BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF023G24

Length=685
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009798339.1|  PREDICTED: probable low-specificity L-threon...    258   9e-81   Nicotiana sylvestris
ref|XP_009631531.1|  PREDICTED: probable low-specificity L-threon...    254   2e-79   
emb|CDO99988.1|  unnamed protein product                                251   9e-79   Coffea canephora [robusta coffee]
ref|XP_004236787.1|  PREDICTED: probable low-specificity L-threon...    247   9e-77   Solanum lycopersicum
ref|XP_010319280.1|  PREDICTED: probable low-specificity L-threon...    247   1e-76   Solanum lycopersicum
ref|NP_001275261.1|  L-allo-threonine aldolase-related protein          247   1e-76   Solanum tuberosum [potatoes]
ref|XP_006361420.1|  PREDICTED: uncharacterized protein R102.4 is...    247   1e-76   Solanum tuberosum [potatoes]
emb|CBI22386.3|  unnamed protein product                                238   3e-73   Vitis vinifera
ref|XP_009795458.1|  PREDICTED: probable low-specificity L-threon...    238   4e-73   Nicotiana sylvestris
ref|XP_002266992.1|  PREDICTED: probable low-specificity L-threon...    238   4e-73   Vitis vinifera
ref|XP_007030420.1|  Threonine aldolase 1 isoform 1                     236   1e-72   
ref|XP_007030422.1|  Threonine aldolase 1 isoform 3                     234   6e-72   
ref|XP_002521974.1|  l-allo-threonine aldolase, putative                233   3e-71   Ricinus communis
ref|XP_010024956.1|  PREDICTED: probable low-specificity L-threon...    229   9e-70   
gb|KCW61508.1|  hypothetical protein EUGRSUZ_H04236                     229   1e-69   Eucalyptus grandis [rose gum]
ref|XP_011101617.1|  PREDICTED: probable low-specificity L-threon...    228   3e-69   Sesamum indicum [beniseed]
ref|XP_007030424.1|  Threonine aldolase 1 isoform 5                     226   9e-69   
gb|AFK43649.1|  unknown                                                 224   1e-67   Lotus japonicus
gb|KJB82283.1|  hypothetical protein B456_013G187300                    223   2e-67   Gossypium raimondii
gb|KCW61511.1|  hypothetical protein EUGRSUZ_H04236                     223   2e-67   Eucalyptus grandis [rose gum]
ref|XP_003521772.1|  PREDICTED: uncharacterized protein R102.4-li...    223   2e-67   Glycine max [soybeans]
ref|XP_004494746.1|  PREDICTED: L-allo-threonine aldolase-like is...    223   3e-67   Cicer arietinum [garbanzo]
gb|KDP23711.1|  hypothetical protein JCGZ_23544                         223   3e-67   Jatropha curcas
ref|XP_002325334.2|  L-allo-threonine aldolase-related family pro...    223   3e-67   Populus trichocarpa [western balsam poplar]
gb|KJB44860.1|  hypothetical protein B456_007G276400                    223   5e-67   Gossypium raimondii
ref|XP_011036295.1|  PREDICTED: probable low-specificity L-threon...    221   8e-67   Populus euphratica
ref|XP_002319106.2|  L-allo-threonine aldolase-related family pro...    221   9e-67   
gb|KJB44862.1|  hypothetical protein B456_007G276400                    223   1e-66   Gossypium raimondii
gb|KJB44861.1|  hypothetical protein B456_007G276400                    223   1e-66   Gossypium raimondii
ref|XP_010102233.1|  L-allo-threonine aldolase                          219   5e-66   Morus notabilis
gb|EYU19887.1|  hypothetical protein MIMGU_mgv1a008896mg                219   5e-66   Erythranthe guttata [common monkey flower]
ref|XP_011038517.1|  PREDICTED: LOW QUALITY PROTEIN: probable low...    219   7e-66   Populus euphratica
ref|XP_007147215.1|  hypothetical protein PHAVU_006G105400g             219   9e-66   Phaseolus vulgaris [French bean]
ref|XP_006577318.1|  PREDICTED: uncharacterized protein R102.4-li...    218   1e-65   Glycine max [soybeans]
gb|KJB46043.1|  hypothetical protein B456_007G345500                    217   4e-65   Gossypium raimondii
ref|XP_009364444.1|  PREDICTED: probable low-specificity L-threon...    217   6e-65   Pyrus x bretschneideri [bai li]
ref|XP_008218319.1|  PREDICTED: probable low-specificity L-threon...    216   8e-65   Prunus mume [ume]
gb|KHN04944.1|  L-allo-threonine aldolase                               216   8e-65   Glycine soja [wild soybean]
gb|KHG25609.1|  L-allo-threonine aldolase                               216   9e-65   Gossypium arboreum [tree cotton]
gb|AFK40044.1|  unknown                                                 216   9e-65   Medicago truncatula
gb|KEH24599.1|  L-allo-threonine aldolase-like protein                  216   9e-65   Medicago truncatula
ref|XP_008388714.1|  PREDICTED: probable low-specificity L-threon...    215   2e-64   
ref|XP_004170828.1|  PREDICTED: L-allo-threonine aldolase-like          215   2e-64   
gb|KDO44520.1|  hypothetical protein CISIN_1g0182431mg                  209   2e-64   Citrus sinensis [apfelsine]
ref|XP_008388713.1|  PREDICTED: probable low-specificity L-threon...    216   2e-64   
ref|XP_010262335.1|  PREDICTED: probable low-specificity L-threon...    215   2e-64   Nelumbo nucifera [Indian lotus]
ref|XP_008456444.1|  PREDICTED: probable low-specificity L-threon...    215   2e-64   Cucumis melo [Oriental melon]
ref|XP_004139254.1|  PREDICTED: L-allo-threonine aldolase-like          214   7e-64   Cucumis sativus [cucumbers]
ref|XP_006577317.1|  PREDICTED: uncharacterized protein R102.4-li...    214   1e-63   Glycine max [soybeans]
ref|XP_010694951.1|  PREDICTED: probable low-specificity L-threon...    214   1e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010246795.1|  PREDICTED: probable low-specificity L-threon...    213   2e-63   Nelumbo nucifera [Indian lotus]
