica]
Length=187

 Score =   302 bits (773),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK NK PLSLSRLI++T GKE KIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTQSKFNAVILKRLFMSKINKAPLSLSRLITYTKGKEGKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVPHSHTKPYVRAKGRKFE+ARGKRNS+G++V
Sbjct  142  KNAREAVKHFGRAPGVPHSHTKPYVRAKGRKFEKARGKRNSKGFRV  187



>ref|XP_010931680.1| PREDICTED: 60S ribosomal protein L18-2 [Elaeis guineensis]
Length=187

 Score =   302 bits (773),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPP+SL RLI F  GKEDKIAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKPPISLKRLIRFMEGKEDKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R YEVPA+KV ALRFT+TARARI +AGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDKRVYEVPAMKVTALRFTETARARILQAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  187



>ref|XP_009338229.1| PREDICTED: 60S ribosomal protein L18-2-like [Pyrus x bretschneideri]
Length=187

 Score =   302 bits (773),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI +  GK++KIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKAPLSLSRLIKYMQGKDNKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVP +KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQN VLLRGP
Sbjct  82   VGTVTDDIRVYEVPQMKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNVVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  142  KNSREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187



>gb|ABK92688.1| unknown [Populus trichocarpa]
Length=187

 Score =   302 bits (773),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK NK PLSLSRLI++T GKE KIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTQSKFNAVILKRLFMSKINKAPLSLSRLITYTKGKEGKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVP LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDIRVYEVPTLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPH HTKPYVRAKGRKFE+ARGKRNS+G++V
Sbjct  142  KNAREAVKHFGPAPGVPHGHTKPYVRAKGRKFEKARGKRNSKGFRV  187



>ref|XP_008388515.1| PREDICTED: 60S ribosomal protein L18-2-like [Malus domestica]
Length=187

 Score =   302 bits (773),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI +  GK+ KIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKAPLSLSRLIKYMQGKDSKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVP LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQN VLLRGP
Sbjct  82   VGTVTDDIRVYEVPQLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNVVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  142  KNSREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187



>ref|XP_007147006.1| hypothetical protein PHAVU_006G088800g [Phaseolus vulgaris]
 gb|ESW19000.1| hypothetical protein PHAVU_006G088800g [Phaseolus vulgaris]
Length=187

 Score =   301 bits (772),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GKEDKIAV+
Sbjct  22   NDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIRYTKGKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R YEVP LK+ AL+FT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTITDDIRVYEVPQLKITALKFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSH+KPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGRRNSRGFRV  187



>ref|XP_006444385.1| hypothetical protein CICLE_v10022435mg [Citrus clementina]
 ref|XP_006479993.1| PREDICTED: 60S ribosomal protein L18-3-like [Citrus sinensis]
 gb|ESR57625.1| hypothetical protein CICLE_v10022435mg [Citrus clementina]
 gb|KDO87175.1| hypothetical protein CISIN_1g029841mg [Citrus sinensis]
 gb|KDO87176.1| hypothetical protein CISIN_1g029841mg [Citrus sinensis]
Length=187

 Score =   301 bits (772),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRT S F+ VILKRLFMSK NKPP+SLSRL  F  GKEDKIAV+
Sbjct  22   NDIYLKLLVKLYRFLVRRTDSNFDKVILKRLFMSKVNKPPMSLSRLTKFMKGKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARGKRNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGKRNSRGFRV  187



>ref|XP_009335702.1| PREDICTED: 60S ribosomal protein L18-2 [Pyrus x bretschneideri]
 ref|XP_009335725.1| PREDICTED: 60S ribosomal protein L18-2 [Pyrus x bretschneideri]
Length=187

 Score =   301 bits (771),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI + +GKE KIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKAPLSLSRLIKYMTGKEGKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R Y+VP LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNT+LLRGP
Sbjct  82   VGTVTDDIRVYDVPCLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTILLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187



>ref|XP_010684349.1| PREDICTED: 60S ribosomal protein L18-2-like [Beta vulgaris subsp. 
vulgaris]
Length=187

 Score =   301 bits (771),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +DVYLKLLVKLYRFLVRRTGSKFNAV+LKRLFMSK NK PLSLSRL+ +  GK+ +IAVL
Sbjct  22   NDVYLKLLVKLYRFLVRRTGSKFNAVVLKRLFMSKINKAPLSLSRLVKYMEGKDGRIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R YEVP +KVCALRFT+TARARIEKAGGEC+TFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTITDDIRVYEVPTMKVCALRFTETARARIEKAGGECITFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVPHSHTKPYVRA GRKFERARG+RNSRGY+V
Sbjct  142  KNAREAVKHFGKAPGVPHSHTKPYVRANGRKFERARGRRNSRGYRV  187



>ref|XP_007201344.1| hypothetical protein PRUPE_ppa012001mg [Prunus persica]
 ref|XP_008235116.1| PREDICTED: 60S ribosomal protein L18-2 [Prunus mume]
 gb|EMJ02543.1| hypothetical protein PRUPE_ppa012001mg [Prunus persica]
Length=187

 Score =   301 bits (771),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK PLSLSRLI + +GK+ KIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFSAVILKRLFMSKVNKAPLSLSRLIRYMNGKDGKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187



>ref|XP_010674074.1| PREDICTED: 60S ribosomal protein L18-2 [Beta vulgaris subsp. 
vulgaris]
Length=187

 Score =   301 bits (770),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +DVYLKLLVKLYRFLVRRTGS FN V+LKRLFMSK NK PLSLSRLI++  GKEDKIAV+
Sbjct  22   NDVYLKLLVKLYRFLVRRTGSSFNGVVLKRLFMSKINKAPLSLSRLITYMKGKEDKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVPHSHTKPYVRA GRKFERARG+RNSRGY+V
Sbjct  142  KNAREAVKHFGKAPGVPHSHTKPYVRANGRKFERARGRRNSRGYRV  187



>ref|XP_008370417.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
Length=187

 Score =   301 bits (770),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK NK PLSLSRLI +  GK++KIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTASKFNAVILKRLFMSKVNKAPLSLSRLIKYMQGKDNKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R YEVP +KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQN VLLRGP
Sbjct  82   VGTITDDIRVYEVPQMKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNVVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  142  KNSREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187



>ref|XP_006386732.1| hypothetical protein POPTR_0002s20400g [Populus trichocarpa]
 gb|ERP64529.1| hypothetical protein POPTR_0002s20400g [Populus trichocarpa]
Length=184

 Score =   301 bits (770),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 158/166 (95%), Gaps = 3/166 (2%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI+F  GK   IAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKPPLSLSRLITFMKGK---IAVV  78

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  79   VGTITDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  138

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPY+R+KGRKFE+ARGKRNS+G++V
Sbjct  139  KNAREAVKHFGPAPGVPHSHTKPYIRSKGRKFEKARGKRNSKGFRV  184



>ref|XP_007205962.1| hypothetical protein PRUPE_ppa012012mg [Prunus persica]
 ref|XP_008245548.1| PREDICTED: 60S ribosomal protein L18-2 [Prunus mume]
 gb|EMJ07161.1| hypothetical protein PRUPE_ppa012012mg [Prunus persica]
Length=187

 Score =   301 bits (770),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI +  GK++KIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKAPLSLSRLIRYMQGKDNKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVP LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQN VLLRGP
Sbjct  82   VGTVTDDIRVYEVPQLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNVVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187



>ref|XP_008369026.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
 ref|XP_008345218.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
 ref|XP_008355492.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
Length=187

 Score =   301 bits (770),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK NK PLSLSRLI + +GKE KIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTSSKFNAVILKRLFMSKVNKAPLSLSRLIKYMTGKEGKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVP LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNT+LLRGP
Sbjct  82   VGTVTDDIRVYEVPCLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTILLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187



>emb|CBI22977.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   303 bits (776),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPP+SLSRLI +  GKEDKIAVL
Sbjct  89   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKPPMSLSRLIRYMQGKEDKIAVL  148

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVP LKV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  149  VGTVTDDLRVYEVPTLKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  208

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  209  KNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  254



>ref|XP_009134833.1| PREDICTED: 60S ribosomal protein L18-2 [Brassica rapa]
Length=187

 Score =   300 bits (768),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVL
Sbjct  22   DDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTITDDLRVHEIPAIKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSH+KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  142  KNSREAVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  187



>ref|NP_187210.1| 60S ribosomal protein L18-2 [Arabidopsis thaliana]
 sp|P42791.2|RL182_ARATH RecName: Full=60S ribosomal protein L18-2 [Arabidopsis thaliana]
 gb|AAF26138.1|AC011620_14 putative 60S ribosomal protein L18 [Arabidopsis thaliana]
 gb|AAK59824.1| AT3g05590/F18C1_14 [Arabidopsis thaliana]
 gb|AAL31164.1| AT3g05590/F18C1_14 [Arabidopsis thaliana]
 gb|AEE74263.1| 60S ribosomal protein L18-2 [Arabidopsis thaliana]
Length=187

 Score =   300 bits (768),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKL VKLYRFLVRRT SKFN VILKRLFMSK NK PLSLSRL+ F +GKEDKIAVL
Sbjct  22   DDVYLKLTVKLYRFLVRRTNSKFNGVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSH+KPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  142  KNSREAVKHFGPAPGVPHSHSKPYVRAKGRKFEKARGKRKSRGFKV  187



>ref|XP_010259492.1| PREDICTED: 60S ribosomal protein L18-3 [Nelumbo nucifera]
Length=187

 Score =   300 bits (768),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMS+ NK P+SLSRLISF  GKEDKIAV+
Sbjct  22   NDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSRVNKAPMSLSRLISFMKGKEDKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R YEVPALKV ALRFT+TARARI KAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDTRVYEVPALKVTALRFTETARARILKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>ref|XP_010938374.1| PREDICTED: 60S ribosomal protein L18-2-like [Elaeis guineensis]
Length=187

 Score =   300 bits (768),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGS+FNAVIL+RLFMSK NKPPLSL RL++F  GKEDKIAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSRFNAVILRRLFMSKVNKPPLSLKRLVTFMQGKEDKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R YEVPA+KV ALRFT+TARARI KAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDKRVYEVPAMKVTALRFTETARARIVKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  142  KNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  187



>ref|XP_008775991.1| PREDICTED: 60S ribosomal protein L18-2 [Phoenix dactylifera]
Length=187

 Score =   299 bits (766),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+PP+SL +LI+F  GKEDKIAVL
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRPPISLKKLITFMEGKEDKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R YEVPA+ V ALRFT+TARARI KAGGEC TFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDKRVYEVPAMTVTALRFTETARARILKAGGECWTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  187



>emb|CDX74138.1| BnaA03g29090D [Brassica napus]
Length=213

 Score =   300 bits (768),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVL
Sbjct  48   DDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVL  107

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  108  VGTITDDLRVHEIPAIKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  167

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSH+KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  168  KNSREAVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  213



>ref|NP_001235897.1| uncharacterized protein LOC100527681 [Glycine max]
 gb|ACU16823.1| unknown [Glycine max]
Length=187

 Score =   299 bits (766),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYR LVRRTGS FNAVILKRLFMSK NKPP+SLSRLI +T GKEDKIAV+
Sbjct  22   NDIYLKLLVKLYRSLVRRTGSNFNAVILKRLFMSKVNKPPISLSRLIKYTKGKEDKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALK+ AL+ T+ ARARIEKAGGECLTFD+LALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDIRVYEVPALKITALKSTERARARIEKAGGECLTFDELALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  187



>ref|XP_002271179.1| PREDICTED: 60S ribosomal protein L18-2 [Vitis vinifera]
Length=187

 Score =   299 bits (765),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRL+ +  GKE KIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLVRYMDGKEGKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVP LKV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDLRVYEVPCLKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>gb|AAA69928.1| cytoplasmic ribosomal protein L18 [Arabidopsis thaliana]
Length=187

 Score =   299 bits (765),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKL VKLYRFLVRRT SKFN VILKRLFMSK N+ PLSLSRL+ F +GKEDKIAVL
Sbjct  22   DDVYLKLTVKLYRFLVRRTNSKFNGVILKRLFMSKVNRAPLSLSRLVEFMTGKEDKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSH+KPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  142  KNSREAVKHFGPAPGVPHSHSKPYVRAKGRKFEKARGKRKSRGFKV  187



>ref|XP_011079632.1| PREDICTED: 60S ribosomal protein L18-2 [Sesamum indicum]
 ref|XP_011084062.1| PREDICTED: 60S ribosomal protein L18-2 [Sesamum indicum]
Length=187

 Score =   299 bits (765),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRTGS+FNAV+LKRLFMS+ N+PPLSLSRLIS  +GKEDKIAVL
Sbjct  22   NDIYLKLLVKLYRFLVRRTGSRFNAVVLKRLFMSRVNRPPLSLSRLISLMNGKEDKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG++TDD+R +EVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRG 
Sbjct  82   VGSVTDDIRVHEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGS  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            + +REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+RNS+G++V
Sbjct  142  RKAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSKGFRV  187



>ref|XP_011079633.1| PREDICTED: 60S ribosomal protein L18-2-like [Sesamum indicum]
Length=187

 Score =   298 bits (764),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRTGS+FNAV+LKRLFMS+ N+PPLSLSRLIS  +GKEDKIAVL
Sbjct  22   NDIYLKLLVKLYRFLVRRTGSRFNAVVLKRLFMSRVNRPPLSLSRLISLMNGKEDKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG++TDD+R +EVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRG 
Sbjct  82   VGSVTDDMRVHEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGS  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            + +REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+RNS+G++V
Sbjct  142  RKAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSKGFRV  187



>ref|XP_009402513.1| PREDICTED: 60S ribosomal protein L18-2-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   298 bits (764),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKFNAVIL+RLFMSK N+PP+SL RLI+F  GK+DKIAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSKFNAVILRRLFMSKINRPPISLKRLITFMQGKDDKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R YEVPA+KV ALRFT+TARARI KAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDKRVYEVPAMKVTALRFTETARARILKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVPHSHTKPYVR+KGRK+ERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGKAPGVPHSHTKPYVRSKGRKYERARGRRNSRGFRV  187



>gb|KJB82634.1| hypothetical protein B456_013G206100 [Gossypium raimondii]
Length=184

 Score =   298 bits (763),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 157/166 (95%), Gaps = 3/166 (2%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVK+YRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F  GK   IAV+
Sbjct  22   DDIYLKLLVKIYRFLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKGK---IAVV  78

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  79   VGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  138

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR++GRKFERARG+RNS+G++V
Sbjct  139  KNAREAVKHFGPAPGVPHSHTKPYVRSRGRKFERARGRRNSKGFRV  184



>ref|XP_002882427.1| hypothetical protein ARALYDRAFT_477850 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58686.1| hypothetical protein ARALYDRAFT_477850 [Arabidopsis lyrata subsp. 
lyrata]
Length=187

 Score =   298 bits (763),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVL
Sbjct  22   DDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSH+KPYVR KGRKFE+ARG+R SRG+KV
Sbjct  142  KNSREAVKHFGPAPGVPHSHSKPYVRGKGRKFEKARGRRKSRGFKV  187



>ref|XP_004984437.1| PREDICTED: 60S ribosomal protein L18-2-like [Setaria italica]
Length=187

 Score =   298 bits (763),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+PPLSL RL++F  GKE++IAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTKSDFNAVILKRLFMSKTNRPPLSLRRLVNFMKGKENQIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R YEVPA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDKRVYEVPAMKVAALRFTETARARIVNAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFE+ARG+RNSRG+KV
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFEKARGRRNSRGFKV  187



>ref|XP_010273829.1| PREDICTED: 60S ribosomal protein L18-2-like [Nelumbo nucifera]
Length=187

 Score =   298 bits (763),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMS+ NKPP+SLSRLI F  GKEDKIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSRVNKPPISLSRLIKFMKGKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG +TDD R YE+PALKV ALRFT+TARARI KAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGAVTDDTRVYELPALKVTALRFTETARARILKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGY  153
            KN+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+RNSRG+
Sbjct  142  KNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGF  185



>gb|KFK26512.1| hypothetical protein AALP_AA8G258600 [Arabis alpina]
Length=187

 Score =   298 bits (762),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK NK PLSLSRL  F  GKEDKIAVL
Sbjct  22   DDVYLKLLVKLYRFLVRRSDSKFNAVILKRLFMSKVNKAPLSLSRLAEFLKGKEDKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PALKV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTITDDLRVHEIPALKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSH+KPYVR+KGRKFE+ARG+R SRG+KV
Sbjct  142  KNSREAVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGRRKSRGFKV  187