ref|XP_011465993.1|  PREDICTED: probable low-specificity L-threon...    213   2e-63   Fragaria vesca subsp. vesca
ref|XP_003556456.2|  PREDICTED: uncharacterized protein R102.4-li...    214   2e-63   
gb|KJB46045.1|  hypothetical protein B456_007G345500                    213   4e-63   Gossypium raimondii
ref|XP_007205422.1|  hypothetical protein PRUPE_ppa007684mg             212   5e-63   Prunus persica
ref|XP_006606453.1|  PREDICTED: uncharacterized protein R102.4-li...    212   7e-63   
gb|ADI24921.1|  L-allo-threonine aldolase                               211   7e-63   Carica papaya [mamon]
ref|XP_006606452.1|  PREDICTED: uncharacterized protein R102.4-li...    212   9e-63   
ref|XP_006417664.1|  hypothetical protein EUTSA_v10008026mg             210   2e-62   Eutrema salsugineum [saltwater cress]
emb|CDX93548.1|  BnaA06g05000D                                          210   2e-62   
ref|XP_009148115.1|  PREDICTED: probable low-specificity L-threon...    210   3e-62   Brassica rapa
ref|XP_006606451.1|  PREDICTED: uncharacterized protein R102.4-li...    212   3e-62   
emb|CDX95045.1|  BnaC05g06260D                                          209   5e-62   
ref|XP_009118358.1|  PREDICTED: probable low-specificity L-threon...    209   6e-62   
emb|CDY06323.1|  BnaA09g48800D                                          209   6e-62   
ref|XP_006487715.1|  PREDICTED: uncharacterized protein R102.4-li...    208   9e-62   Citrus sinensis [apfelsine]
ref|XP_006442676.1|  hypothetical protein CICLE_v10020798mg             208   1e-61   Citrus clementina [clementine]
emb|CDY22672.1|  BnaC08g43060D                                          207   4e-61   Brassica napus [oilseed rape]
gb|ACF86035.1|  unknown                                                 202   7e-61   Zea mays [maize]
ref|XP_009123981.1|  PREDICTED: probable low-specificity L-threon...    206   7e-61   Brassica rapa
ref|XP_003590971.1|  L-allo-threonine aldolase                          205   7e-61   
gb|AES61221.2|  L-allo-threonine aldolase-like protein                  206   8e-61   Medicago truncatula
ref|XP_006408182.1|  hypothetical protein EUTSA_v10021036mg             206   9e-61   Eutrema salsugineum [saltwater cress]
gb|AFK38526.1|  unknown                                                 206   1e-60   Medicago truncatula
ref|XP_003590972.1|  L-allo-threonine aldolase                          206   1e-60   Medicago truncatula
ref|XP_003590973.1|  L-allo-threonine aldolase                          206   2e-60   
ref|XP_004495577.1|  PREDICTED: L-allo-threonine aldolase-like is...    205   2e-60   Cicer arietinum [garbanzo]
ref|XP_010906812.1|  PREDICTED: probable low-specificity L-threon...    205   2e-60   Elaeis guineensis
emb|CDY42933.1|  BnaC05g47180D                                          205   3e-60   Brassica napus [oilseed rape]
ref|NP_566228.1|  threonine aldolase 2                                  204   3e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010906811.1|  PREDICTED: probable low-specificity L-threon...    204   3e-60   
ref|XP_004495576.1|  PREDICTED: L-allo-threonine aldolase-like is...    205   3e-60   Cicer arietinum [garbanzo]
emb|CDY49330.1|  BnaA05g32920D                                          204   3e-60   Brassica napus [oilseed rape]
gb|ACG34432.1|  L-allo-threonine aldolase                               205   4e-60   Zea mays [maize]
ref|XP_008661960.1|  PREDICTED: L-allo-threonine aldolase isoform X1    205   4e-60   
tpg|DAA36971.1|  TPA: putative threonine aldolase family protein ...    204   5e-60   
ref|XP_007144017.1|  hypothetical protein PHAVU_007G122200g             204   5e-60   Phaseolus vulgaris [French bean]
ref|XP_010906809.1|  PREDICTED: probable low-specificity L-threon...    204   6e-60   
ref|XP_010906810.1|  PREDICTED: probable low-specificity L-threon...    204   6e-60   
dbj|BAK03835.1|  predicted protein                                      204   9e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003580135.1|  PREDICTED: probable low-specificity L-threon...    203   1e-59   Brachypodium distachyon [annual false brome]
ref|XP_010553776.1|  PREDICTED: probable low-specificity L-threon...    202   2e-59   Tarenaya hassleriana [spider flower]
ref|XP_008443794.1|  PREDICTED: probable low-specificity L-threon...    202   2e-59   
ref|XP_006305180.1|  hypothetical protein CARUB_v10009546mg             202   2e-59   Capsella rubella
ref|XP_010553775.1|  PREDICTED: probable low-specificity L-threon...    202   3e-59   Tarenaya hassleriana [spider flower]
ref|XP_002448187.1|  hypothetical protein SORBIDRAFT_06g022630          202   3e-59   Sorghum bicolor [broomcorn]
ref|XP_010489194.1|  PREDICTED: probable low-specificity L-threon...    202   4e-59   Camelina sativa [gold-of-pleasure]
ref|NP_001241763.1|  L-allo-threonine aldolase                          202   4e-59   
ref|XP_010463930.1|  PREDICTED: probable low-specificity L-threon...    201   4e-59   Camelina sativa [gold-of-pleasure]
ref|XP_006298023.1|  hypothetical protein CARUB_v10014068mg             201   4e-59   Capsella rubella
ref|XP_008667491.1|  PREDICTED: putative threonine aldolase famil...    202   4e-59   
ref|XP_010415759.1|  PREDICTED: probable low-specificity L-threon...    201   5e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010475669.1|  PREDICTED: probable low-specificity L-threon...    201   7e-59   Camelina sativa [gold-of-pleasure]
ref|XP_002884450.1|  hypothetical protein ARALYDRAFT_896488             200   1e-58   Arabidopsis lyrata subsp. lyrata
gb|ACJ85157.1|  unknown                                                 201   2e-58   Medicago truncatula
ref|XP_003590970.1|  L-allo-threonine aldolase                          202   2e-58   
ref|NP_001149239.1|  L-allo-threonine aldolase                          199   4e-58   Zea mays [maize]
ref|XP_008802139.1|  PREDICTED: probable low-specificity L-threon...    199   5e-58   Phoenix dactylifera
gb|EMS52584.1|  L-allo-threonine aldolase                               198   5e-58   Triticum urartu
tpg|DAA45471.1|  TPA: hypothetical protein ZEAMMB73_239903              193   6e-58   
ref|XP_008655940.1|  PREDICTED: probable low-specificity L-threon...    193   7e-58   
ref|XP_010262337.1|  PREDICTED: probable low-specificity L-threon...    198   7e-58   Nelumbo nucifera [Indian lotus]
ref|NP_001189807.1|  threonine aldolase 2                               198   8e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010485829.1|  PREDICTED: probable low-specificity L-threon...    198   8e-58   Camelina sativa [gold-of-pleasure]
emb|CDY31134.1|  BnaA08g26840D                                          198   8e-58   Brassica napus [oilseed rape]
ref|XP_008655935.1|  PREDICTED: probable low-specificity L-threon...    194   9e-58   
ref|XP_009110878.1|  PREDICTED: probable low-specificity L-threon...    198   9e-58   Brassica rapa
ref|XP_010458106.1|  PREDICTED: probable low-specificity L-threon...    197   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_004976222.1|  PREDICTED: uncharacterized protein R102.4-like     197   3e-57   Setaria italica
emb|CAE05443.2|  OSJNBa0073E02.3                                        196   4e-57   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053314.1|  Os04g0516600                                       196   5e-57   
ref|XP_008667492.1|  PREDICTED: putative threonine aldolase famil...    196   5e-57   Zea mays [maize]
ref|XP_007030423.1|  L-allo-threonine aldolase isoform 4                196   6e-57   
gb|AAM63785.1|  unknown                                                 196   6e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004142582.1|  PREDICTED: L-allo-threonine aldolase-like          196   7e-57   
ref|XP_006588445.1|  PREDICTED: uncharacterized protein LOC100790...    195   1e-56   Glycine max [soybeans]
ref|NP_563822.1|  threonine aldolase                                    195   1e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006652519.1|  PREDICTED: uncharacterized protein R102.4-like     195   2e-56   Oryza brachyantha
gb|EMS67121.1|  L-allo-threonine aldolase                               194   3e-56   Triticum urartu
ref|XP_009389078.1|  PREDICTED: probable low-specificity L-threon...    194   3e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAF63783.1|  L-allo-threonine aldolase, putative                     194   4e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892465.1|  hypothetical protein ARALYDRAFT_470930             194   4e-56   
emb|CDY54493.1|  BnaCnng27100D                                          192   8e-56   Brassica napus [oilseed rape]
ref|NP_001242307.1|  uncharacterized protein LOC100790890               193   8e-56   
ref|XP_006857300.1|  hypothetical protein AMTR_s00067p00056150          192   2e-55   Amborella trichopoda
ref|XP_004155692.1|  PREDICTED: L-allo-threonine aldolase-like          192   2e-55   
ref|XP_008453666.1|  PREDICTED: probable low-specificity L-threon...    192   5e-55   Cucumis melo [Oriental melon]
dbj|BAJ93201.1|  predicted protein                                      191   8e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG00003.1|  ltaA                                                    188   2e-54   Gossypium arboreum [tree cotton]
gb|KHG00004.1|  ltaA                                                    188   6e-54   Gossypium arboreum [tree cotton]
ref|XP_010906814.1|  PREDICTED: probable low-specificity L-threon...    187   2e-53   Elaeis guineensis
ref|XP_004976228.1|  PREDICTED: uncharacterized protein R102.4-li...    187   2e-53   Setaria italica
ref|XP_008802138.1|  PREDICTED: probable low-specificity L-threon...    185   9e-53   Phoenix dactylifera
gb|AAF99780.1|AC003981_30  F22O13.11                                    183   3e-52   Arabidopsis thaliana [mouse-ear cress]
gb|KJB44863.1|  hypothetical protein B456_007G276400                    182   9e-52   Gossypium raimondii
gb|EPS60604.1|  hypothetical protein M569_14199                         181   9e-52   Genlisea aurea
gb|ABR18450.1|  unknown                                                 181   5e-51   Picea sitchensis
ref|XP_004976227.1|  PREDICTED: uncharacterized protein R102.4-li...    181   7e-51   
ref|XP_010520652.1|  PREDICTED: probable low-specificity L-threon...    175   5e-49   Tarenaya hassleriana [spider flower]
ref|XP_008453667.1|  PREDICTED: probable low-specificity L-threon...    176   6e-49   Cucumis melo [Oriental melon]
ref|XP_008802141.1|  PREDICTED: probable low-specificity L-threon...    173   2e-48   
ref|XP_004976226.1|  PREDICTED: uncharacterized protein R102.4-like     171   1e-47   Setaria italica
ref|NP_001077492.1|  threonine aldolase                                 170   4e-47   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK01917.1|  predicted protein                                      169   8e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001140767.1|  putative threonine aldolase family protein         166   6e-46   