>ref|XP_009417724.1| PREDICTED: 60S ribosomal protein L18-2 [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   298 bits (762),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+PP+SL RLI+F +GK+DKIAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRPPISLKRLITFMNGKDDKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R YEVPA+KV ALRFT+TARARI KAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDKRVYEVPAMKVTALRFTETARARILKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+R SRG++V
Sbjct  142  KNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRKSRGFRV  187



>emb|CDY18813.1| BnaAnng02780D [Brassica napus]
Length=249

 Score =   300 bits (767),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVL
Sbjct  84   DDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVL  143

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  144  VGTITDDLRVHEIPAIKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  203

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSH+KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  204  KNSREAVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  249



>ref|XP_009384409.1| PREDICTED: 60S ribosomal protein L18-2 [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   297 bits (761),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+PP+SL RLI+F +GK++KIAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRPPISLKRLITFMNGKDNKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R YEVPALKV ALRFT+TARARI KAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDKRVYEVPALKVTALRFTETARARILKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAV+HFG APGVPHSHTKPY+R+KGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVRHFGKAPGVPHSHTKPYIRSKGRKFERARGRRNSRGFRV  187



>ref|XP_002465302.1| hypothetical protein SORBIDRAFT_01g035860 [Sorghum bicolor]
 gb|EER92300.1| hypothetical protein SORBIDRAFT_01g035860 [Sorghum bicolor]
Length=187

 Score =   297 bits (761),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+PPLSL RL++F  GKE++IAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRPPLSLRRLVNFMEGKENQIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R YEVPA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDKRVYEVPAMKVAALRFTETARARIVNAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187



>ref|XP_002512455.1| 60S ribosomal protein L18, putative [Ricinus communis]
 gb|EEF49907.1| 60S ribosomal protein L18, putative [Ricinus communis]
Length=403

 Score =   305 bits (781),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI+F  GKE K AV+
Sbjct  238  DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKAPLSLSRLITFMKGKESKTAVV  297

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV AL+FT+TARARIEKAGGECLTFDQLA+RAPLGQNTVLLRGP
Sbjct  298  VGTVTDDIRVYEVPALKVTALKFTETARARIEKAGGECLTFDQLAMRAPLGQNTVLLRGP  357

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  358  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  403



>ref|XP_009124870.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=187

 Score =   297 bits (761),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVL
Sbjct  22   DDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL +PLGQNTVLLRGP
Sbjct  82   VGTITDDLRVHEIPAIKVTALRFTERARARIEKAGGECLTFDQLALSSPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSH+KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  142  KNSREAVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  187



>ref|XP_004494383.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score =   296 bits (759),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK NKPPLSLSRLI F  GKE KIAV+
Sbjct  22   NDIYLKLLVKLYRFLVRRTESSFNAVILKRLFMSKVNKPPLSLSRLIRFMKGKEGKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG +TDD+R YEVPA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGAVTDDIRVYEVPAIKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARG+R SRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV  187



>ref|XP_009411663.1| PREDICTED: 60S ribosomal protein L18-3-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   296 bits (758),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+PP+SL RLI+F +GK++KIAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRPPISLKRLITFMNGKDNKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R YEVPALKV ALRFT+TARARI KAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDKRVYEVPALKVTALRFTETARARILKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVPHS+TKPYVR+KGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGKAPGVPHSNTKPYVRSKGRKFERARGRRNSRGFRV  187



>ref|XP_008810211.1| PREDICTED: 60S ribosomal protein L18-2-like [Phoenix dactylifera]
Length=187

 Score =   296 bits (758),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+PP+SL RLI F  GKEDKI V+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRPPISLKRLIRFMEGKEDKIVVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R YEVPA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDKRVYEVPAMKVTALRFTETARARILNAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGLAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>ref|XP_002874343.1| 60S ribosomal protein L18 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50602.1| 60S ribosomal protein L18 [Arabidopsis lyrata subsp. lyrata]
Length=187

 Score =   296 bits (758),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVL
Sbjct  22   DDVYLKLLVKLYRFLVRRSESKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL+APLGQNTVLLRGP
Sbjct  82   VGTITDDLRVHEIPAIKVTALRFTERARARIEKAGGECLTFDQLALKAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHS TKPYVR KGRKFE+ARGKR SRG+KV
Sbjct  142  KNSREAVKHFGPAPGVPHSSTKPYVRHKGRKFEKARGKRKSRGFKV  187



>ref|XP_010914484.1| PREDICTED: 60S ribosomal protein L18-3 [Elaeis guineensis]
Length=187

 Score =   296 bits (758),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPP+SL RL  F  GK+DKIAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKPPISLKRLAKFMEGKDDKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R YEVPA+KV ALRFT+T RARI KAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDKRVYEVPAMKVTALRFTETVRARILKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHS TKPYVR+KGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSRTKPYVRSKGRKFERARGRRNSRGFRV  187



>emb|CDY40718.1| BnaC03g34340D [Brassica napus]
Length=227

 Score =   297 bits (761),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVL
Sbjct  62   DDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVL  121

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  122  VGTITDDLRVHEIPAIKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  181

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFG APGVPHSH+KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  182  KNSREAVKHFGRAPGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  227



>ref|XP_002461201.1| hypothetical protein SORBIDRAFT_02g042750 [Sorghum bicolor]
 gb|EER97722.1| hypothetical protein SORBIDRAFT_02g042750 [Sorghum bicolor]
Length=187

 Score =   296 bits (757),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+PPLS+ RL+ F  GK D+IAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRPPLSMRRLVKFMEGKSDQIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R  EVPA+KVCALRFT+TARARI  AGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDKRINEVPAMKVCALRFTETARARIINAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187



>ref|XP_008784768.1| PREDICTED: 60S ribosomal protein L18-2-like [Phoenix dactylifera]
Length=187

 Score =   295 bits (756),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+PP+SL RL++F  GK+DKIAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRPPISLKRLVTFMQGKDDKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R YEVPA+KV ALRFT+TARARI KAGGECLTFDQLAL++PLGQNTVLLRGP
Sbjct  82   VGTVTDDKRVYEVPAMKVTALRFTETARARILKAGGECLTFDQLALQSPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  142  KNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  187



>ref|NP_198137.1| 60S ribosomal protein L18-3 [Arabidopsis thaliana]
 sp|Q940B0.1|RL183_ARATH RecName: Full=60S ribosomal protein L18-3 [Arabidopsis thaliana]
 gb|AAL07220.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AAM67529.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AAN31854.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AED93736.1| 60S ribosomal protein L18-3 [Arabidopsis thaliana]
Length=187

 Score =   295 bits (756),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRR+ S FNAVILKRLFMSK NK PLSLSRL+ F +GK+DKIAVL
Sbjct  22   DDVYLKLLVKLYRFLVRRSNSNFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKDDKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHS+TKPYVR KGRKFE+ARGKR SRG+KV
Sbjct  142  KNSREAVKHFGPAPGVPHSNTKPYVRHKGRKFEKARGKRKSRGFKV  187



>emb|CBI36879.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   299 bits (766),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRL+ +  GKE KIAV+
Sbjct  132  DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLVRYMDGKEGKIAVV  191

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVP LKV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  192  VGTVTDDLRVYEVPCLKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  251

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  252  KNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  297



>gb|AFK45456.1| unknown [Lotus japonicus]
Length=187

 Score =   295 bits (756),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRTGS FN+VILKRLFMSK NK PLSLSRLI +T GKE KIAV+
Sbjct  22   NDIYLKLLVKLYRFLVRRTGSNFNSVILKRLFMSKVNKAPLSLSRLIRYTKGKEGKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLAL APLGQNTVLLRGP
Sbjct  82   VGAVTDDIRVYEVPALKVAALRFTETARARIEKAGGECLTFDQLALIAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+ GRKFE+ARGKRNS+G++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSNGRKFEKARGKRNSKGFRV  187



>ref|XP_009151179.1| PREDICTED: 60S ribosomal protein L18-2 [Brassica rapa]
Length=187

 Score =   295 bits (755),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F  GK+ KIAVL
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMKGKDGKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLGQNTVLLRGP
Sbjct  82   VGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSH+KPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  142  KNSREAVKHFGPAPGVPHSHSKPYVRAKGRKFEKARGKRKSRGFKV  187



>emb|CDY66803.1| BnaAnng22990D, partial [Brassica napus]
Length=200

 Score =   295 bits (756),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F +GK+ KIAVL
Sbjct  35   DDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMNGKDGKIAVL  94

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLGQNTVLLRGP
Sbjct  95   VGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLGQNTVLLRGP  154

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSH+KPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  155  KNSREAVKHFGPAPGVPHSHSKPYVRAKGRKFEKARGKRKSRGFKV  200



>ref|XP_006408052.1| hypothetical protein EUTSA_v10021598mg [Eutrema salsugineum]
 gb|ESQ49505.1| hypothetical protein EUTSA_v10021598mg [Eutrema salsugineum]
Length=187

 Score =   295 bits (754),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKL VKLYRFL RRT SKFN VILKRLFMSK NK PLSLSRL+ F +GKEDKIAVL
Sbjct  22   DDVYLKLTVKLYRFLFRRTNSKFNGVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTITDDLRVHEIPAIKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSH+KPYVR+ GRKFE+ARGKR SRG+KV
Sbjct  142  KNSREAVKHFGPAPGVPHSHSKPYVRSTGRKFEKARGKRKSRGFKV  187



>gb|EMS45435.1| 60S ribosomal protein L18-2 [Triticum urartu]
Length=187

 Score =   294 bits (753),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRT S+FNAVILKRLFMSKTN+PPLS+ RL+ F  GKEDKIAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTKSQFNAVILKRLFMSKTNRPPLSMRRLVRFMEGKEDKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD R YE+PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLGQNT+LLRGP
Sbjct  82   VGTITDDQRVYEIPAMKVAALRFTETARARIVNAGGECLTFDQLALRAPLGQNTLLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  142  KNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187



>ref|XP_010269589.1| PREDICTED: 60S ribosomal protein L18-3 [Nelumbo nucifera]
Length=187

 Score =   294 bits (753),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMS+ NK P+SLSRLI +  GKE+KIAVL
Sbjct  22   NDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSRVNKAPMSLSRLIRYMEGKENKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R Y+VPALKV ALRFT+TARARI KAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDTRVYDVPALKVTALRFTETARARILKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>ref|XP_009129884.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=222

 Score =   295 bits (754),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F  GK+ KIAVL
Sbjct  57   DDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMKGKDGKIAVL  116

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLGQNTVLLRGP
Sbjct  117  VGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLGQNTVLLRGP  176

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSH+KPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  177  KNSREAVKHFGPAPGVPHSHSKPYVRAKGRKFEKARGKRKSRGFKV  222



>ref|XP_009111741.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=187

 Score =   293 bits (751),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F  GK+ KIAVL
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMKGKDGKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLGQNTVLLRGP
Sbjct  82   VGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFG APGVPHSHTKPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  142  KNSREAVKHFGKAPGVPHSHTKPYVRAKGRKFEKARGKRKSRGFKV  187



>emb|CDY19736.1| BnaA09g03890D [Brassica napus]
Length=215

 Score =   294 bits (753),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F  GK+ KIAVL
Sbjct  50   DDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMKGKDGKIAVL  109

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLGQNTVLLRGP
Sbjct  110  VGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLGQNTVLLRGP  169

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFG APGVPHSHTKPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  170  KNSREAVKHFGKAPGVPHSHTKPYVRAKGRKFEKARGKRKSRGFKV  215



>ref|XP_006298640.1| hypothetical protein CARUB_v10014730mg [Capsella rubella]
 gb|EOA31538.1| hypothetical protein CARUB_v10014730mg [Capsella rubella]
Length=187

 Score =   293 bits (750),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F  GKEDKIAVL
Sbjct  22   DDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMEGKEDKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDDVR +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNT+LLRGP
Sbjct  82   VGTVTDDVRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTILLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFG APGVPHS TKPYVR KGRKFE+ARGKR SRG+KV
Sbjct  142  KNSREAVKHFGLAPGVPHSDTKPYVRHKGRKFEKARGKRKSRGFKV  187



>ref|XP_010429374.1| PREDICTED: 60S ribosomal protein L18-3-like [Camelina sativa]
Length=187

 Score =   293 bits (750),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK P+SLSRL+ F SGKEDKIAVL
Sbjct  22   DDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKAPISLSRLVEFMSGKEDKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNT+LLRGP
Sbjct  82   VGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTILLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFG APGVPHS TKPYVR KGRKFE+ARGKR SRG+KV
Sbjct  142  KNSREAVKHFGLAPGVPHSDTKPYVRHKGRKFEKARGKRKSRGFKV  187



>ref|NP_001131538.1| uncharacterized protein LOC100192878 [Zea mays]
 gb|ACG24841.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG31936.1| 60S ribosomal protein L18 [Zea mays]
 tpg|DAA64098.1| TPA: ribosomal protein L18 [Zea mays]
Length=187

 Score =   293 bits (750),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+PPLS+ RL+ F  GK D+IAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRPPLSMRRLVRFMEGKGDQIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R  EVPA+KVCALRFT+TARARI  AGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDKRISEVPAMKVCALRFTETARARIINAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAV+HFGPAPGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  142  KNAREAVRHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187



>ref|XP_010486014.1| PREDICTED: 60S ribosomal protein L18-3 [Camelina sativa]
Length=187

 Score =   293 bits (750),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F SGKEDKIAVL
Sbjct  22   DDVYLKLTVKLYRFLVRRTESKFNAVILKRLFMSKVNKAPLSLSRLVEFMSGKEDKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNT+LLRGP
Sbjct  82   VGTVTDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTILLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFG APGVPHS TKPYVR KGRKFE+ARGKR SRG+KV
Sbjct  142  KNSREAVKHFGLAPGVPHSDTKPYVRHKGRKFEKARGKRKSRGFKV  187



>ref|XP_010464086.1| PREDICTED: 60S ribosomal protein L18-3-like [Camelina sativa]
Length=187

 Score =   293 bits (749),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F SGKEDKIAVL
Sbjct  22   DDVYLKLTVKLYRFLVRRTESKFNAVILKRLFMSKVNKAPLSLSRLVEFMSGKEDKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R +E+PA+K+ ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNT+LLRGP
Sbjct  82   VGTVTDDLRVHEIPAMKITALRFTERARARIEKAGGECLTFDQLALRAPLGQNTILLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFG APGVPHS TKPYVR KGRKFE+ARGKR SRG+KV
Sbjct  142  KNSREAVKHFGLAPGVPHSDTKPYVRHKGRKFEKARGKRKSRGFKV  187



>ref|XP_009381102.1| PREDICTED: 60S ribosomal protein L18-2-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   293 bits (749),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSK N+PP+SL RLI+F   K+DKIAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTESKFNAVILKRLFMSKNNRPPISLKRLITFMERKDDKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R Y+VPA+KV ALRFT+TARARI KAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDKRVYDVPAMKVTALRFTETARARILKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  142  KNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>emb|CDX99969.1| BnaC09g03320D [Brassica napus]
Length=210

 Score =   293 bits (751),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F  GK+ KIAVL
Sbjct  45   DDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMKGKDGKIAVL  104

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLGQNTVLLRGP
Sbjct  105  VGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLGQNTVLLRGP  164

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFG APGVPHSHTKPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  165  KNSREAVKHFGKAPGVPHSHTKPYVRAKGRKFEKARGKRKSRGFKV  210



>ref|XP_006855263.1| hypothetical protein AMTR_s00183p00048560 [Amborella trichopoda]
 gb|ERN16730.1| hypothetical protein AMTR_s00183p00048560 [Amborella trichopoda]
Length=187

 Score =   292 bits (748),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = -1

Query  641  DVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLV  462
            DVYLK+LVKLYRFLVRRTGSKFNAVILKRLFMSK NK PLSLSRLI F +GKEDK+AV+V
Sbjct  23   DVYLKILVKLYRFLVRRTGSKFNAVILKRLFMSKVNKAPLSLSRLIKFMAGKEDKVAVIV  82

Query  461  GTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPK  282
            GT+TDD R YEVPALKV ALRFT+ ARARI KAGGECLTFD LALRAPLG+NTVLLRGPK
Sbjct  83   GTVTDDTRVYEVPALKVTALRFTERARARILKAGGECLTFDDLALRAPLGRNTVLLRGPK  142

Query  281  NSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            N+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+RNSRG++V
Sbjct  143  NAREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>gb|EMT12638.1| 60S ribosomal protein L18-2 [Aegilops tauschii]
Length=187