gb|KGN66765.1|  hypothetical protein Csa_1G680120                       166   9e-46   
ref|XP_008675991.1|  PREDICTED: probable low-specificity L-threon...    161   9e-46   
ref|XP_008655946.1|  PREDICTED: probable low-specificity L-threon...    162   1e-45   
ref|XP_004170415.1|  PREDICTED: L-allo-threonine aldolase-like          165   2e-45   
ref|XP_008657658.1|  PREDICTED: probable low-specificity L-threon...    162   2e-45   Zea mays [maize]
emb|CDY59150.1|  BnaC08g13650D                                          167   5e-45   Brassica napus [oilseed rape]
ref|XP_001768407.1|  predicted protein                                  165   8e-45   
ref|XP_007030425.1|  Threonine aldolase 1 isoform 6                     163   9e-45   
ref|XP_008453668.1|  PREDICTED: probable low-specificity L-threon...    162   9e-44   Cucumis melo [Oriental melon]
ref|XP_008671569.1|  PREDICTED: probable low-specificity L-threon...    156   8e-43   Zea mays [maize]
gb|AFK42511.1|  unknown                                                 151   2e-42   Lotus japonicus
ref|XP_008671685.1|  PREDICTED: uncharacterized protein LOC103649121    156   2e-41   
ref|XP_002973664.1|  hypothetical protein SELMODRAFT_99781              152   3e-40   
ref|XP_008659428.1|  PREDICTED: probable low-specificity L-threon...    149   3e-40   
ref|XP_002975719.1|  hypothetical protein SELMODRAFT_103881             152   4e-40   
ref|XP_006442684.1|  hypothetical protein CICLE_v10020798mg             150   6e-40   
gb|AFW86293.1|  putative threonine aldolase family protein              150   1e-39   
ref|WP_020877756.1|  aromatic amino acid beta-eliminating lyase/t...    149   4e-39   Desulfococcus multivorans
ref|WP_011697570.1|  threonine aldolase                                 147   1e-38   Syntrophobacter fumaroxidans
ref|WP_027408853.1|  threonine aldolase                                 146   4e-38   Anoxybacillus tepidamans
ref|XP_004151117.1|  PREDICTED: L-allo-threonine aldolase-like          144   7e-38   
ref|XP_005854754.1|  threonine aldolase                                 144   9e-38   Nannochloropsis gaditana CCMP526
ref|WP_027448368.1|  threonine aldolase                                 145   1e-37   Pontibacillus marinus
gb|AIE93607.1|  Beta-eliminating lyase superfamily protein (ltaE)       145   2e-37   uncultured marine group II/III euryarchaeote AD1000_39_C05
ref|WP_037564212.1|  threonine aldolase                                 144   2e-37   Alkalispirochaeta odontotermitis
ref|WP_020265088.1|  hypothetical protein                               144   3e-37   
ref|WP_009609982.1|  threonine aldolase                                 143   5e-37   Caldanaerobacter subterraneus
ref|WP_011024735.1|  threonine aldolase                                 143   5e-37   Caldanaerobacter subterraneus
tpg|DAA54991.1|  TPA: putative threonine aldolase family protein        145   5e-37   
emb|CAN82414.1|  hypothetical protein VITISV_039151                     144   6e-37   Vitis vinifera
ref|WP_025322967.1|  threonine aldolase                                 142   1e-36   
gb|ACJ83727.1|  unknown                                                 135   3e-36   Medicago truncatula
ref|WP_014100459.1|  threonine aldolase                                 141   4e-36   Chloracidobacterium thermophilum
ref|WP_026475800.1|  threonine aldolase                                 141   4e-36   Alkaliphilus transvaalensis
gb|EEG77367.1|  Threonine aldolase                                      140   4e-36   Dethiobacter alkaliphilus AHT 1
ref|WP_040378796.1|  threonine aldolase                                 140   5e-36   
ref|WP_004400281.1|  MULTISPECIES: Threonine aldolase                   140   5e-36   Thermoanaerobacter
ref|WP_026677955.1|  threonine aldolase                                 140   6e-36   Fictibacillus gelatini
ref|WP_018706849.1|  hypothetical protein                               140   7e-36   Bacillus fordii
gb|EWM22625.1|  threonine aldolase                                      145   1e-35   Nannochloropsis gaditana
gb|EGU57937.1|  L-allo-threonine aldolase                               135   1e-35   Vibrio nigripulchritudo ATCC 27043
ref|WP_038146243.1|  threonine aldolase                                 135   2e-35   
ref|WP_012269711.1|  MULTISPECIES: threonine aldolase                   139   2e-35   Thermoanaerobacter
ref|WP_014062139.1|  threonine aldolase                                 139   2e-35   Thermoanaerobacter wiegelii
gb|ETK74181.1|  hypothetical protein, variant                           137   2e-35   Phytophthora parasitica
ref|WP_013988231.1|  threonine aldolase                                 139   2e-35   
ref|WP_006447171.1|  threonine aldolase                                 139   2e-35   Alicyclobacillus hesperidum
dbj|GAL27114.1|  low-specificity L-threonine aldolase                   135   2e-35   Vibrio variabilis
ref|WP_003867083.1|  MULTISPECIES: threonine aldolase                   139   3e-35   Thermoanaerobacter
ref|WP_029688227.1|  threonine aldolase                                 139   3e-35   
ref|XP_010906817.1|  PREDICTED: probable low-specificity L-threon...    138   4e-35   Elaeis guineensis
gb|ETM34050.1|  hypothetical protein, variant                           135   5e-35   Phytophthora parasitica
ref|WP_018133494.1|  hypothetical protein                               138   5e-35   Effusibacillus pohliae