 Score =   292 bits (747),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRT S+FNAVILKRLFMSKTN+PPLS+ RL+ F  GK DKIAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTKSQFNAVILKRLFMSKTNRPPLSMRRLVRFMEGKADKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD R YE+PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLGQNT+LLRGP
Sbjct  82   VGTITDDQRVYEIPAMKVAALRFTETARARIVNAGGECLTFDQLALRAPLGQNTLLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  142  KNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187



>ref|XP_004494578.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score =   292 bits (747),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK N+PPLSLSRLI +  GKE KI V+
Sbjct  22   NDIYLKLLVKLYRFLVRRTDSNFNAVILKRLFMSKVNRPPLSLSRLIKYMQGKEGKIGVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG +TDD+R Y+VPA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGAVTDDIRVYDVPAIKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARG+R SRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV  187



>ref|XP_006394935.1| hypothetical protein EUTSA_v10004865mg [Eutrema salsugineum]
 gb|ESQ32221.1| hypothetical protein EUTSA_v10004865mg [Eutrema salsugineum]
Length=230

 Score =   293 bits (749),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRR+GSKFNAVILKRLFMSK NK PLSLSRL++F  GKE KIAVL
Sbjct  65   DDVYLKLLVKLYRFLVRRSGSKFNAVILKRLFMSKVNKAPLSLSRLVTFMKGKEGKIAVL  124

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL+APLGQNTVLLRGP
Sbjct  125  VGTITDDLRIHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALKAPLGQNTVLLRGP  184

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFG APGVPHS+TKPYVR+KGRKFE+ARG+R SRG+KV
Sbjct  185  KNSREAVKHFGLAPGVPHSNTKPYVRSKGRKFEKARGRRKSRGFKV  230



>ref|XP_006288739.1| hypothetical protein CARUB_v10002048mg [Capsella rubella]
 gb|EOA21637.1| hypothetical protein CARUB_v10002048mg [Capsella rubella]
Length=187

 Score =   290 bits (743),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK NK PLSLS+L+SF  GK+ KI VL
Sbjct  22   DDVYLKLLVKLYRFLVRRSNSKFNAVILKRLFMSKVNKAPLSLSKLVSFMEGKDGKIGVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R  E+PA+K+ ALRFT+ ARARIEKAGGECLTFDQLAL+APLGQNTVLLRGP
Sbjct  82   VGTITDDLRIQEIPAMKITALRFTERARARIEKAGGECLTFDQLALKAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHS TKPYVRAKGRKFE+ARG+R SRG+KV
Sbjct  142  KNSREAVKHFGPAPGVPHSSTKPYVRAKGRKFEKARGRRKSRGFKV  187



>ref|XP_010455077.1| PREDICTED: 60S ribosomal protein L18-3-like isoform X1 [Camelina 
sativa]
Length=187

 Score =   290 bits (742),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK NK PLSLS+L+SF +GK+ KI VL
Sbjct  22   DDVYLKLLVKLYRFLVRRSESKFNAVILKRLFMSKVNKAPLSLSKLVSFMNGKDGKIGVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +++PA+K+ ALRFT+ ARARIEKAGGECLTFDQLAL+APLGQNTVLLRGP
Sbjct  82   VGTITDDLRVHDIPAMKITALRFTERARARIEKAGGECLTFDQLALKAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSHTKPYVR +GRKFE+ARG+R SRG+KV
Sbjct  142  KNSREAVKHFGPAPGVPHSHTKPYVRGRGRKFEKARGRRKSRGFKV  187



>ref|XP_010421566.1| PREDICTED: 60S ribosomal protein L18-2-like [Camelina sativa]
Length=187

 Score =   290 bits (742),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK NK PLSLS+L+SF +GK+ KI VL
Sbjct  22   DDVYLKLLVKLYRFLVRRSESKFNAVILKRLFMSKVNKAPLSLSKLVSFMNGKDGKIGVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +++PA+K+ ALRFT+ ARARIEKAGGECLTFDQLAL+APLGQNTVLLRGP
Sbjct  82   VGTITDDLRVHDIPAMKITALRFTERARARIEKAGGECLTFDQLALKAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSH+KPYVR KGRKFE+ARG+R SRG+KV
Sbjct  142  KNSREAVKHFGPAPGVPHSHSKPYVRGKGRKFEKARGRRKSRGFKV  187



>ref|XP_007050975.1| Ribosomal protein L18 isoform 2 [Theobroma cacao]
 gb|EOX95132.1| Ribosomal protein L18 isoform 2 [Theobroma cacao]
Length=180

 Score =   290 bits (741),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 152/166 (92%), Gaps = 7/166 (4%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPPLSLSRLI F   KEDKIAV+
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIEFMKCKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNT      
Sbjct  82   VGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNT------  135

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
             NSREAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+RNS+G++V
Sbjct  136  -NSREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSKGFRV  180



>gb|KFK37967.1| hypothetical protein AALP_AA3G053100 [Arabis alpina]
Length=187

 Score =   290 bits (741),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKL VKLYRFLVRRT S FN VILKRLFMSK NK PLSLSRL+   SGK+DKIAVL
Sbjct  22   DDVYLKLTVKLYRFLVRRTQSNFNKVILKRLFMSKVNKAPLSLSRLVELMSGKDDKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDDVR +++PA+KV ALRFT+ ARARI KAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTITDDVRVHDIPAIKVAALRFTERARARIVKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSH+KPYVR+KGRKFE+ARG+R SRG+KV
Sbjct  142  KNSREAVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGRRKSRGFKV  187



>ref|XP_003562459.1| PREDICTED: 60S ribosomal protein L18-3-like [Brachypodium distachyon]
Length=187

 Score =   289 bits (740),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+PPLS+ RL+ F  GK D+IAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTKSHFNAVILKRLFMSKTNRPPLSMRRLVRFMEGKGDQIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD R YE+PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLGQNT+LLRGP
Sbjct  82   VGTITDDKRVYEIPAMKVAALRFTETARARIVNAGGECLTFDQLALRAPLGQNTLLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  142  KNAREAVRHFGAAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187



>emb|CDX80616.1| BnaC07g28280D [Brassica napus]
Length=232

 Score =   291 bits (744),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F  GK+ KIAVL
Sbjct  67   DDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMKGKDGKIAVL  126

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLGQNTVLLRGP
Sbjct  127  VGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLGQNTVLLRGP  186

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFG APGVPHSH+KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  187  KNSREAVKHFGLAPGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  232



>emb|CDY25018.1| BnaC02g39900D [Brassica napus]
Length=197

 Score =   289 bits (740),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK PLSLS+L  F  GK+ KIAVL
Sbjct  32   DDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLAEFMKGKDGKIAVL  91

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLGQNTVLLRGP
Sbjct  92   VGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLGQNTVLLRGP  151

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFG APGVPHSH+KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  152  KNSREAVKHFGLAPGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  197



>ref|NP_001050069.1| Os03g0341100 [Oryza sativa Japonica Group]
 gb|ABF95861.1| 60S ribosomal protein L18, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11983.1| Os03g0341100 [Oryza sativa Japonica Group]
 gb|EEC75232.1| hypothetical protein OsI_11506 [Oryza sativa Indica Group]
 gb|EEE59035.1| hypothetical protein OsJ_10788 [Oryza sativa Japonica Group]
Length=187

 Score =   288 bits (737),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKL+VKLYRFLVRRT S FNAVIL+RLFMSKTN+PPLSL RL+ F  GKE++IAV+
Sbjct  22   DDVYLKLIVKLYRFLVRRTKSPFNAVILRRLFMSKTNRPPLSLRRLVRFMEGKENQIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R YEVPA+KV ALRFT+TARARI   GGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDKRVYEVPAMKVAALRFTETARARIVNTGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHS+TKPYVR+KGRKFE+ARG+RNS+G+KV
Sbjct  142  KNAREAVKHFGPAPGVPHSNTKPYVRSKGRKFEKARGRRNSKGFKV  187



>ref|XP_010228645.1| PREDICTED: 60S ribosomal protein L18-2-like [Brachypodium distachyon]
Length=187

 Score =   288 bits (737),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRT + FNAVILKRLFMSKTN+PPLSL RL+ F  GKE++IAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTKNHFNAVILKRLFMSKTNRPPLSLRRLVKFMEGKENQIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD + YEVPA+KV ALRFT+TARARI  AGGECLTFDQLAL APLGQNTVLLRGP
Sbjct  82   VGTITDDKKVYEVPAMKVAALRFTETARARIVNAGGECLTFDQLALHAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  142  KNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187



>ref|XP_004958675.1| PREDICTED: 60S ribosomal protein L18-3-like [Setaria italica]
Length=187

 Score =   288 bits (737),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK N+ PLS+ RL+ F  GK D+IAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTKSPFNAVILKRLFMSKANRSPLSMRRLVKFMEGKGDQIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R  EVPA+KVCALRFT+TARARI  AGGECLTFDQLALRAPLGQNTV+LRGP
Sbjct  82   VGTVTDDKRITEVPAMKVCALRFTETARARIINAGGECLTFDQLALRAPLGQNTVILRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187



>gb|AFC88843.1| 60S ribosomal protein L18-3-like protein, partial [Miscanthus 
sinensis]
Length=166

 Score =   286 bits (733),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+ PLS+ RL+ F  GK D+IAV+
Sbjct  4    DDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRAPLSMRRLVKFMEGKGDQIAVI  63

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R  EVPA+KVCALRFT+TARARI  AGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  64   VGTVTDDKRINEVPAMKVCALRFTETARARIINAGGECLTFDQLALRAPLGQNTVLLRGP  123

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRG  156
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARG+RNSRG
Sbjct  124  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRG  166



>gb|ABK26318.1| unknown [Picea sitchensis]
Length=187

 Score =   287 bits (735),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRT S+FNAVILKRLFMSKTNKPPLSLSRL  +  GKEDKIAV+
Sbjct  22   EDIYLKLLVKLYRFLVRRTSSRFNAVILKRLFMSKTNKPPLSLSRLARYMQGKEDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD R YE+P +K+ ALRFT+TARARI KAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTITDDNRVYELPPVKITALRFTETARARILKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            K+ REAVKHFG APGVPHSHTKPYVR+KGRK+E ARG+RNSRG+KV
Sbjct  142  KSHREAVKHFGRAPGVPHSHTKPYVRSKGRKYEMARGRRNSRGFKV  187



>ref|XP_006650060.1| PREDICTED: 60S ribosomal protein L18-3-like [Oryza brachyantha]
Length=187

 Score =   286 bits (733),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +DVYLKL+VKLYRFLVRRT S FNAVIL+RLFMSKTN+PPLSL RL+ F  GKE++IAV+
Sbjct  22   EDVYLKLIVKLYRFLVRRTKSPFNAVILRRLFMSKTNRPPLSLRRLVRFMEGKENQIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R YEVPA+KV ALRFT+T RARI  AGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDKRVYEVPAMKVAALRFTETVRARIVNAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHS+TKPYVR+KGRKFE+ARG+RNS+G+KV
Sbjct  142  KNAREAVKHFGPAPGVPHSNTKPYVRSKGRKFEKARGRRNSKGFKV  187



>ref|XP_009629121.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana tomentosiformis]
Length=187

 Score =   286 bits (731),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK NK PLSLSRLI++  GKEDK+AV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSQFNAVILKRLFMSKINKAPLSLSRLITYMKGKEDKVAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDDVRAYEVP+LKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDVRAYEVPSLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFG APGVPHSHTKPYVRAKGRKFERARGKR SRG+KV
Sbjct  142  KNSREAVKHFGRAPGVPHSHTKPYVRAKGRKFERARGKRKSRGFKV  187



>ref|XP_010921627.1| PREDICTED: uncharacterized protein LOC105045157 [Elaeis guineensis]
Length=398

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK N+PP+SL RL++F  GK DKIAV+
Sbjct  233  DDVYLKLLVKLYRFLVRRTGSRFNAVILKRLFMSKINRPPISLKRLVTFMEGKGDKIAVI  292

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R Y+VPALKV ALRFT+TARARI KAGGECLTFD LALRAPLGQNTVLLRGP
Sbjct  293  VGTVTDDKRVYDVPALKVTALRFTETARARILKAGGECLTFDHLALRAPLGQNTVLLRGP  352

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  353  KNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  398



>gb|ABK21809.1| unknown [Picea sitchensis]
 gb|ABK26564.1| unknown [Picea sitchensis]
Length=187

 Score =   285 bits (729),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSKTNKPPLSLSRL  +  GK+DKIAV+
Sbjct  22   EDIYLKLLVKLYRFLVRRTSSSFNAVILKRLFMSKTNKPPLSLSRLARYMQGKDDKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD R YE+P +KV ALRFT+TARARI KAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTITDDNRVYELPPVKVTALRFTETARARILKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            K+ REAVKHFG APGVPHSHTKPYVR+KGRK+E ARG+RNSRG+KV
Sbjct  142  KSHREAVKHFGRAPGVPHSHTKPYVRSKGRKYEMARGRRNSRGFKV  187



>ref|XP_004247404.1| PREDICTED: 60S ribosomal protein L18-2 [Solanum lycopersicum]
Length=187

 Score =   285 bits (729),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFL RRTGSKFNAVILKRLFMSK NK PLSLSRL+++ +GKED IAV+
Sbjct  22   DDVYLKLLVKLYRFLSRRTGSKFNAVILKRLFMSKINKAPLSLSRLVTYMTGKEDNIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDDVRAYEVP +KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDVRAYEVPKIKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFG APGVPHSHTKPYVRAKGRKFERARGKRNSRGYK 
Sbjct  142  KNSREAVKHFGKAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKA  187



>ref|NP_001132852.1| uncharacterized protein LOC100194344 [Zea mays]
 gb|ACG24961.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG34787.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG39589.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACR34137.1| unknown [Zea mays]
 gb|AFW77275.1| ribosomal protein L18 [Zea mays]
 gb|AFW81439.1| ribosomal protein L18 [Zea mays]
 gb|AGS43131.1| hypothetical protein [Zea mays]
Length=187

 Score =   285 bits (729),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+PP+S+ RL+ F  GKE  IAV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRPPISMRRLVKFMEGKEKNIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R  EVPA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG+NTVLLRGP
Sbjct  82   VGTVTDDKRIQEVPAMKVTALRFTETARARIVNAGGECLTFDQLALRAPLGENTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  142  KNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187



>ref|XP_003591163.1| Ribosomal protein L18 [Medicago truncatula]
 gb|AES61414.1| 60S ribosomal protein L18-3 [Medicago truncatula]
Length=187

 Score =   285 bits (729),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T+GKE KIAV+
Sbjct  22   NDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIKYTNGKEGKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG ITDDVR  EVPA+KV ALRFT+ ARARIE AGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGAITDDVRVNEVPAIKVTALRFTERARARIESAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVP SHTKPYVR K RK E+ARGKR SRG++V
Sbjct  142  KNAREAVKHFGRAPGVPQSHTKPYVRGKSRKIEKARGKRKSRGFRV  187



>ref|XP_008656150.1| PREDICTED: 60S ribosomal protein L18-3-like [Zea mays]
Length=222

 Score =   286 bits (731),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+PP+S+ RL+ F  GKE  IAV+
Sbjct  57   DDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRPPISMRRLVKFMEGKEKNIAVI  116

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R  EVPA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG+NTVLLRGP
Sbjct  117  VGTVTDDKRIQEVPAMKVTALRFTETARARIVNAGGECLTFDQLALRAPLGENTVLLRGP  176

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  177  KNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  222



>emb|CDY05183.1| BnaC05g46200D [Brassica napus]
Length=223

 Score =   285 bits (730),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYL      YRFLVRRT SKFNAVILKRLFMSK NK PLSLSRL+ F +GKEDKIAVL
Sbjct  58   DDVYLSSPESFYRFLVRRTQSKFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKEDKIAVL  117

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PA+KV ALRFT+ ARA IEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  118  VGTITDDLRVHEIPAIKVTALRFTERARASIEKAGGECLTFDQLALRAPLGQNTVLLRGP  177

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSH+KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  178  KNSREAVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  223



>gb|ADD54595.1| putative ribosomal protein L18 [Linum usitatissimum]
Length=154

 Score =   283 bits (724),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -1

Query  608  RFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYE  429
            RFLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI FT GKE KIAV+VGTITDD+R Y+
Sbjct  1    RFLVRRTGSSFNAVILKRLFMSKVNKPPLSLSRLIRFTKGKEGKIAVVVGTITDDIRVYD  60

Query  428  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGP  249
            VPA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGP
Sbjct  61   VPAMKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGP  120

Query  248  APGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  121  APGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  154



>gb|EPS67068.1| hypothetical protein M569_07709, partial [Genlisea aurea]
Length=186