ref|XP_008897473.1|  hypothetical protein, variant                      135   6e-35   Phytophthora parasitica INRA-310
ref|WP_003869086.1|  threonine aldolase                                 137   7e-35   
ref|WP_039929082.1|  threonine aldolase                                 137   7e-35   Thermoanaerobacter
ref|WP_014645330.1|  threonine aldolase                                 137   8e-35   Halobacillus halophilus
ref|WP_038227001.1|  threonine aldolase                                 137   9e-35   Vibrio sp. ER1A
gb|EIV99346.1|  threonine aldolase                                      137   1e-34   Thermoanaerobacter siderophilus SR4
ref|WP_038559128.1|  threonine aldolase                                 137   1e-34   Terribacillus
ref|WP_042834178.1|  threonine aldolase                                 137   1e-34   Thermoanaerobacter sp. YS13
gb|EMS57977.1|  L-allo-threonine aldolase                               135   2e-34   Triticum urartu
ref|WP_008216429.1|  threonine aldolase                                 136   2e-34   Vibrionales bacterium SWAT-3
gb|AIE92478.1|  threonine aldolase (ltaE)                               136   2e-34   uncultured marine group II/III euryarchaeote AD1000_23_G03
gb|ETK74180.1|  hypothetical protein L915_18981                         136   2e-34   Phytophthora parasitica
ref|WP_042470320.1|  threonine aldolase                                 135   2e-34   
ref|WP_012957344.1|  threonine aldolase                                 136   2e-34   Bacillus pseudofirmus
ref|WP_013296780.1|  threonine aldolase                                 136   2e-34   Thermoanaerobacterium thermosaccharolyticum
ref|WP_019839219.1|  threonine aldolase                                 136   3e-34   Aeromonas sp. MDS8
ref|WP_017781663.1|  threonine aldolase                                 136   3e-34   Aeromonas hydrophila
ref|WP_010634262.1|  MULTISPECIES: L-allo-threonine aldolase            135   3e-34   Aeromonas
ref|WP_022601443.1|  Low specificity L-threonine aldolase               135   3e-34   Vibrio nigripulchritudo
ref|WP_017786172.1|  threonine aldolase                                 135   3e-34   Aeromonas hydrophila
ref|WP_034132280.1|  threonine aldolase                                 135   3e-34   
ref|WP_017765885.1|  threonine aldolase                                 135   3e-34   Aeromonas
ref|WP_005299873.1|  threonine aldolase                                 135   3e-34   Aeromonas dhakensis
ref|WP_025229058.1|  threonine aldolase                                 135   3e-34   Fimbriimonas ginsengisoli
ref|WP_042050919.1|  L-allo-threonine aldolase                          135   3e-34   Aeromonas dhakensis
ref|WP_034131989.1|  threonine aldolase                                 135   4e-34   
ref|WP_004740139.1|  threonine aldolase                                 135   4e-34   Vibrio splendidus
ref|WP_017109562.1|  threonine aldolase                                 135   4e-34   Vibrio
gb|ETM34049.1|  hypothetical protein L914_18796                         135   5e-34   Phytophthora parasitica
ref|WP_014394185.1|  threonine aldolase                                 135   5e-34   Corallococcus coralloides
ref|WP_017067124.1|  threonine aldolase                                 135   5e-34   Vibrio crassostreae
ref|XP_008897472.1|  hypothetical protein PPTG_05622                    135   6e-34   Phytophthora parasitica INRA-310
ref|WP_022597498.1|  Low specificity L-threonine aldolase               135   7e-34   Vibrio nigripulchritudo
ref|WP_042008166.1|  L-allo-threonine aldolase                          135   7e-34   Aeromonas dhakensis
ref|WP_015310760.1|  threonine aldolase                                 135   7e-34   Thermoanaerobacterium thermosaccharolyticum
ref|WP_013778623.1|  threonine aldolase                                 135   7e-34   Tepidanaerobacter acetatoxydans
ref|WP_022592526.1|  Low specificity L-threonine aldolase               134   8e-34   Vibrio nigripulchritudo
ref|WP_009793967.1|  MULTISPECIES: threonine aldolase                   134   9e-34   Bacillus
ref|WP_022561270.1|  Low specificity L-threonine aldolase               134   9e-34   Vibrio nigripulchritudo
ref|WP_042071615.1|  L-allo-threonine aldolase                          134   9e-34   Aeromonas enteropelogenes
ref|WP_029301221.1|  L-allo-threonine aldolase                          134   1e-33   Aeromonas hydrophila
ref|WP_015049145.1|  threonine aldolase                                 134   1e-33   Simiduia agarivorans
ref|WP_017104708.1|  threonine aldolase                                 134   1e-33   Vibrio
dbj|GAK82526.1|  low-specificity L-threonine aldolase                   130   1e-33   Vibrio ponticus
ref|WP_043171927.1|  MULTISPECIES: L-allo-threonine aldolase            134   1e-33   Aeromonas
ref|WP_003540689.1|  threonine aldolase                                 134   1e-33   Desulfotomaculum nigrificans
ref|WP_038083758.1|  threonine aldolase                                 134   1e-33   Tumebacillus flagellatus
ref|WP_044799803.1|  L-allo-threonine aldolase                          134   1e-33   Aeromonas hydrophila
ref|WP_011196526.1|  threonine aldolase                                 134   2e-33   Symbiobacterium thermophilum
ref|WP_034217358.1|  threonine aldolase                                 134   2e-33   
ref|WP_034421730.1|  threonine aldolase                                 134   2e-33   Clostridiales bacterium DRI-13