 Score =   284 bits (726),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRT SKFN V+LKRLFMS+ N+PPL LSRLI+   GKEDKIAVL
Sbjct  21   NDIYLKLLVKLYRFLVRRTESKFNGVVLKRLFMSRVNRPPLRLSRLIAHMKGKEDKIAVL  80

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD R +EVP LKV ALRFT+T RARIEKAGGECLTFDQLALRAPLGQNTVLLRG 
Sbjct  81   VGTITDDNRIHEVPPLKVTALRFTETVRARIEKAGGECLTFDQLALRAPLGQNTVLLRGS  140

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            +N+REAV+HFGPAPGVPHS TKPYVR+KGRKFERARG+RNSRG++V
Sbjct  141  RNAREAVRHFGPAPGVPHSSTKPYVRSKGRKFERARGRRNSRGFRV  186



>emb|CDY05559.1| BnaA02g31320D [Brassica napus]
Length=503

 Score =   295 bits (754),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK PLSLS+L+ F  GK+ KIAVL
Sbjct  57   DDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKAPLSLSKLVEFMKGKDGKIAVL  116

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECLTFDQLAL APLGQNTVLLRGP
Sbjct  117  VGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALVAPLGQNTVLLRGP  176

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSH+KPYVRAKGRKFE+ARGKR SRG+K+
Sbjct  177  KNSREAVKHFGPAPGVPHSHSKPYVRAKGRKFEKARGKRKSRGFKL  222



>ref|XP_006658116.1| PREDICTED: 60S ribosomal protein L18-3-like [Oryza brachyantha]
Length=187

 Score =   284 bits (726),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +DVY+KLLVKLYRFL RRT S FNAVILKRLFMSKTN+PPLS+ RL+ F  GK D+IAV+
Sbjct  22   EDVYVKLLVKLYRFLERRTKSHFNAVILKRLFMSKTNRPPLSMRRLVRFMEGKGDQIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R YEVPA+KV ALRFT+TA+ARI  AGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDKRVYEVPAMKVAALRFTETAKARIINAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHS+TKPYVR+KGRKFE+ARG+RNS+G+KV
Sbjct  142  KNAREAVKHFGPAPGVPHSNTKPYVRSKGRKFEKARGRRNSKGFKV  187



>ref|XP_002439318.1| hypothetical protein SORBIDRAFT_09g004290 [Sorghum bicolor]
 gb|EES17748.1| hypothetical protein SORBIDRAFT_09g004290 [Sorghum bicolor]
Length=188

 Score =   283 bits (725),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAV  468
            DDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+PP+SL RL+ F  GKE+K IAV
Sbjct  22   DDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRPPISLRRLVKFMEGKEEKNIAV  81

Query  467  LVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRG  288
            +VGT+TDD R  EVPA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG+NTVLLRG
Sbjct  82   IVGTVTDDKRIQEVPAMKVTALRFTETARARIVNAGGECLTFDQLALRAPLGENTVLLRG  141

Query  287  PKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            PKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  142  PKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188



>gb|AFC88838.1| 60S ribosomal protein L18-like protein [Miscanthus sinensis]
Length=188

 Score =   283 bits (725),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAV  468
            DDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+PP+SL RL+ F  GKE+K IAV
Sbjct  22   DDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRPPISLRRLVKFMEGKEEKNIAV  81

Query  467  LVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRG  288
            +VGT+TDD R  EVPA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG+NTVL+RG
Sbjct  82   IVGTVTDDKRIQEVPAMKVTALRFTETARARIVNAGGECLTFDQLALRAPLGENTVLMRG  141

Query  287  PKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            PKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  142  PKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188



>gb|EMT18368.1| 60S ribosomal protein L18-2 [Aegilops tauschii]
Length=188

 Score =   283 bits (725),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 154/167 (92%), Gaps = 1/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAV  468
            DDVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+PPLS+ RL +F  GKE+K IAV
Sbjct  22   DDVYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRPPLSMRRLSNFMKGKEEKNIAV  81

Query  467  LVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRG  288
            +VGTITDD+R  EVPA+KV ALRFT+TARARI  AGGECLTFDQLALRAP G+NT+LLRG
Sbjct  82   VVGTITDDMRIQEVPAMKVTALRFTETARARIINAGGECLTFDQLALRAPTGENTILLRG  141

Query  287  PKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            PKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  142  PKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188



>ref|XP_010524859.1| PREDICTED: 60S ribosomal protein L18-3 [Tarenaya hassleriana]
Length=187

 Score =   283 bits (724),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NK PLSLSRL+ F  GKEDKI V+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKAPLSLSRLVRFMQGKEDKIGVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDDVR YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDVRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R SRG+KV
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGFKV  187



>dbj|BAJ90421.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88976.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=188

 Score =   283 bits (724),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 154/167 (92%), Gaps = 1/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAV  468
            DDVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+PPLS+ RL +F  GKE+K IAV
Sbjct  22   DDVYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRPPLSMRRLSNFMKGKEEKNIAV  81

Query  467  LVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRG  288
            +VGTITDD+R  E+PA+KV ALRFT+TARARI  AGGECLTFDQLALRAP G+NT+LLRG
Sbjct  82   VVGTITDDMRIQEIPAMKVTALRFTETARARIVNAGGECLTFDQLALRAPTGENTILLRG  141

Query  287  PKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            PKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  142  PKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188



>gb|ABK22247.1| unknown [Picea sitchensis]
Length=187

 Score =   282 bits (721),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRT S+FNAVILKRLFMSKTNKPPLSLSRL  +  GK+DK+AV+
Sbjct  22   EDIYLKLLVKLYRFLVRRTSSRFNAVILKRLFMSKTNKPPLSLSRLARYMQGKDDKVAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD R YE+P +KV ALRFT+TARARI KAGGECLTFDQLAL APLGQNTVLLRGP
Sbjct  82   VGTITDDNRVYELPPVKVTALRFTETARARILKAGGECLTFDQLALCAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            K+ REAVKHFG APGVPHSHTKPYVR+KGRK+E ARG+RNSRG+KV
Sbjct  142  KSHREAVKHFGRAPGVPHSHTKPYVRSKGRKYEMARGRRNSRGFKV  187



>pdb|3J61|Q Chain Q, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAW50985.1| ribosomal protein L18 [Triticum aestivum]
Length=188

 Score =   281 bits (720),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAV  468
            DDVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+PPLS+ RL +F  GKE+K IAV
Sbjct  22   DDVYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRPPLSMRRLSNFMKGKEEKNIAV  81

Query  467  LVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRG  288
            +VGTITDD+R  EVPA+KV ALRFT+TARARI  AGGECLTFDQLALRAP G+NT+LLRG
Sbjct  82   VVGTITDDMRIQEVPAMKVTALRFTETARARIINAGGECLTFDQLALRAPTGENTILLRG  141

Query  287  PKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            PKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ RG+RNSRG+KV
Sbjct  142  PKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKVRGRRNSRGFKV  188



>ref|XP_003626231.1| 60S ribosomal protein L18 [Medicago truncatula]
 gb|ACJ85938.1| unknown [Medicago truncatula]
 gb|AES82449.1| 60S ribosomal protein L18-3 [Medicago truncatula]
 gb|AFK48984.1| unknown [Medicago truncatula]
Length=187

 Score =   281 bits (720),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK N+PP+SLS++I +  GK+ KI V+
Sbjct  22   NDIYLKLLVKLYRFLVRRTDSNFNAVILKRLFMSKVNRPPISLSKMIEYMKGKDGKIGVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG +TDD+R YEVP LK+ ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGAVTDDIRVYEVPVLKIAALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVPHSH+KPYVR+KGRK E+ARGKR SRG++V
Sbjct  142  KNAREAVKHFGRAPGVPHSHSKPYVRSKGRKQEKARGKRKSRGFRV  187



>gb|AGV54741.1| 60S ribosomal protein L18-3-like protein [Phaseolus vulgaris]
Length=222

 Score =   283 bits (723),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 157/201 (78%), Gaps = 35/201 (17%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGK-------  486
            +D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI +T GK       
Sbjct  22   NDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKPPLSLSRLIRYTKGKVCLSIFF  81

Query  485  ----------------------------EDKIAVLVGTITDDVRAYEVPALKVCALRFTK  390
                                        EDKIAV+VGTITDD+R YEVP LK+ AL+FT+
Sbjct  82   TSCTGVASSHIVLLIIAYISTFYFCQMLEDKIAVVVGTITDDIRVYEVPQLKITALKFTE  141

Query  389  TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYV  210
             ARARIEKAGGECLTFDQLALRAPLGQNTVL RGPKN+REAVKHFGPAPGVPHSH+KPYV
Sbjct  142  RARARIEKAGGECLTFDQLALRAPLGQNTVLFRGPKNAREAVKHFGPAPGVPHSHSKPYV  201

Query  209  RAKGRKFERARGKRNSRGYKV  147
            R+KGRKFE+ARG+RNSRG++V
Sbjct  202  RSKGRKFEKARGRRNSRGFRV  222



>ref|XP_006654064.1| PREDICTED: 60S ribosomal protein L18-2-like [Oryza brachyantha]
Length=188

 Score =   281 bits (718),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAV  468
            DDVYLKL+VKLYRFL RRT SKFNAVILKRLFMSKTN+PPLSL RL  F  GKE+K IAV
Sbjct  22   DDVYLKLIVKLYRFLYRRTKSKFNAVILKRLFMSKTNRPPLSLRRLAKFMEGKEEKNIAV  81

Query  467  LVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRG  288
            +VGT+TDD R  E+PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG+NTVLLRG
Sbjct  82   IVGTVTDDKRIQEIPAMKVTALRFTETARARIVNAGGECLTFDQLALRAPLGENTVLLRG  141

Query  287  PKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            PKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  142  PKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188



>ref|XP_010550997.1| PREDICTED: 60S ribosomal protein L18-3-like isoform X1 [Tarenaya 
hassleriana]
Length=187

 Score =   281 bits (718),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NK PLSLSRL++F  GKEDKI V+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSSFNAVILKRLFMSKVNKAPLSLSRLVNFMQGKEDKIGVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDDVR YEVPALKV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGTVTDDVRVYEVPALKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR  GRKFERARG+R SRG+KV
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRYTGRKFERARGRRKSRGFKV  187



>ref|XP_003568896.1| PREDICTED: 60S ribosomal protein L18-2-like [Brachypodium distachyon]
Length=188

 Score =   280 bits (717),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 154/167 (92%), Gaps = 1/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAV  468
            DDVYL+LLVKLYRFLVRRT SKFNAVILKRLFMSKTN+PPLS+ RL +F  GK++K IAV
Sbjct  22   DDVYLRLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRPPLSMRRLSNFMKGKDEKSIAV  81

Query  467  LVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRG  288
            +VGTITDD R  E+PA+KV ALRFT+TARARI  AGGECLTFDQLALRAP+G+NT+LLRG
Sbjct  82   IVGTITDDKRIQEIPAMKVTALRFTETARARIINAGGECLTFDQLALRAPMGENTILLRG  141

Query  287  PKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            PKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  142  PKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188



>ref|XP_004977069.1| PREDICTED: 60S ribosomal protein L18-2-like [Setaria italica]
Length=188

 Score =   280 bits (716),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAV  468
            DDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK N+PP+SL RL +F  GKE+K IAV
Sbjct  22   DDVYLKLLVKLYRFLVRRTKSSFNAVILKRLFMSKANRPPISLRRLANFMKGKEEKNIAV  81

Query  467  LVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRG  288
            +VGT+TDD R  E+PA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLG+NTVLLRG
Sbjct  82   IVGTVTDDKRIQEIPAMKVTALRFTETARARIINAGGECLTFDQLALRAPLGENTVLLRG  141

Query  287  PKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            PKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  142  PKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188



>ref|NP_001060617.1| Os07g0674700 [Oryza sativa Japonica Group]
 dbj|BAC83538.1| putative cytoplasmic ribosomal protein L18 [Oryza sativa Japonica 
Group]
 dbj|BAD31974.1| putative cytoplasmic ribosomal protein L18 [Oryza sativa Japonica 
Group]
 dbj|BAF22531.1| Os07g0674700 [Oryza sativa Japonica Group]
 gb|EAZ05118.1| hypothetical protein OsI_27311 [Oryza sativa Indica Group]
 dbj|BAG89915.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67806.1| hypothetical protein OsJ_25556 [Oryza sativa Japonica Group]
Length=195

 Score =   280 bits (715),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 154/174 (89%), Gaps = 8/174 (5%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGK-------  486
            +DVYLKL+VKLYRFLVRRT S FNAVILKRLFMSKTN+PPLS+ RL+ F  GK       
Sbjct  22   EDVYLKLIVKLYRFLVRRTKSHFNAVILKRLFMSKTNRPPLSMRRLVRFMEGKVPDRHAI  81

Query  485  -EDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQ  309
              D+IAV+VGT+TDD R YEVPA+KV ALRFT+TARARI  AGGECLTFDQLALRAPLGQ
Sbjct  82   SGDQIAVIVGTVTDDKRIYEVPAMKVAALRFTETARARIINAGGECLTFDQLALRAPLGQ  141

Query  308  NTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            NTVLLRGPKN+REAVKHFGPAPGVPHS+TKPYVR+KGRKFE+ARG+RNS+G+KV
Sbjct  142  NTVLLRGPKNAREAVKHFGPAPGVPHSNTKPYVRSKGRKFEKARGRRNSKGFKV  195



>gb|EMS65848.1| 60S ribosomal protein L18-2 [Triticum urartu]
Length=229

 Score =   281 bits (718),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 153/166 (92%), Gaps = 1/166 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAV  468
            +DVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+PPLS+ RL +F  GKE+K IAV
Sbjct  28   NDVYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRPPLSMRRLSNFMKGKEEKNIAV  87

Query  467  LVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRG  288
            +VGTITDD+R  EVPA+KV ALRFT+TARARI  AGGECLTFDQLALRAP G+NT+LLRG
Sbjct  88   VVGTITDDMRIQEVPAMKVTALRFTETARARIVNAGGECLTFDQLALRAPTGENTILLRG  147

Query  287  PKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            PKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+K
Sbjct  148  PKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFK  193



>ref|NP_001054688.1| Os05g0155100 [Oryza sativa Japonica Group]
 gb|AAV32218.1| cytoplasmic ribosomal protein L18 [Oryza sativa Japonica Group]
 dbj|BAF16602.1| Os05g0155100 [Oryza sativa Japonica Group]
 gb|EAY96610.1| hypothetical protein OsI_18515 [Oryza sativa Indica Group]
 gb|ABR25945.1| 60S ribosomal protein l18 [Oryza sativa Indica Group]
 dbj|BAG88175.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00211.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62383.1| hypothetical protein OsJ_17172 [Oryza sativa Japonica Group]
Length=188

 Score =   278 bits (712),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAV  468
            DDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+PPLSL RL  F  GKE+  IAV
Sbjct  22   DDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRPPLSLRRLAKFMEGKEENNIAV  81

Query  467  LVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRG  288
            +VGT+TDD R  E+P +KV ALRFT+TARARI  AGGECLTFDQLALRAPLG+NTVLLRG
Sbjct  82   IVGTVTDDKRIQEIPKMKVTALRFTETARARIVNAGGECLTFDQLALRAPLGENTVLLRG  141

Query  287  PKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            PKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  142  PKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188



>ref|XP_009611670.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   278 bits (711),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/165 (90%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = -1

Query  641  DVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLV  462
            DVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK NK PLSLSRLI++  GKEDK+ V+V
Sbjct  23   DVYLKLLVKLYRFLVRRTGSQFNAVILKRLFMSKINKAPLSLSRLITYMKGKEDKVVVVV  82

Query  461  GTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPK  282
            GT+TDDVRAYEVP+LKV ALRFTKTARARIEKAGGECLTFDQLALRAPLGQN VLLRGPK
Sbjct  83   GTVTDDVRAYEVPSLKVTALRFTKTARARIEKAGGECLTFDQLALRAPLGQNMVLLRGPK  142

Query  281  NSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            NSREAVKHFG APGVPHSHTKPYVRAKGRKFERARGKR SRG+KV
Sbjct  143  NSREAVKHFGRAPGVPHSHTKPYVRAKGRKFERARGKRKSRGFKV  187