tpg|DAA54990.1|  TPA: putative threonine aldolase family protein        135   2e-33   
ref|WP_016566240.1|  l-allo-threonine aldolase                          133   2e-33   
ref|WP_017064540.1|  threonine aldolase                                 133   3e-33   Vibrio crassostreae
ref|WP_022629649.1|  threonine aldolase                                 133   3e-33   Bacillus marmarensis
ref|WP_006069652.1|  threonine aldolase                                 133   3e-33   Vibrio shilonii
ref|WP_017078726.1|  threonine aldolase                                 133   3e-33   Vibrio splendidus
ref|WP_017070585.1|  threonine aldolase                                 133   3e-33   Vibrio crassostreae
ref|WP_042028952.1|  L-allo-threonine aldolase                          133   3e-33   Aeromonas enteropelogenes
ref|WP_017086880.1|  threonine aldolase                                 133   3e-33   Vibrio splendidus
ref|WP_026456738.1|  L-allo-threonine aldolase                          133   3e-33   Aeromonas enteropelogenes
ref|WP_040745449.1|  threonine aldolase                                 133   4e-33   
ref|WP_006643962.1|  threonine aldolase                                 132   4e-33   Photobacterium sp. SKA34
ref|WP_043555330.1|  L-allo-threonine aldolase                          133   4e-33   Aeromonas bestiarum
ref|WP_017095444.1|  threonine aldolase                                 132   4e-33   Vibrio splendidus
ref|WP_043122222.1|  L-allo-threonine aldolase                          133   4e-33   Aeromonas hydrophila
ref|WP_042147273.1|  threonine aldolase                                 132   4e-33   Paucisalibacillus sp. EB02
ref|WP_043165668.1|  L-allo-threonine aldolase                          132   4e-33   Aeromonas hydrophila
gb|EDP63139.1|  L-allo-threonine aldolase                               133   4e-33   alpha proteobacterium BAL199
gb|EVU16683.1|  L-allo-threonine aldolase                               128   4e-33   Vibrio parahaemolyticus V-223/04
gb|ABO48655.1|  L-threonine aldolase                                    132   4e-33   Desulfotomaculum reducens MI-1
ref|WP_041274354.1|  threonine aldolase                                 132   4e-33   
ref|WP_019822304.1|  threonine aldolase                                 132   4e-33   
ref|WP_017058210.1|  threonine aldolase                                 132   4e-33   
ref|WP_044162565.1|  threonine aldolase                                 132   5e-33   
dbj|BAL53180.1|  threonine aldolase                                     132   5e-33   
ref|WP_035985324.1|  threonine aldolase                                 133   5e-33   
ref|WP_024943462.1|  L-allo-threonine aldolase                          132   5e-33   
ref|WP_017062565.1|  threonine aldolase                                 132   5e-33   
ref|WP_013275483.1|  threonine aldolase                                 132   5e-33   
ref|WP_022934098.1|  threonine aldolase                                 132   6e-33   
ref|WP_017025760.1|  threonine aldolase                                 132   6e-33   
gb|EPZ48130.1|  hypothetical protein N007_04560                         132   6e-33   
ref|WP_027695975.1|  threonine aldolase                                 132   6e-33   
ref|WP_017076025.1|  threonine aldolase                                 132   6e-33   
ref|WP_031218345.1|  threonine aldolase                                 132   6e-33   
ref|WP_039214922.1|  L-allo-threonine aldolase                          132   7e-33   
ref|WP_035551533.1|  threonine aldolase                                 132   7e-33   
ref|WP_029303300.1|  L-allo-threonine aldolase                          132   7e-33   
ref|WP_017102851.1|  threonine aldolase                                 132   7e-33   
ref|WP_006092490.1|  threonine aldolase                                 132   7e-33   
ref|WP_017089379.1|  threonine aldolase                                 132   7e-33   
ref|WP_043136661.1|  L-allo-threonine aldolase                          132   7e-33   
ref|WP_006827009.1|  threonine aldolase                                 132   8e-33   
ref|WP_034631722.1|  threonine aldolase                                 132   8e-33   
ref|WP_027415105.1|  threonine aldolase                                 132   8e-33   
ref|WP_016350428.1|  L-allo-threonine aldolase                          132   9e-33   
gb|AGI05087.1|  threonine aldolase                                      130   9e-33   
ref|WP_005337176.1|  threonine aldolase                                 132   9e-33   
ref|WP_009845431.1|  MULTISPECIES: threonine aldolase                   132   9e-33   
ref|WP_039624451.1|  threonine aldolase                                 131   1e-32   
ref|WP_031408953.1|  threonine aldolase                                 132   1e-32   
ref|WP_042033568.1|  L-allo-threonine aldolase                          131   1e-32   
ref|WP_010678507.1|  threonine aldolase                                 131   1e-32   
tpg|DAA39241.1|  TPA: putative threonine aldolase family protein        133   1e-32   
ref|WP_042064361.1|  L-allo-threonine aldolase                          131   1e-32   
ref|WP_033129146.1|  L-allo-threonine aldolase                          131   1e-32   
gb|KCW61512.1|  hypothetical protein EUGRSUZ_H04236                     130   1e-32   
ref|WP_010675015.1|  MULTISPECIES: threonine aldolase                   131   1e-32   
ref|WP_005472373.1|  threonine aldolase                                 131   1e-32   