>ref|XP_001781485.1| predicted protein [Physcomitrella patens]
 gb|EDQ53665.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   278 bits (711),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 152/166 (92%), Gaps = 1/166 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
             +VYLKLLVKLYRFLVRRT + FN+V+LKRLFMS+TN+ PLS+SRL+ + +GKE KIAVL
Sbjct  22   QNVYLKLLVKLYRFLVRRTDAPFNSVVLKRLFMSRTNRAPLSMSRLVKYMTGKEGKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDDVR +EVPALKVCALRFT+TARARI KAGGECLTFDQLALRAP G NTVLLRGP
Sbjct  82   VGTITDDVRQFEVPALKVCALRFTETARARILKAGGECLTFDQLALRAPTGSNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVP SH KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  142  KNAREAVKHFG-APGVPQSHAKPYVRSKGRKFEKARGRRNSRGFKV  186



>gb|KEH24393.1| 60S ribosomal protein L18-3 [Medicago truncatula]
Length=188

 Score =   278 bits (711),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKPPLSLSRLI +T GKE KIAV+
Sbjct  22   NDIYLKLLVKLYRFLVRRTESNFNKVILKRLFMSKVNKPPLSLSRLIRYTKGKEGKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG +TDD+R YEVPA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGAVTDDIRVYEVPAIKVTALRFTEKARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRA-KGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVPHS+TKPYVR  K RK E ARGKR SRG+KV
Sbjct  142  KNAREAVKHFGRAPGVPHSNTKPYVRGKKSRKVEAARGKRKSRGFKV  188



>ref|XP_001760902.1| predicted protein [Physcomitrella patens]
 gb|EDQ74291.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   277 bits (709),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 152/166 (92%), Gaps = 1/166 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
             +VYLKLLVKLYRFLVRRT + FN+V+LKRLFMS+ N+ PLS+SRL+ + +GK+DKIAVL
Sbjct  22   QNVYLKLLVKLYRFLVRRTDAPFNSVVLKRLFMSRINRAPLSMSRLVKYMAGKDDKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDDVR +EVPALKVCALRFT+TARARI KAGGECLTFDQLALRAP G NTVLLRGP
Sbjct  82   VGTITDDVRQFEVPALKVCALRFTETARARIVKAGGECLTFDQLALRAPTGANTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVP SH KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  142  KNAREAVKHFG-APGVPQSHAKPYVRSKGRKFEKARGRRNSRGFKV  186



>gb|AFK34017.1| unknown [Medicago truncatula]
Length=188

 Score =   276 bits (707),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKPPLSLSRLI +T GKE KIAV+
Sbjct  22   NDIYLKLLVKLYRFLVRRTESNFNKVILKRLFMSKVNKPPLSLSRLIRYTKGKEGKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG +TDD+R YEVPA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGAVTDDIRVYEVPAIKVTALRFTEKARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRA-KGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVPHS+TKPYVR  K RK E ARGKR SRG++V
Sbjct  142  KNAREAVKHFGRAPGVPHSNTKPYVRGKKSRKVEAARGKRKSRGFRV  188



>ref|XP_008789961.1| PREDICTED: uncharacterized protein LOC103707302 [Phoenix dactylifera]
Length=988

 Score =   298 bits (763),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK N+PP+SL RL++F  GKEDKIAV+
Sbjct  823  DDVYLKLLVKLYRFLVRRTGSRFNAVILKRLFMSKVNRPPISLKRLVTFMQGKEDKIAVI  882

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R YEVPA+KV ALRFT+TARARI KAGGEC TFDQLALR+PLGQNTVLLRGP
Sbjct  883  VGTVTDDKRVYEVPAMKVTALRFTETARARILKAGGECFTFDQLALRSPLGQNTVLLRGP  942

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  943  KNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  988



>dbj|BAJ93091.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=212

 Score =   277 bits (709),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = -1

Query  638  VYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLV  462
            VYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+PPLS+ RL +F  GKE+K IAV+V
Sbjct  48   VYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRPPLSMRRLSNFMKGKEEKNIAVVV  107

Query  461  GTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPK  282
            GTITDD+R  E+PA+KV ALRFT+TARARI  AGGECLTFDQLALRAP G+NT+LLRGPK
Sbjct  108  GTITDDMRIQEIPAMKVTALRFTETARARIVNAGGECLTFDQLALRAPTGENTILLRGPK  167

Query  281  NSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            N+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  168  NAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  212



>ref|XP_001751734.1| predicted protein [Physcomitrella patens]
 gb|EDQ83169.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   276 bits (705),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = -1

Query  641  DVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLV  462
            +VYLKLLVKLYRFLVRRT + FN+VILKRLFMS+TN+ PLS+SRL+ + +GK+DKIAVLV
Sbjct  23   NVYLKLLVKLYRFLVRRTDAPFNSVILKRLFMSRTNRAPLSMSRLVKYMAGKDDKIAVLV  82

Query  461  GTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPK  282
            GTITDDVR +EVPALKV ALRFT+TARARI KAGGECLTFDQLALRAP G NTVLLRGPK
Sbjct  83   GTITDDVRQFEVPALKVAALRFTETARARILKAGGECLTFDQLALRAPTGANTVLLRGPK  142

Query  281  NSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            N+REAVKHFG APGVP SH KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  143  NAREAVKHFG-APGVPQSHAKPYVRSKGRKFEKARGRRNSRGFKV  186



>gb|EYU46738.1| hypothetical protein MIMGU_mgv1a014520mg [Erythranthe guttata]
Length=187

 Score =   275 bits (704),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+Y+KLLVKLY FLVRRTGSKFN V+ KRL MS+ N+PPLSLSRL +   GKE++IAVL
Sbjct  22   DDIYIKLLVKLYSFLVRRTGSKFNEVVRKRLTMSRVNRPPLSLSRLSALMKGKENQIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG++TDD+R +E+PA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTV+LRG 
Sbjct  82   VGSVTDDIRVHEIPAMKVAALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVILRGS  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            + +REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+R SRG++V
Sbjct  142  RKAREAVRHFGAAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV  187



>gb|KIZ05100.1| 60S ribosomal protein L18-3 [Monoraphidium neglectum]
 gb|KIZ07537.1| 60S ribosomal protein L18-3 [Monoraphidium neglectum]
Length=187

 Score =   275 bits (703),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            D+VYLKLLVKLYRFL RRT S FNAV+LKRLFMSK N+PPLSLS+L  F +GKEDK+AVL
Sbjct  22   DNVYLKLLVKLYRFLERRTESNFNAVVLKRLFMSKINRPPLSLSKLAKFMAGKEDKVAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDDVR +EVP L+V ALRFT+TARARI KAGGECLTFDQLAL  P G++ VLLRGP
Sbjct  82   VGTVTDDVRLHEVPKLRVTALRFTETARARIVKAGGECLTFDQLALERPTGKDCVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            KN+REAVKHFGPAPGVPHS TKPYVR+KGRKFE+ARG+RNSRGYK
Sbjct  142  KNNREAVKHFGPAPGVPHSSTKPYVRSKGRKFEKARGRRNSRGYK  186



>sp|O65729.1|RL18_CICAR RecName: Full=60S ribosomal protein L18, partial [Cicer arietinum]
 emb|CAA06246.1| ribosomal protein L18 [Cicer arietinum]
Length=183

 Score =   274 bits (701),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 150/166 (90%), Gaps = 1/166 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK N+PPLSLSRLI +  GKE KI V+
Sbjct  19   NDIYLKLLVKLYRFLVRRTDSNFNAVILKRLFMSKVNRPPLSLSRLIKYMQGKEGKIGVV  78

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG +TDD+R Y+VP +KV AL+FT+TARARI+KAGGECLTFDQLALR PL  +TVLLRGP
Sbjct  79   VGAVTDDIRVYDVPTIKVTALKFTETARARIQKAGGECLTFDQLALRLPL-TDTVLLRGP  137

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARG+R SRG++V
Sbjct  138  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV  183



>ref|XP_004290808.1| PREDICTED: 60S ribosomal protein L18-2 [Fragaria vesca subsp. 
vesca]
Length=187

 Score =   271 bits (692),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
             D+YLKL VKLY F+ RRT S F+ VI  RL MSK NK PLSLSRL  +  G EDKIAVL
Sbjct  22   QDIYLKLTVKLYDFIHRRTKSHFSKVIRHRLCMSKVNKAPLSLSRLCRYMQGHEDKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDDVR  EVPALKV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNT+LLRGP
Sbjct  82   VGTVTDDVRIAEVPALKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTMLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARGKRNSRG++V
Sbjct  142  KNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKRNSRGFRV  187



>emb|CEF99132.1| Ribosomal protein L18e, conserved site [Ostreococcus tauri]
Length=186

 Score =   271 bits (692),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 147/166 (89%), Gaps = 1/166 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            D+VYLKLLVKLYRFL RRTGSKFN  +LKRLFMSKTN+PPLSLS+L  F  GKE K+A +
Sbjct  22   DNVYLKLLVKLYRFLARRTGSKFNETVLKRLFMSKTNRPPLSLSKLAKFMKGKEGKVAAV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDDVR ++VP LKVCALRFT+TARARI KAGGEC+TFDQLAL AP G+  VLLRGP
Sbjct  82   VGTITDDVRMFDVPKLKVCALRFTETARARIIKAGGECMTFDQLALAAPTGEGVVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFG APG+P SH KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  142  KNSREAVKHFG-APGIPGSHAKPYVRSKGRKFEKARGRRNSRGFKV  186



>ref|XP_001785869.1| predicted protein [Physcomitrella patens]
 gb|EDQ49322.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   268 bits (684),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 149/166 (90%), Gaps = 1/166 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            D+VYLKLLVKLYRFLVRRT + FN+V+LKRLFMS+ N+PP+S+SRL+ + +GKE KIAV+
Sbjct  22   DNVYLKLLVKLYRFLVRRTDAPFNSVVLKRLFMSRINRPPISMSRLVKYMTGKEGKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R YEVPALKV ALRFT+TARARI K+GGE LTFDQLALRAP G N VLLRGP
Sbjct  82   VGTVTDDTRIYEVPALKVAALRFTETARARILKSGGEVLTFDQLALRAPTGSNCVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KN+REAVKHFG APGVP SH KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  142  KNAREAVKHFG-APGVPQSHAKPYVRSKGRKFEKARGRRNSRGFKV  186



>ref|XP_001690885.1| ribosomal protein L18, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 ref|XP_010832938.1| PREDICTED: 60S ribosomal protein L18-2-like [Bison bison bison]
 gb|EDP05331.1| ribosomal protein L18 [Chlamydomonas reinhardtii]
Length=187

 Score =   266 bits (680),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
             +VYL LLVKLYRFLVRRT SKFN VILKRLFMSKTN+PPLSLS+L +F  GKE K+AV+
Sbjct  22   QNVYLALLVKLYRFLVRRTESKFNKVILKRLFMSKTNRPPLSLSKLAAFMKGKESKVAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            V T+TDDVR +EVP L+VCALRFT+TARARI KAGGECLTFDQLAL+ P G++ VLLRGP
Sbjct  82   VATVTDDVRLFEVPKLRVCALRFTETARARITKAGGECLTFDQLALQRPTGKDCVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            K+ REA KHFGPAPGVP S TKPYVRAKGRKFE+ARG+R SRG+KV
Sbjct  142  KSQREACKHFGPAPGVPGSTTKPYVRAKGRKFEKARGRRKSRGFKV  187



>ref|XP_002948325.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ50732.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=187

 Score =   265 bits (677),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
             +VYL LLVKLYRFLVRRT SKFN VILKRLFMSKTN+PPLSLS+L +F  GKE+K+AV+
Sbjct  22   QNVYLALLVKLYRFLVRRTDSKFNKVILKRLFMSKTNRPPLSLSKLATFMKGKENKVAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            V T+TDDVR YEVP L+V ALRFT+TARARI KAGGECLTFDQLAL  P G++ VLLRGP
Sbjct  82   VATVTDDVRLYEVPKLRVVALRFTETARARITKAGGECLTFDQLALERPTGKDCVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            K+ REAVKHFGPAPGVP S TKPYVRAKGRKFE+ARG+R SRG+KV
Sbjct  142  KSHREAVKHFGPAPGVPGSTTKPYVRAKGRKFEKARGRRKSRGFKV  187



>ref|XP_005843726.1| hypothetical protein CHLNCDRAFT_37334 [Chlorella variabilis]
 gb|EFN51624.1| hypothetical protein CHLNCDRAFT_37334 [Chlorella variabilis]
Length=187

 Score =   265 bits (677),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            ++ Y+KLLVKLYRFLVRRT S FN V+LKRLFMSKTN+PPLSLS+L+ F  GKE K+AVL
Sbjct  22   ENPYVKLLVKLYRFLVRRTESDFNKVVLKRLFMSKTNRPPLSLSKLVKFMEGKEGKLAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD R +EVP L+VCALR T+TARARI KAGGE +TFDQLAL AP G NTVLLRGP
Sbjct  82   VGTITDDTRLFEVPKLRVCALRVTETARARILKAGGEIITFDQLALIAPTGSNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            KNSREAVKHFGPAPGVP S  KPYVRAKGRKFERARG+R SRGYK
Sbjct  142  KNSREAVKHFGPAPGVPGSTAKPYVRAKGRKFERARGRRKSRGYK  186



>ref|XP_001419602.1| Ribosomal protein L18, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO97895.1| Ribosomal protein L18, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=186

 Score =   265 bits (676),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 145/165 (88%), Gaps = 1/165 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            D+VYLKLLVKLYRFL RRT SKFN  +LKRLFMSKTN+PPLSLS++  F  GKE K+A +
Sbjct  22   DNVYLKLLVKLYRFLARRTDSKFNDTVLKRLFMSKTNRPPLSLSKVAKFMKGKEGKVAAI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDDVR ++VPALKVCALRFT+TARARI KAGG+C+TFDQLAL AP G+  VLLRGP
Sbjct  82   VGTVTDDVRLHDVPALKVCALRFTETARARIIKAGGQCMTFDQLALSAPTGEGVVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            KNSREAVKHFG APGVP SH KPYVRAKGRKFE+ARG+R SRGYK
Sbjct  142  KNSREAVKHFG-APGVPGSHAKPYVRAKGRKFEKARGRRASRGYK  185



>ref|XP_001760959.1| predicted protein [Physcomitrella patens]
 gb|EDQ74348.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   265 bits (676),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = -1

Query  641  DVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLV  462
            +VYLKLLVKLYRFLVRRT + FNAV+LKRLFMS+ N+PP+S+SRL+ +  GKEDKIAV+V
Sbjct  23   NVYLKLLVKLYRFLVRRTDAPFNAVVLKRLFMSRINRPPISMSRLVRYMKGKEDKIAVIV  82

Query  461  GTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPK  282
            G++TDD R YEVPALKV ALRFT+TARARI K GGE LTFDQLALRAP G N VLLRGPK
Sbjct  83   GSVTDDTRIYEVPALKVAALRFTETARARILKNGGEVLTFDQLALRAPTGSNCVLLRGPK  142

Query  281  NSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            N+REAVKHFG APGVP SH KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  143  NAREAVKHFG-APGVPRSHAKPYVRSKGRKFEKARGRRNSRGFKV  186



>ref|XP_002985888.1| hypothetical protein SELMODRAFT_181978 [Selaginella moellendorffii]
 gb|EFJ13065.1| hypothetical protein SELMODRAFT_181978 [Selaginella moellendorffii]
Length=187

 Score =   263 bits (673),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            D+VYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+PP+SLSRL +    K  KIAVL
Sbjct  22   DNVYLKLLVKLYRFLVRRTNSKFNAVILKRLFMSKTNQPPVSLSRLSASMEKKSGKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R   VPA+ V ALRFT+TARARI  AGG+CLTFD+LAL AP G NTVLLRG 
Sbjct  82   VGTVTDDPRLAAVPAMTVVALRFTRTARARITNAGGKCLTFDELALLAPTGCNTVLLRGR  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            K++REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  142  KSAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  187



>ref|XP_002976425.1| hypothetical protein SELMODRAFT_267976 [Selaginella moellendorffii]
 gb|EFJ22685.1| hypothetical protein SELMODRAFT_267976 [Selaginella moellendorffii]
Length=187

 Score =   263 bits (673),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            D+VYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+PP+SLSRL +    K  KIAVL
Sbjct  22   DNVYLKLLVKLYRFLVRRTNSKFNAVILKRLFMSKTNQPPVSLSRLSASMEKKSGKIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R   VPA+ V ALRFT+TARARI  AGG+CLTFD+LAL AP G NTVLLRG 
Sbjct  82   VGTVTDDPRLATVPAMTVVALRFTRTARARITNAGGKCLTFDELALLAPTGCNTVLLRGR  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            K++REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  142  KSAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  187



>ref|XP_007510670.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18203.1| predicted protein [Bathycoccus prasinos]
Length=240

 Score =   265 bits (676),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 142/165 (86%), Gaps = 1/165 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            ++VYL LLVKLYRFL RRT SKFN  +LKRLFMSKTN+PPLSLS+L  F  GKE K+A +
Sbjct  76   ENVYLALLVKLYRFLARRTDSKFNQTVLKRLFMSKTNRPPLSLSKLAKFMKGKEGKVACV  135

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDDVR +EVP L VCALRFT TARARI KAGGECLTFDQLAL+AP G+  VLLRGP
Sbjct  136  VGTITDDVRMFEVPKLTVCALRFTATARARIVKAGGECLTFDQLALKAPTGEGVVLLRGP  195

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            KNSREAVKHFG APGVPHSH KPYV+ KGRKFE+ARG+R SRGYK
Sbjct  196  KNSREAVKHFG-APGVPHSHAKPYVQHKGRKFEKARGRRASRGYK  239



>gb|EYU21621.1| hypothetical protein MIMGU_mgv1a014504mg [Erythranthe guttata]
Length=187

 Score =   262 bits (669),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +DVY+KLLVKLYRFL RRTGS FN++ILKRL MS+ N+PPLSLSRL S   GKE +IAVL
Sbjct  22   NDVYIKLLVKLYRFLTRRTGSSFNSIILKRLIMSRVNRPPLSLSRLSSLMKGKEGQIAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG+ITDD+R +E+PA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRG 
Sbjct  82   VGSITDDIRVHEIPAMKVAALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGS  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            + +REAV+HFGPAPGVPHSHTKPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  142  RKAREAVRHFGPAPGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187



>gb|ACJ85943.1| unknown [Medicago truncatula]
 gb|AFK48653.1| unknown [Medicago truncatula]
Length=174

 Score =   259 bits (663),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKPPLSLSRLI +T GKE KIAV+
Sbjct  22   NDIYLKLLVKLYRFLVRRTESNFNKVILKRLFMSKVNKPPLSLSRLIRYTKGKEGKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG +TDD+R YEVPA+KV ALRFT+ ARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   VGAVTDDIRVYEVPAIKVTALRFTEKARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAK  201
            KN+REAVKHFG APGVPHS+TKPYVR K
Sbjct  142  KNAREAVKHFGRAPGVPHSNTKPYVRGK  169



>sp|O22254.3|RL181_ARATH RecName: Full=Putative 60S ribosomal protein L18-1 [Arabidopsis 
thaliana]
Length=188

 Score =   259 bits (661),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVK  R+LVRRT SKFNAVILKRLFMSK NK PLSLSRL+ +  GK+ KIAV+
Sbjct  22   DDVYLKLLVKANRYLVRRTESKFNAVILKRLFMSKVNKAPLSLSRLVRYMDGKDGKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAP-LGQNTVLLRG  288
            VGT+TDDVR  +VPAL V ALRFT++ARARI KAGGECLTFDQLAL  P   +NTVLLRG
Sbjct  82   VGTVTDDVRIEDVPALTVTALRFTESARARIHKAGGECLTFDQLALPCPTWSENTVLLRG  141

Query  287  PKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            PKN+REAVKHFGPAPGVPHSHTKPYVR  G+K E ARG+R SRG+KV
Sbjct  142  PKNTREAVKHFGPAPGVPHSHTKPYVRQTGKKIEIARGRRRSRGFKV  188



>gb|KFK32338.1| hypothetical protein AALP_AA6G228700 [Arabis alpina]
Length=197

 Score =   258 bits (658),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 141/166 (85%), Gaps = 2/166 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKL VKLYRFLVRRT S FN VILKRLFMSK NK P SLSRL+   SGK+DKIAVL
Sbjct  34   DDVYLKLTVKLYRFLVRRTQSNFNKVILKRLFMSKVNKAPFSLSRLVELMSGKDDKIAVL  93

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTI DDV  +++ A+KV ALRFT+ ARARI KAGG+CLTFDQLALRAPLGQNTV LRG 
Sbjct  94   VGTIIDDVSVHDILAIKVAALRFTERARARIVKAGGKCLTFDQLALRAPLGQNTVFLRGR  153

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFGPAPGVPHSH+KPYVR++GRKFE  R  R SR +KV
Sbjct  154  KNSREAVKHFGPAPGVPHSHSKPYVRSEGRKFETRR--RKSRRFKV  197



>ref|XP_003081305.1| ribosomal protein L18 (ISS) [Ostreococcus tauri]
Length=181

 Score =   254 bits (649),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 138/158 (87%), Gaps = 1/158 (1%)
 Frame = -1

Query  620  VKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDV  441
             +LYRFL RRTGSKFN  +LKRLFMSKTN+PPLSLS+L  F  GKE K+A +VGTITDDV
Sbjct  25   TQLYRFLARRTGSKFNETVLKRLFMSKTNRPPLSLSKLAKFMKGKEGKVAAVVGTITDDV  84

Query  440  RAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVK  261
            R ++VP LKVCALRFT+TARARI KAGGEC+TFDQLAL AP G+  VLLRGPKNSREAVK
Sbjct  85   RMFDVPKLKVCALRFTETARARIIKAGGECMTFDQLALAAPTGEGVVLLRGPKNSREAVK  144

Query  260  HFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            HFG APG+P SH KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  145  HFG-APGIPGSHAKPYVRSKGRKFEKARGRRNSRGFKV  181



>ref|XP_005643635.1| ribosomal protein L18 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE19091.1| ribosomal protein L18 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
Length=186

 Score =   254 bits (649),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 142/165 (86%), Gaps = 1/165 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            ++VYLKLLVKLY FLVRRT SKFN V+LKRLFMS+TN+PPLSLS+L +F  GKEDK AVL
Sbjct  22   ENVYLKLLVKLYTFLVRRTESKFNKVVLKRLFMSRTNRPPLSLSKLATFMKGKEDKTAVL  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            +GTITDDVR +EVP L V ALR T+TARARI  AGG+ LTFDQLAL AP G N VLLRGP
Sbjct  82   IGTITDDVRLFEVPKLTVVALRVTETARARILGAGGKILTFDQLALLAPTGSNCVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            KNSREAVKH G APGVPHSH KPYVR+KGRKFE+ARG+R SRGYK
Sbjct  142  KNSREAVKHRG-APGVPHSHAKPYVRSKGRKFEKARGRRKSRGYK  185



>ref|XP_009775352.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana sylvestris]
Length=173

 Score =   251 bits (642),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 141/166 (85%), Gaps = 14/166 (8%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DDVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK NK PLSLSRLI++  GKEDK+AV+
Sbjct  22   DDVYLKLLVKLYRFLVRRTGSQFNAVILKRLFMSKINKAPLSLSRLITYMKGKEDKVAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
                             V ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP
Sbjct  82   --------------VGTVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  127

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFG APGV HSHTKPYVRAKGRKFERARGKR SRG+KV
Sbjct  128  KNSREAVKHFGRAPGVSHSHTKPYVRAKGRKFERARGKRKSRGFKV  173



>gb|KJB82633.1| hypothetical protein B456_013G206100 [Gossypium raimondii]
Length=134

 Score =   249 bits (635),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = -1

Query  548  MSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIE  369
            MSK NKPPLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIE
Sbjct  1    MSKVNKPPLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIE  60

Query  368  KAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKF  189
            KAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR++GRKF
Sbjct  61   KAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSRGRKF  120

Query  188  ERARGKRNSRGYKV  147
            ERARG+RNS+G++V
Sbjct  121  ERARGRRNSKGFRV  134



>gb|KJB23305.1| hypothetical protein B456_004G091200 [Gossypium raimondii]
Length=134

 Score =   248 bits (634),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = -1

Query  548  MSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIE  369
            MSK NKPPLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARI+
Sbjct  1    MSKVNKPPLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARID  60

Query  368  KAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKF  189
            KAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKF
Sbjct  61   KAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKF  120

Query  188  ERARGKRNSRGYKV  147
            ERARG+RNS+G++V
Sbjct  121  ERARGRRNSKGFRV  134



>ref|XP_001745439.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90017.1| predicted protein [Monosiga brevicollis MX1]
Length=185

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D YL+LLVKLYRFL RRT S FN V+L+RLFMS+ N+PPLSLS+L++    +E KIAV+
Sbjct  21   EDPYLRLLVKLYRFLARRTESSFNKVVLRRLFMSRINRPPLSLSKLMTHMKKQESKIAVI  80

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDDVR  EVP L VCALR T++AR RI  AGGE +TFDQLALRAP GQNTVLL+GP
Sbjct  81   VGTVTDDVRVIEVPKLTVCALRVTESARKRILAAGGEIMTFDQLALRAPTGQNTVLLQGP  140

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            + SREAVKHFG APGVPHSH KPYVR+KGRKFE+ARG+R SRGYKV
Sbjct  141  RKSREAVKHFG-APGVPHSHVKPYVRSKGRKFEKARGRRASRGYKV  185



>ref|XP_010550998.1| PREDICTED: 60S ribosomal protein L18-2-like isoform X2 [Tarenaya 
hassleriana]
Length=157

 Score =   248 bits (633),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = -1

Query  593  RTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALK  414
            RTGS FNAVILKRLFMSK NK PLSLSRL++F  GKEDKI V+VGT+TDDVR YEVPALK
Sbjct  9    RTGSSFNAVILKRLFMSKVNKAPLSLSRLVNFMQGKEDKIGVVVGTVTDDVRVYEVPALK  68

Query  413  VCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVP  234
            V ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVP
Sbjct  69   VTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVP  128

Query  233  HSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            HSHTKPYVR  GRKFERARG+R SRG+KV
Sbjct  129  HSHTKPYVRYTGRKFERARGRRKSRGFKV  157



>gb|KJB22517.1| hypothetical protein B456_004G052100 [Gossypium raimondii]
Length=134

 Score =   247 bits (631),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = -1

Query  548  MSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIE  369
            MSK NKPPLSLSRLI +  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIE
Sbjct  1    MSKVNKPPLSLSRLIQYMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIE  60

Query  368  KAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKF  189
            KAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+ GRKF
Sbjct  61   KAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSNGRKF  120

Query  188  ERARGKRNSRGYKV  147
            ERARG+RNS+G++V
Sbjct  121  ERARGRRNSKGFRV  134



>ref|XP_011255380.1| PREDICTED: 60S ribosomal protein L18 [Camponotus floridanus]
 gb|EFN68908.1| 60S ribosomal protein L18 [Camponotus floridanus]
Length=188

 Score =   248 bits (633),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 143/167 (86%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIA  471
             DVYL+LLVKLYRFL RRT SKFN +IL+RLFMSK N+PP+SL+R++ F    G+E+ +A
Sbjct  21   QDVYLRLLVKLYRFLARRTNSKFNQIILRRLFMSKINRPPISLARIVRFMKKPGRENCVA  80

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VG++TDD R +E+P L VCALR T+ ARARI KAGGE +TFDQLALRAP G+ TVL++
Sbjct  81   VIVGSVTDDARIFEIPKLTVCALRVTERARARILKAGGEIITFDQLALRAPTGKRTVLMQ  140

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            GP+ +RE+VKHFGPAPGVPHSH+KPYVR+KGRKFERARG+R S GYK
Sbjct  141  GPRKARESVKHFGPAPGVPHSHSKPYVRSKGRKFERARGRRRSCGYK  187



>gb|AAO46881.1| 60S ribosomal protein [Medicago sativa]
Length=164

 Score =   246 bits (629),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKPPLSLSRLI +T GKE KIAV+
Sbjct  22   NDIYLKLLVKLYRFLVRRTESNFNKVILKRLFMSKVNKPPLSLSRLIRYTKGKEGKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VG +TDD+R YEVPA+KV ALRFT+ ARARIEKAGGECLTFDQLAL+APLGQNTVLLRGP
Sbjct  82   VGAVTDDIRVYEVPAIKVTALRFTEKARARIEKAGGECLTFDQLALKAPLGQNTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTK  219
            KN+REAVKHFG APGVPHS TK
Sbjct  142  KNAREAVKHFGRAPGVPHSSTK  163



>ref|XP_968042.1| PREDICTED: 60S ribosomal protein L18 [Tribolium castaneum]
 gb|EFA00786.1| hypothetical protein TcasGA2_TC003672 [Tribolium castaneum]
Length=188

 Score =   247 bits (630),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 139/167 (83%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIA  471
             DVYL+LLVKLYR+L RRTGSKFN +ILKRLFMSK NKPP+SL+R++      G+E   A
Sbjct  21   QDVYLRLLVKLYRYLARRTGSKFNKIILKRLFMSKINKPPISLARVVRAMKKPGREGLTA  80

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VGT+TDD R +EVP L +CALR T TARARI KAGGE +TFDQLALRAP G  TVLL+
Sbjct  81   VIVGTVTDDARIWEVPKLSICALRVTGTARARILKAGGEVITFDQLALRAPTGAKTVLLQ  140

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            G +N+REAVKHFGPAPGVPHSHTKP+VR KGRKFERARG+R S GYK
Sbjct  141  GRRNAREAVKHFGPAPGVPHSHTKPFVRTKGRKFERARGRRRSCGYK  187



>ref|XP_011351685.1| PREDICTED: 60S ribosomal protein L18 [Cerapachys biroi]
 gb|EZA61183.1| 60S ribosomal protein L18 [Cerapachys biroi]
Length=188

 Score =   246 bits (629),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 143/167 (86%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIA  471
            +DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK ++PP+SL+R++ F    G+E+ IA
Sbjct  21   EDVYLRLLVKLYRFLARRTNSKFNRIILKRLFMSKIHRPPISLARIVRFMKKPGRENCIA  80

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VGT+TDD R +E+P L VCALR T  ARARI KAGGE +T DQLALRAP G++TVL++
Sbjct  81   VIVGTVTDDARIFEIPKLTVCALRVTTRARARILKAGGEIITLDQLALRAPTGKHTVLMQ  140

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            GP+ +RE+VKHFGPAPGVPHSH+KPYVR+KGRKFERARG+R S GYK
Sbjct  141  GPRKARESVKHFGPAPGVPHSHSKPYVRSKGRKFERARGRRRSCGYK  187



>ref|XP_001640445.1| predicted protein [Nematostella vectensis]
 gb|EDO48382.1| predicted protein [Nematostella vectensis]
Length=188

 Score =   246 bits (629),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 145/168 (86%), Gaps = 2/168 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISF--TSGKEDKIA  471
             +VY++LLVKLYRFL RRT +KFN +++KRL MS+T +PPLSL+RL+     SG +DKI 
Sbjct  21   QNVYIRLLVKLYRFLSRRTNAKFNQIVMKRLCMSRTKRPPLSLARLVRKMKASGHKDKIC  80

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VG+ITDD R +EVPALK+CALRF++TARARI KAGGE LTFDQLALRAPLGQNTVLL+
Sbjct  81   VVVGSITDDKRIFEVPALKICALRFSETARARILKAGGEILTFDQLALRAPLGQNTVLLQ  140

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            GP+ +REA +H G APGVPHS TKP+VR+KGRKFERARG+R SRG+KV
Sbjct  141  GPRKAREAERHMGLAPGVPHSDTKPFVRSKGRKFERARGRRKSRGFKV  188



>ref|XP_006677675.1| hypothetical protein BATDEDRAFT_87003 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF82239.1| hypothetical protein BATDEDRAFT_87003 [Batrachochytrium dendrobatidis 
JAM81]
Length=186

 Score =   246 bits (628),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 140/165 (85%), Gaps = 1/165 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            D+VYL+LLVKLYRFL RRT SKFN V+LKRLFMS+ N+PP+S+SRL  + SGKE+KIAV+
Sbjct  22   DNVYLRLLVKLYRFLARRTNSKFNQVVLKRLFMSRVNRPPISISRLSKYLSGKENKIAVV  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R  EVP + V ALR T +ARARI KAGGE LTFDQLALR+PLG+ TVLLRGP
Sbjct  82   VGTVTDDNRLLEVPKISVAALRVTNSARARILKAGGEILTFDQLALRSPLGKGTVLLRGP  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            KNSREAVKHFG  PG P S  KPYVR+KGRKFE+ARG+R SRGYK
Sbjct  142  KNSREAVKHFG-TPGKPGSTAKPYVRSKGRKFEKARGRRASRGYK  185



>ref|XP_003707499.1| PREDICTED: 60S ribosomal protein L18-like [Megachile rotundata]
Length=218

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 142/167 (85%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIA  471
             DVYL+LLVKLYRFL RRT +KFN +ILKRLFMSK ++PP+SL+R++ F    G+E+ IA
Sbjct  51   QDVYLRLLVKLYRFLARRTNAKFNKIILKRLFMSKIHRPPISLARVVRFMKKPGRENAIA  110