ref|WP_004731185.1|  threonine aldolase                                 131   1e-32   
ref|WP_042640779.1|  L-allo-threonine aldolase                          131   1e-32   
ref|WP_017632336.1|  threonine aldolase                                 131   1e-32   
ref|WP_043851472.1|  L-allo-threonine aldolase                          131   1e-32   
ref|WP_016958887.1|  threonine aldolase                                 131   1e-32   
ref|WP_017004902.1|  threonine aldolase                                 131   1e-32   
ref|WP_017410193.1|  threonine aldolase                                 131   1e-32   
ref|WP_017006944.1|  threonine aldolase                                 131   1e-32   
ref|WP_042871316.1|  L-allo-threonine aldolase                          131   2e-32   
ref|WP_013705006.1|  threonine aldolase                                 131   2e-32   
ref|WP_043893263.1|  threonine aldolase                                 131   2e-32   
ref|WP_027883536.1|  threonine aldolase                                 131   2e-32   
gb|EPJ52411.1|  hypothetical protein OFPI_14000                         131   2e-32   
ref|WP_041207448.1|  L-allo-threonine aldolase                          131   2e-32   
ref|WP_041887564.1|  threonine aldolase                                 131   2e-32   
ref|WP_042019111.1|  L-allo-threonine aldolase                          131   2e-32   
ref|WP_028784440.1|  threonine aldolase                                 131   2e-32   
ref|WP_027877883.1|  threonine aldolase                                 131   2e-32   
ref|WP_033406166.1|  hypothetical protein                               131   2e-32   
ref|WP_027365759.1|  threonine aldolase                                 131   2e-32   
ref|WP_000854011.1|  threonine aldolase                                 131   2e-32   
ref|WP_039447431.1|  threonine aldolase                                 130   2e-32   
ref|WP_011081042.1|  threonine aldolase                                 130   2e-32   
ref|WP_014434736.1|  threonine aldolase                                 131   2e-32   
ref|WP_042057263.1|  L-allo-threonine aldolase                          130   2e-32   
ref|WP_008989461.1|  threonine aldolase                                 130   2e-32   
ref|WP_017092987.1|  threonine aldolase                                 130   2e-32   
ref|WP_011705678.1|  threonine aldolase                                 130   2e-32   
ref|WP_005584362.1|  L-allo-threonine aldolase                          130   2e-32   
ref|WP_008074850.1|  threonine aldolase                                 130   3e-32   
ref|WP_017080978.1|  threonine aldolase                                 130   3e-32   
ref|WP_012063574.1|  threonine aldolase                                 130   3e-32   
ref|WP_024050701.1|  hypothetical protein                               130   3e-32   
ref|WP_043162748.1|  L-allo-threonine aldolase                          130   3e-32   
ref|WP_034107576.1|  threonine aldolase                                 130   3e-32   
ref|WP_034427809.1|  threonine aldolase                                 130   3e-32   
ref|WP_024944061.1|  L-allo-threonine aldolase                          130   3e-32   
ref|WP_013171710.1|  threonine aldolase [                               130   3e-32   
gb|AIF02517.1|  Beta-eliminating lyase superfamily protein (ltaE)       130   3e-32   
gb|ETL80848.1|  hypothetical protein, variant                           129   3e-32   
ref|WP_002629188.1|  Low-specificity L-threonine aldolase               130   4e-32   
ref|WP_040094296.1|  L-allo-threonine aldolase                          130   4e-32   
ref|WP_005351141.1|  threonine aldolase                                 130   4e-32   
ref|WP_005359865.1|  threonine aldolase                                 130   4e-32   
ref|WP_019444708.1|  threonine aldolase                                 130   4e-32   
ref|XP_008897475.1|  hypothetical protein, variant                      129   4e-32   
ref|WP_043823591.1|  L-allo-threonine aldolase                          130   4e-32   
ref|WP_005346530.1|  threonine aldolase                                 130   4e-32   
ref|WP_011551549.1|  threonine aldolase                                 130   4e-32   
ref|WP_017069124.1|  threonine aldolase                                 130   5e-32   
ref|WP_042055613.1|  L-allo-threonine aldolase                          130   5e-32   
ref|WP_012579439.1|  threonine aldolase                                 130   5e-32   
gb|KJG31994.1|  threonine aldolase                                      129   5e-32   
ref|WP_038147072.1|  threonine aldolase                                 130   5e-32   
gb|KJG42774.1|  threonine aldolase                                      129   5e-32   
ref|WP_038214282.1|  threonine aldolase                                 129   5e-32   
ref|WP_006672298.1|  threonine aldolase                                 129   6e-32   
ref|WP_000347574.1|  threonine aldolase                                 129   6e-32   
gb|KJG17909.1|  threonine aldolase                                      129   6e-32   
ref|WP_006714392.1|  threonine aldolase                                 129   6e-32   
gb|KJG03116.1|  threonine aldolase                                      129   6e-32   
ref|WP_004103798.1|  threonine aldolase                                 129   6e-32   
ref|WP_013970093.1|  threonine aldolase                                 129   6e-32   