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VGT+TDD R +E+P L VCALR T+ ARARI KAGGE +TFDQLALRAP G+ TVL++
Sbjct  111  VIVGTVTDDARIFEIPKLTVCALRITEKARARILKAGGELITFDQLALRAPTGRRTVLMQ  170

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            G +N+REAVKHFGPAPGVPHSHTKP VR+KGRKFERARG+R S GYK
Sbjct  171  GRRNAREAVKHFGPAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  217



>gb|ABR23470.1| 60s ribosomal protein L18 [Ornithodoros parkeri]
Length=188

 Score =   245 bits (625),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 143/167 (86%), Gaps = 2/167 (1%)
 Frame = -1

Query  641  DVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAV  468
            +VYL LLVK+YRFL RRT +KFN VILKRLFMS+ N+PP++LS+++ F    G+E+KIAV
Sbjct  22   NVYLGLLVKVYRFLARRTDAKFNRVILKRLFMSRINRPPMALSKVVRFMKKPGRENKIAV  81

Query  467  LVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRG  288
            +VGTITDDVR YEVP L+VCAL  T  ARARI KAGGE + FD+LA+++P GQNTVL++G
Sbjct  82   VVGTITDDVRLYEVPKLRVCALHVTDRARARIHKAGGEIMNFDELAVKSPRGQNTVLIQG  141

Query  287  PKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
             + +REA +HFGPAPGVPHSHTKPYVR+KGRKFERARG+R SRG+KV
Sbjct  142  RRTAREACRHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGFKV  188



>ref|XP_011135288.1| PREDICTED: 60S ribosomal protein L18 [Harpegnathos saltator]
Length=188

 Score =   245 bits (625),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 139/167 (83%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIA  471
             DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK NKPP+SL+R++   S   +E+ IA
Sbjct  21   QDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSKINKPPISLARIVRLMSKSHRENCIA  80

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VGTITDD R +E+P L VCALR T+ AR RI KAGGE +TFDQLALRAP G+ TVLL+
Sbjct  81   VVVGTITDDARIFEIPKLTVCALRVTEKARGRILKAGGELITFDQLALRAPTGKRTVLLQ  140

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            GP+ +REA KHFGPAPGVPHSHTKP VR+KGRKFERARG+R S GYK
Sbjct  141  GPRKAREAQKHFGPAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  187



>gb|EFN87206.1| 60S ribosomal protein L18 [Harpegnathos saltator]
Length=187

 Score =   244 bits (624),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 139/167 (83%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIA  471
             DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK NKPP+SL+R++   S   +E+ IA
Sbjct  20   QDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSKINKPPISLARIVRLMSKSHRENCIA  79

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VGTITDD R +E+P L VCALR T+ AR RI KAGGE +TFDQLALRAP G+ TVLL+
Sbjct  80   VVVGTITDDARIFEIPKLTVCALRVTEKARGRILKAGGELITFDQLALRAPTGKRTVLLQ  139

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            GP+ +REA KHFGPAPGVPHSHTKP VR+KGRKFERARG+R S GYK
Sbjct  140  GPRKAREAQKHFGPAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  186



>ref|XP_002400316.1| ribosomal protein L18, putative [Ixodes scapularis]
 gb|EEC15787.1| ribosomal protein L18, putative [Ixodes scapularis]
Length=188

 Score =   244 bits (624),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 145/167 (87%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIA  471
            ++VYL LLVK+YRFL RR+G+KFN ++LKRLFMS+ NKP +SL+R+  F    G+E+ IA
Sbjct  21   ENVYLGLLVKVYRFLARRSGAKFNRIVLKRLFMSRINKPVISLARVTRFMKKPGRENLIA  80

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VGT+TDD+R Y+VP L++CALR T+ ARARI KAGGE LTFDQLA++AP G+ TVL++
Sbjct  81   VVVGTVTDDLRLYDVPKLRLCALRVTERARARILKAGGEILTFDQLAVQAPKGKGTVLMQ  140

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            GP+NSREA +HFGPAPGVPHSHTKPYVR+KGRKFERARG+R SRGYK
Sbjct  141  GPRNSREACRHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGYK  187



>ref|XP_003056676.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58321.1| predicted protein [Micromonas pusilla CCMP1545]
Length=183

 Score =   244 bits (623),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 136/166 (82%), Gaps = 4/166 (2%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            ++VYLKLLVKLYRFL RRT S FN  +LKRLFMSK N+PPLSLS+L  F  G    ++ +
Sbjct  22   ENVYLKLLVKLYRFLARRTDSDFNKTVLKRLFMSKINRPPLSLSKLAKFHKGG---VSAI  78

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R +EVPA+KVCALRFT+TARARI KAGGEC+TFDQLAL AP G    LLRGP
Sbjct  79   VGTVTDDARMFEVPAMKVCALRFTETARARIIKAGGECMTFDQLALSAPTGDGVTLLRGP  138

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            KNSREAVKHFG APGVP SH KPYVR KGRKFE+ARG+R SRGYK 
Sbjct  139  KNSREAVKHFG-APGVPGSHAKPYVRHKGRKFEKARGRRKSRGYKA  183



>ref|XP_006561192.1| PREDICTED: 60S ribosomal protein L18-like [Apis mellifera]
 ref|XP_006622209.1| PREDICTED: 60S ribosomal protein L18-like [Apis dorsata]
Length=188

 Score =   244 bits (623),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 141/167 (84%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIA  471
             DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK ++PP+SL+R++ F    G+E+ IA
Sbjct  21   QDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSKIHRPPISLARIVRFMKKPGRENAIA  80

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VGT+TDD R +E+P L VCALR T+ ARARI KAGGE ++FDQLALRAP G+ TVL++
Sbjct  81   VIVGTVTDDARIFEIPKLTVCALRITERARARILKAGGELISFDQLALRAPTGKRTVLMQ  140

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            G + +REAVKHFGPAPGVPHSHTKP VR+KGRKFERARG+R S GYK
Sbjct  141  GRRKAREAVKHFGPAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  187



>ref|XP_003691391.1| PREDICTED: 60S ribosomal protein L18-like [Apis florea]
Length=188

 Score =   244 bits (622),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 141/167 (84%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIA  471
             DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK ++PP+SL+R++ F    G+E+ IA
Sbjct  21   QDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSKIHRPPISLARIVRFMKKPGRENAIA  80

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VGT+TDD R +E+P L VCALR T+ ARARI KAGGE ++FDQLALRAP G+ TVL++
Sbjct  81   VIVGTVTDDARIFEIPKLTVCALRVTERARARILKAGGELISFDQLALRAPTGKRTVLMQ  140

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            G + +REAVKHFGPAPGVPHSHTKP VR+KGRKFERARG+R S GYK
Sbjct  141  GRRKAREAVKHFGPAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  187



>gb|AAX48850.1| L18 [Suberites domuncula]
Length=187

 Score =   244 bits (622),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 146/168 (87%), Gaps = 2/168 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFT--SGKEDKIA  471
            DD YL+L+VKLYRFL RRT + FN V+LKRL+MSKTN+PPLS++R++     + +  KIA
Sbjct  20   DDPYLRLIVKLYRFLARRTDAPFNKVVLKRLYMSKTNRPPLSIARIVRQMKPADRTTKIA  79

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VGT+T+DVR +++P + +CAL+FT+ ARAR+ KAGGE LTFDQLALRAP GQNT++L+
Sbjct  80   VVVGTVTNDVRIFDIPKMTICALKFTEAARARVLKAGGEVLTFDQLALRAPKGQNTIILQ  139

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            GP+ +REAV+HFG APGVPHSH+KPYVR+KGRKFERARG+RNS+G+KV
Sbjct  140  GPRRAREAVRHFGRAPGVPHSHSKPYVRSKGRKFERARGRRNSKGFKV  187



>ref|XP_004991895.1| ribosomal protein l18 [Salpingoeca rosetta]
 gb|EGD75438.1| ribosomal protein l18 [Salpingoeca rosetta]
Length=186

 Score =   243 bits (621),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D YL+LLV+LYRFLVRRT S FN V+LKR+FMSK ++PP+SLSR++    G+E  IAV+
Sbjct  21   EDPYLRLLVQLYRFLVRRTNSSFNKVVLKRMFMSKIHRPPMSLSRIVQNMKGREQLIAVI  80

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R  E+P L VCALRF++TAR RI  AGGECLTFDQLALR+P GQNTVL++GP
Sbjct  81   VGTVTDDPRMLELPKLTVCALRFSETARKRILAAGGECLTFDQLALRSPKGQNTVLMQGP  140

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            + +REAVKHFG APG+P SH +PYVRAKGRKFE+ARG+R SRG++
Sbjct  141  RKAREAVKHFGRAPGLPGSHARPYVRAKGRKFEKARGRRTSRGFR  185



>ref|XP_011497333.1| PREDICTED: 60S ribosomal protein L18 [Ceratosolen solmsi marchali]
Length=188

 Score =   243 bits (620),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 140/167 (84%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIA  471
             DVYL+LLVKLYRFL RRT SKFN +ILKRLFMS+ ++PP+SL+R+  F    G+ED IA
Sbjct  21   QDVYLRLLVKLYRFLARRTRSKFNRIILKRLFMSRIHRPPISLARITRFMKKPGREDCIA  80

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VGT+TDD R +EVP L +CALR T+ AR RI KAGGE +TFDQLALR+P G+ TVL++
Sbjct  81   VIVGTVTDDARIFEVPKLTICALRVTEKARGRILKAGGEIITFDQLALRSPTGRKTVLIQ  140

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            GP+ +REAVKHFGPAPGVPHSHTKP VR+KGRKFERARG+R S GYK
Sbjct  141  GPRKAREAVKHFGPAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  187



>gb|KDR14978.1| 60S ribosomal protein L18 [Zootermopsis nevadensis]
Length=188

 Score =   242 bits (618),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 139/167 (83%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKE--DKIA  471
             DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK N+PP+SL+R++      E  + IA
Sbjct  21   QDVYLRLLVKLYRFLTRRTKSKFNKIILKRLFMSKINRPPISLARVVHLMKDPERANLIA  80

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VGTITDD R +EVP L VCALR T+ ARARI KAGGE +TFDQLALRAP G+ TVL++
Sbjct  81   VIVGTITDDQRIFEVPKLTVCALRVTERARARILKAGGEIITFDQLALRAPTGKKTVLIQ  140

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            G +N+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+R S GYK
Sbjct  141  GRRNAREAVKHFGLAPGVPHSHTKPYVRSKGRKFERARGRRRSCGYK  187



>ref|XP_011062886.1| PREDICTED: 60S ribosomal protein L18 [Acromyrmex echinatior]
 gb|EGI60312.1| 60S ribosomal protein L18 [Acromyrmex echinatior]
Length=232

 Score =   243 bits (621),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 140/167 (84%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIA  471
             DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK ++PP+SL+R++ F     +E+ +A
Sbjct  65   QDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSKIHRPPISLARIVRFMKKPNRENCVA  124

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VGTITDD R +EVP L VCALR T+ ARARI K GGE +TFDQLALR+P G  TVL++
Sbjct  125  VIVGTITDDARIFEVPKLTVCALRVTEKARARILKNGGEIITFDQLALRSPTGSRTVLMQ  184

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            GP+N+RE+VKHFG APGVPHSHTKPYVR+KGRKFERARG+R S GYK
Sbjct  185  GPRNARESVKHFGLAPGVPHSHTKPYVRSKGRKFERARGRRRSCGYK  231



>ref|XP_009012591.1| hypothetical protein HELRODRAFT_156470 [Helobdella robusta]
 gb|ESO09498.1| hypothetical protein HELRODRAFT_156470 [Helobdella robusta]
Length=188

 Score =   241 bits (616),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 139/167 (83%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFT--SGKEDKIA  471
            DD+YL+LLVKLY+FL RRT +KFN ++ KRL MS+TNKPPLSLSRL       G+E+K+A
Sbjct  21   DDIYLRLLVKLYKFLARRTNAKFNQIVFKRLIMSRTNKPPLSLSRLSRHMKKQGRENKLA  80

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VGT+TDD R Y VP LK+ ALR T TAR RI KAGGE LTFDQLAL+AP G+NTVLL+
Sbjct  81   VVVGTVTDDERLYTVPKLKLVALRVTDTARTRILKAGGEILTFDQLALKAPKGENTVLLQ  140

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            G + +R+A +HFG APGVPHSHTKPYVRAKGRKFERARG+R SRGYK
Sbjct  141  GQRKARKAYRHFGLAPGVPHSHTKPYVRAKGRKFERARGRRKSRGYK  187



>emb|CAJ17294.1| ribosomal protein L18e [Hister sp. APV-2005]
Length=188

 Score =   241 bits (616),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 139/167 (83%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIA  471
             DVYL+LLVKLYR+L RRT SKFN +IL+RLFMS+ N+ P+SL+R++ F    G+E  +A
Sbjct  21   QDVYLRLLVKLYRYLARRTNSKFNKIILRRLFMSRINRAPMSLARIVRFMKKPGREGLMA  80

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VGT+TDD R +EVP L VCALR T+ ARARI KAGGE LTFDQLALRAP G  TVL++
Sbjct  81   VVVGTVTDDQRIWEVPKLTVCALRITEKARARILKAGGEILTFDQLALRAPTGNKTVLMQ  140

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            G + +REAVKHFGPAPGVPHSHTKP+VR+KGRKFERARG+R S GYK
Sbjct  141  GKRTAREAVKHFGPAPGVPHSHTKPFVRSKGRKFERARGRRRSCGYK  187



>emb|CBK21900.2| Ribosomal protein L18e [Blastocystis hominis]
Length=189

 Score =   241 bits (616),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 139/166 (84%), Gaps = 1/166 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            ++VYL LLV LYRFL RRT ++F  V+LKRL+MS+ N+PP+SLSRL+    GKEDKIAV+
Sbjct  25   ENVYLALLVNLYRFLARRTNARFPEVVLKRLYMSRINRPPMSLSRLMKHMQGKEDKIAVI  84

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R  EVPALKVCALRFT+TARARI KAGGEC+T DQLALRAP G NTVLL+G 
Sbjct  85   VGTVTDDIRVIEVPALKVCALRFTETARARILKAGGECITLDQLALRAPTGANTVLLQGH  144

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            +++REAV+HFG  PG P S  +PYVR+ GRKFERARG+R S GYKV
Sbjct  145  RSAREAVRHFG-TPGTPGSKARPYVRSTGRKFERARGRRASMGYKV  189



>emb|CBK22442.2| unnamed protein product [Blastocystis hominis]
Length=186

 Score =   241 bits (615),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 139/166 (84%), Gaps = 1/166 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            ++VYL LLV LYRFL RRT ++F  V+LKRL+MS+ N+PP+SLSRL+    GKEDKIAV+
Sbjct  22   ENVYLALLVNLYRFLARRTNARFPEVVLKRLYMSRINRPPMSLSRLMKHMQGKEDKIAVI  81

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R  EVPALKVCALRFT+TARARI KAGGEC+T DQLALRAP G NTVLL+G 
Sbjct  82   VGTVTDDIRVIEVPALKVCALRFTETARARILKAGGECITLDQLALRAPTGANTVLLQGH  141

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            +++REAV+HFG  PG P S  +PYVR+ GRKFERARG+R S GYKV
Sbjct  142  RSAREAVRHFG-TPGTPGSKARPYVRSTGRKFERARGRRASMGYKV  186



>ref|XP_011351645.1| PREDICTED: 60S ribosomal protein L18-like [Cerapachys biroi]
 gb|EZA61166.1| 60S ribosomal protein L18 [Cerapachys biroi]
Length=188

 Score =   241 bits (615),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 140/167 (84%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIA  471
             DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK + PP+SL+R++ F    G+E+ IA
Sbjct  21   QDVYLRLLVKLYRFLARRTNSKFNRIILKRLFMSKIHLPPISLARIVRFMKKPGRENCIA  80

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VGT+TDD R +E+P L +CALR T+ AR RI KAGGE +TFDQLALRAP G+ TVL++
Sbjct  81   VIVGTVTDDSRIFEIPKLTICALRVTEKARGRILKAGGEIITFDQLALRAPTGKRTVLMQ  140

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            GP+ +RE+VKHFG APGVPHSHTKPYVR+KGRKFERARG+R S GYK
Sbjct  141  GPRKARESVKHFGLAPGVPHSHTKPYVRSKGRKFERARGRRRSCGYK  187



>ref|XP_008546759.1| PREDICTED: 60S ribosomal protein L18 [Microplitis demolitor]
Length=188

 Score =   241 bits (614),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 138/167 (83%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIA  471
             D+YL+LLVKLYRFL RRTGSKFN +ILKRLFMS+ NKPP+SL+R++ F     +E+ IA
Sbjct  21   QDIYLRLLVKLYRFLARRTGSKFNKIILKRLFMSRINKPPISLARVVRFMKKPHRENCIA  80

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VGT+TDD R +E P L VCALR T  AR RI KAGGE +TFD+LALR+P G  TVL++
Sbjct  81   VIVGTVTDDARIFECPKLTVCALRVTDKARGRILKAGGEVITFDELALRSPTGSKTVLMQ  140

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            G +N+REAVKHFGPAPGVPHSHTKP VR+KGRKFERARG+R S GYK
Sbjct  141  GRRNAREAVKHFGPAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  187



>emb|CBK22327.2| unnamed protein product [Blastocystis hominis]
Length=194

 Score =   241 bits (614),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 139/166 (84%), Gaps = 1/166 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            ++VYL LLV LYRFL RRT ++F  V+LKRL+MS+ N+PP+SLSRL+    GKEDKIAV+
Sbjct  30   ENVYLALLVNLYRFLARRTNARFPEVVLKRLYMSRINRPPMSLSRLMKHMQGKEDKIAVI  89

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD+R  EVPALKVCALRFT+TARARI KAGGEC+T DQLALRAP G NTVLL+G 
Sbjct  90   VGTVTDDIRVIEVPALKVCALRFTETARARILKAGGECITLDQLALRAPTGANTVLLQGH  149

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            +++REAV+HFG  PG P S  +PYVR+ GRKFERARG+R S GYKV
Sbjct  150  RSAREAVRHFG-TPGTPGSKARPYVRSTGRKFERARGRRASMGYKV  194



>gb|AAN73381.1| ribosomal protein L18 [Branchiostoma lanceolatum]
Length=188

 Score =   240 bits (613),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 142/167 (85%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIA  471
            +D+YL+LLVKLYRFL RRT +KFN V+L+RLFMS+TN+PP+S++RLI      G+E K A
Sbjct  21   EDIYLRLLVKLYRFLARRTNAKFNQVVLERLFMSRTNRPPMSIARLIRLMKKPGREGKTA  80

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VGTITDDVR +E+P LK+C LR T+ ARA+I KAGGE +TFDQLALR+P G+NTVL++
Sbjct  81   VVVGTITDDVRIFEIPKLKICCLRVTEGARAKILKAGGEIITFDQLALRSPKGKNTVLIQ  140

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            G + +RE  +H+GPAPGVPHSHTKP+VR+KGRKFERARG+R S GYK
Sbjct  141  GQRRARETCRHWGPAPGVPHSHTKPFVRSKGRKFERARGRRKSCGYK  187



>gb|KHG01788.1| 60S ribosomal L18-2 -like protein [Gossypium arboreum]
Length=160

 Score =   239 bits (610),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 127/152 (84%), Gaps = 13/152 (9%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            DD+YLKLLVKLYRFLVRRTGSKFN VILKRLFMSK NKPPLSLSRLI F  GK       
Sbjct  22   DDIYLKLLVKLYRFLVRRTGSKFNTVILKRLFMSKVNKPPLSLSRLIQFMKGK-------  74

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
                   +  YEVPALKV ALRFT+TARARIEKAGGECL+FDQLALRAPLGQNTVLLRGP
Sbjct  75   ------GLWVYEVPALKVTALRFTETARARIEKAGGECLSFDQLALRAPLGQNTVLLRGP  128

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKF  189
            KN+REAVKHFGPAPGVPHS  KPYVR+KGRK 
Sbjct  129  KNAREAVKHFGPAPGVPHSLYKPYVRSKGRKL  160



>ref|XP_008201914.1| PREDICTED: 60S ribosomal protein L18 [Nasonia vitripennis]
Length=188

 Score =   240 bits (612),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 139/167 (83%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIA  471
             DVYL+LLVKLYRFL RRT SKFN +ILKRLFMS+ ++PP+SL+R+  F    G+E+ IA
Sbjct  21   QDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSRIHRPPISLARVTRFMKKPGRENCIA  80

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VGT+TDD R +EVP L VCALR T+ AR RI KAGGE +TFDQLAL++P G+ TVL++
Sbjct  81   VIVGTVTDDARIFEVPKLTVCALRVTEKARGRILKAGGEIITFDQLALKSPTGRKTVLIQ  140

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            GP+  REAVKHFGPAPGVPHSHTKP VR+KGRKFERARG+R S GYK
Sbjct  141  GPRKGREAVKHFGPAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  187



>ref|XP_002506220.1| ribosomal protein L18 [Micromonas sp. RCC299]
 gb|ACO67478.1| ribosomal protein L18 [Micromonas sp. RCC299]
Length=386

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 140/166 (84%), Gaps = 3/166 (2%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            ++VYLKLLVKLYRFLVRRT SK N  ILKRLFMSK N+PPLSLS+L  F   K  +I+ +
Sbjct  224  ENVYLKLLVKLYRFLVRRTDSKVNETILKRLFMSKINRPPLSLSKLAKFA--KPGQISAV  281

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGTITDD R +EVPAL+VCALRFT+TARARI KAGGEC+TFDQLAL+AP G+N  LLRGP
Sbjct  282  VGTITDDARMFEVPALRVCALRFTETARARIVKAGGECITFDQLALQAPTGENVCLLRGP  341

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            K+ REAVKHFG APGVP SH KPYVR KGRKFE+ARG+R SRGYK 
Sbjct  342  KSHREAVKHFG-APGVPGSHAKPYVRHKGRKFEKARGRRKSRGYKA  386



>ref|XP_004345091.2| ribosomal protein L18e [Capsaspora owczarzaki ATCC 30864]
Length=186

 Score =   239 bits (611),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+Y++LLVKLYRFL RRT S FN V+LKRLF S+ ++PPLSLS+L+  T G E   AV+
Sbjct  21   EDLYIRLLVKLYRFLARRTDSPFNKVVLKRLFQSRIHRPPLSLSKLVRLTKGSEKLTAVV  80

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R + VP L VCALRFT  ARARI KAGGE +TFDQLALR+P G+NT+LLRGP
Sbjct  81   VGTVTDDERLHVVPKLTVCALRFTAAARARILKAGGETITFDQLALRSPTGKNTLLLRGP  140

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
              SREAVKHFG APGVP S TKPYVR+KGRKFE+ARG+R SRGYKV
Sbjct  141  VKSREAVKHFGAAPGVPKSTTKPYVRSKGRKFEKARGRRASRGYKV  186



>gb|EFZ15690.1| hypothetical protein SINV_04174 [Solenopsis invicta]
Length=187

 Score =   239 bits (610),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 142/167 (85%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIA  471
             DVYL+LLVKLYRFL RRT SKFN +ILKRLFMS+ ++PP+S++R++ F    G+E+ +A
Sbjct  20   QDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSRIHRPPISVARIVRFMKKPGRENCVA  79

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VG++TDD R +++P L VCALR T+ ARARI KAGGE +TFDQLALRAP G+ T+L++
Sbjct  80   VIVGSVTDDARIFQIPKLTVCALRVTEKARARILKAGGEIITFDQLALRAPTGKKTILMQ  139

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            G +N+RE+VKHFG APGVPHSHTKPYVR+KGRKFERARG+R S GYK
Sbjct  140  GRRNARESVKHFGLAPGVPHSHTKPYVRSKGRKFERARGRRRSCGYK  186



>gb|KJE95959.1| ribosomal protein L18e [Capsaspora owczarzaki ATCC 30864]
Length=209

 Score =   239 bits (611),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVL  465
            +D+Y++LLVKLYRFL RRT S FN V+LKRLF S+ ++PPLSLS+L+  T G E   AV+
Sbjct  44   EDLYIRLLVKLYRFLARRTDSPFNKVVLKRLFQSRIHRPPLSLSKLVRLTKGSEKLTAVV  103

Query  464  VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGP  285
            VGT+TDD R + VP L VCALRFT  ARARI KAGGE +TFDQLALR+P G+NT+LLRGP
Sbjct  104  VGTVTDDERLHVVPKLTVCALRFTAAARARILKAGGETITFDQLALRSPTGKNTLLLRGP  163

Query  284  KNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
              SREAVKHFG APGVP S TKPYVR+KGRKFE+ARG+R SRGYKV
Sbjct  164  VKSREAVKHFGAAPGVPKSTTKPYVRSKGRKFEKARGRRASRGYKV  209



>ref|XP_003393579.1| PREDICTED: hypothetical protein LOC100643724 [Bombus terrestris]
Length=409

 Score =   246 bits (627),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 141/166 (85%), Gaps = 2/166 (1%)
 Frame = -1

Query  641  DVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAV  468
            DVYL+LLVKLYRFL RRT SKFN ++LKRLFMSK ++PP+SL+R++ F    G+E+ IAV
Sbjct  243  DVYLRLLVKLYRFLARRTNSKFNKIVLKRLFMSKIHRPPISLARIVRFMKKPGRENAIAV  302

Query  467  LVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRG  288
            +VGT+TDD R +E+P L VCALR T+ ARARI KAGGE +TFDQLALR P+G+ TVL++G
Sbjct  303  IVGTVTDDARIFEIPKLTVCALRVTERARARILKAGGELITFDQLALRTPIGERTVLMQG  362

Query  287  PKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
             + +REAVKHFGPAPGVPHSHTKP VR+KGRKFERARG+R S GYK
Sbjct  363  RRKAREAVKHFGPAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  408



>ref|XP_003485273.1| PREDICTED: hypothetical protein LOC100746406 [Bombus impatiens]
Length=400

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 141/166 (85%), Gaps = 2/166 (1%)
 Frame = -1

Query  641  DVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIAV  468
            DVYL+LLVKLYRFL RRT SKFN ++LKRLFMSK ++PP+SL+R++ F    G+E+ IAV
Sbjct  234  DVYLRLLVKLYRFLARRTNSKFNKIVLKRLFMSKIHRPPISLARVVRFMKKPGRENAIAV  293

Query  467  LVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRG  288
            +VGT+TDD R +E+P L VCALR T+ ARARI KAGGE +TFDQLALR P+G+ TVL++G
Sbjct  294  IVGTVTDDARIFEIPKLTVCALRVTERARARILKAGGELITFDQLALRTPIGERTVLMQG  353

Query  287  PKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
             + +REAVKHFGPAPGVPHSHTKP VR+KGRKFERARG+R S GYK
Sbjct  354  RRKAREAVKHFGPAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  399



>gb|ABW90395.1| putative ribosomal protein L18 [Barentsia elongata]
Length=188

 Score =   238 bits (607),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 140/167 (84%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIA  471
            DDVYL+LLVKLYRFL RRT +KFN +ILKRLFMSK N+PPLSL+R++  T   G++ K+ 
Sbjct  21   DDVYLRLLVKLYRFLARRTDAKFNKIILKRLFMSKINRPPLSLARILRQTKKPGRDGKLV  80

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V VGT+TDD+R  +VP LK+CAL  T  AR RI KAGGE +TFDQLAL+AP G+NT+L++
Sbjct  81   VCVGTVTDDLRILDVPKLKICALHVTSGARTRILKAGGEIITFDQLALQAPKGKNTLLIQ  140

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            GP+ +REA +HFG APGVPHSHTKP+VR+KGRKFERARG+R SRGYK
Sbjct  141  GPRKAREACRHFGRAPGVPHSHTKPFVRSKGRKFERARGRRKSRGYK  187



>ref|XP_011313252.1| PREDICTED: 60S ribosomal protein L18 [Fopius arisanus]
Length=188

 Score =   238 bits (606),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 138/167 (83%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIA  471
             DVYL+LLVKLYRFL RRT +KFN +ILKRLFMSK ++PP+SL+R++ F     +E+ IA
Sbjct  21   QDVYLRLLVKLYRFLARRTNAKFNKIILKRLFMSKIHRPPISLARVVRFMKKPTRENCIA  80

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VGT+TDD R +E+P L VCALR T+ AR RI KAGGE +TFDQLALRAP G  TVL++
Sbjct  81   VVVGTVTDDARIFEIPKLTVCALRVTEKARGRILKAGGEIITFDQLALRAPTGNKTVLMQ  140

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            G + +REAVKHFGPAPGVPHSHTKP VR+KGRKFERARG+R S GYK
Sbjct  141  GRRKAREAVKHFGPAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  187



>ref|XP_011163555.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L18 [Solenopsis 
invicta]
Length=247

 Score =   239 bits (611),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 142/167 (85%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIA  471
             DVYL+LLVKLYRFL RRT SKFN +ILKRLFMS+ ++PP+S++R++ F    G+E+ +A
Sbjct  80   QDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSRIHRPPISVARIVRFMKKPGRENCVA  139

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VG++TDD R +++P L VCALR T+ ARARI KAGGE +TFDQLALRAP G+ T+L++
Sbjct  140  VIVGSVTDDARIFQIPKLTVCALRVTEKARARILKAGGEIITFDQLALRAPTGKKTILMQ  199

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            G +N+RE+VKHFG APGVPHSHTKPYVR+KGRKFERARG+R S GYK
Sbjct  200  GRRNARESVKHFGLAPGVPHSHTKPYVRSKGRKFERARGRRRSCGYK  246



>gb|ACR35483.1| unknown [Zea mays]
 tpg|DAA64099.1| TPA: hypothetical protein ZEAMMB73_909543 [Zea mays]
Length=134

 Score =   236 bits (601),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -1

Query  548  MSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIE  369
            MSKTN+PPLS+ RL+ F  GK D+IAV+VGT+TDD R  EVPA+KVCALRFT+TARARI 
Sbjct  1    MSKTNRPPLSMRRLVRFMEGKGDQIAVIVGTVTDDKRISEVPAMKVCALRFTETARARII  60

Query  368  KAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKF  189
             AGGECLTFDQLALRAPLGQNTVLLRGPKN+REAV+HFGPAPGVPHSHTKPYVR+KGRKF
Sbjct  61   NAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVRHFGPAPGVPHSHTKPYVRSKGRKF  120

Query  188  ERARGKRNSRGYKV  147
            E+ARG+RNSRG+KV
Sbjct  121  EKARGRRNSRGFKV  134



>sp|Q4GXG7.1|RL18_TIMBA RecName: Full=60S ribosomal protein L18 [Timarcha balearica]
 emb|CAJ17295.1| ribosomal protein L18e [Timarcha balearica]
Length=188

 Score =   237 bits (605),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 138/167 (83%), Gaps = 2/167 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIA  471
             DVYL+LLVKLYR+L RRTG+KFN +ILKRLFMSK  +PP+SLS+++ F    G+E   A
Sbjct  21   QDVYLRLLVKLYRYLARRTGAKFNKIILKRLFMSKIYRPPISLSKVVRFMKKPGRELLTA  80

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VGT+TDD R +E+P L +CALR T+TARA I KAGGE +TFDQLALR+P G  TVLL+
Sbjct  81   VIVGTVTDDSRIFEIPKLSICALRVTQTARAGILKAGGEVITFDQLALRSPTGSKTVLLQ  140

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  150
            G +N+REAVKHFGPAPGVPHSH KP VR+KGRKFERARG+R S GYK
Sbjct  141  GKRNAREAVKHFGPAPGVPHSHAKPLVRSKGRKFERARGRRRSCGYK  187



>ref|XP_002161036.1| PREDICTED: 60S ribosomal protein L18-like [Hydra vulgaris]
Length=188

 Score =   237 bits (605),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 136/168 (81%), Gaps = 2/168 (1%)
 Frame = -1

Query  644  DDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTS--GKEDKIA  471
             D YL+LLVKLYRFL RRT SKFN V+LKRLFMSK N+PP+S+SR+       G EDKI 
Sbjct  21   QDPYLRLLVKLYRFLARRTSSKFNQVVLKRLFMSKINRPPVSISRIARRMKKPGCEDKIC  80

Query  470  VLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLR  291
            V+VGTITDD+R  EVP LKVCALR T+ AR RI K+GGE +TFDQLALR+P G+ TVLL+
Sbjct  81   VVVGTITDDIRLIEVPKLKVCALRLTEGARTRILKSGGEVITFDQLALRSPTGKKTVLLQ  140

Query  290  GPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  147
            GP+ SREA KH G APGVPHS TKPYVR+KGRKFERARG+R S GYKV
Sbjct  141  GPRKSREACKHMGRAPGVPHSTTKPYVRSKGRKFERARGRRASCGYKV  188



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375