ref|WP_039038701.1|  L-allo-threonine aldolase                          129   6e-32   
ref|WP_017302462.1|  hypothetical protein                               129   7e-32   
ref|WP_044022162.1|  threonine aldolase                                 129   7e-32   
gb|AIE95112.1|  Beta-eliminating lyase superfamily protein (ltaE)       129   7e-32   
gb|EDL66247.1|  L-allo-threonine aldolase                               129   7e-32   
gb|AIE99022.1|  Beta-eliminating lyase superfamily protein (ltaE)       129   7e-32   
ref|WP_038192232.1|  threonine aldolase                                 129   7e-32   
ref|WP_002635500.1|  threonine aldolase                                 129   8e-32   
gb|AIF08118.1|  Beta-eliminating lyase superfamily protein (ltaE)       129   8e-32   
ref|WP_039474404.1|  threonine aldolase                                 129   8e-32   
ref|WP_042076536.1|  L-allo-threonine aldolase                          129   8e-32   
gb|EGU19361.1|  L-allo-threonine aldolase                               129   9e-32   
ref|WP_042081921.1|  L-allo-threonine aldolase                          129   9e-32   
ref|WP_039480221.1|  threonine aldolase                                 129   9e-32   
ref|WP_043759978.1|  L-allo-threonine aldolase                          129   9e-32   
ref|WP_025640491.1|  threonine aldolase                                 129   1e-31   
sp|O07051.1|LTAA_AERJA  RecName: Full=L-allo-threonine aldolase; ...    129   1e-31   
ref|WP_028777176.1|  threonine aldolase                                 129   1e-31   
ref|WP_025027486.1|  threonine aldolase                                 129   1e-31   
ref|WP_018625079.1|  threonine aldolase                                 129   1e-31   
ref|WP_005364740.1|  threonine aldolase                                 129   1e-31   
ref|WP_038899520.1|  threonine aldolase                                 129   1e-31   
pdb|3WGC|A  Chain A, Aeromonas Jandaei L-allo-threonine Aldolase ...    129   1e-31   
ref|WP_017790755.1|  threonine aldolase                                 129   1e-31   
ref|WP_038886197.1|  threonine aldolase                                 129   1e-31   
pdb|3WGB|A  Chain A, Crystal Structure Of Aeromonas Jandaei L-all...    129   1e-31   
ref|WP_042034357.1|  L-allo-threonine aldolase                          129   1e-31   
ref|WP_040069314.1|  L-allo-threonine aldolase                          129   1e-31   
ref|WP_000347573.1|  MULTISPECIES: threonine aldolase                   129   1e-31   
ref|WP_000347575.1|  threonine aldolase                                 129   1e-31   
gb|KGN66766.1|  hypothetical protein Csa_1G681120                       123   1e-31   
ref|WP_034122282.1|  threonine aldolase                                 129   1e-31   
ref|WP_009385056.1|  threonine aldolase                                 129   1e-31   
ref|WP_027888175.1|  MULTISPECIES: threonine aldolase                   129   1e-31   
ref|WP_025327203.1|  L-allo-threonine aldolase                          129   1e-31   
gb|KJF97803.1|  threonine aldolase                                      128   1e-31   
ref|WP_021231410.1|  threonine aldolase                                 128   1e-31   
ref|WP_031852043.1|  threonine aldolase                                 128   2e-31   
ref|WP_010451642.1|  threonine aldolase                                 128   2e-31   
ref|WP_006904712.1|  threonine aldolase                                 128   2e-31   
gb|ETL80847.1|  hypothetical protein L917_18707                         129   2e-31   
ref|WP_005396402.1|  low-specificity L-threonine aldolase               128   2e-31   
ref|WP_005594507.1|  threonine aldolase                                 128   2e-31   
ref|WP_016785291.1|  threonine aldolase                                 128   2e-31   
gb|ETI33812.1|  hypothetical protein F443_19563                         129   2e-31   
gb|ETM34051.1|  hypothetical protein L914_18797                         129   2e-31   
gb|AGF92836.1|  low-specificity L-threonine aldolase                    128   2e-31   
ref|WP_026906754.1|  threonine aldolase                                 128   2e-31   
ref|WP_000347576.1|  threonine aldolase                                 128   2e-31   
ref|WP_025541936.1|  threonine aldolase                                 128   2e-31   
ref|WP_020373357.1|  hypothetical protein                               128   2e-31   
ref|XP_008897474.1|  hypothetical protein PPTG_05623                    129   2e-31   
ref|WP_042520986.1|  threonine aldolase                                 128   2e-31   
ref|WP_028022675.1|  threonine aldolase                                 128   2e-31   
ref|WP_040992653.1|  MULTISPECIES: threonine aldolase                   128   2e-31   
ref|WP_040305009.1|  threonine aldolase                                 128   2e-31   
ref|WP_031820542.1|  threonine aldolase                                 128   2e-31   
ref|WP_025627548.1|  threonine aldolase                                 128   2e-31   
ref|WP_035698102.1|  threonine aldolase                                 125   2e-31   
ref|WP_016768093.1|  threonine aldolase                                 128   2e-31   
ref|XP_009516979.1|  hypothetical protein PHYSODRAFT_471070             128   2e-31   
ref|WP_030000032.1|  threonine aldolase                                 128   2e-31   
ref|WP_029955476.1|  threonine aldolase                                 124   2e-31   
ref|WP_038137262.1|  threonine aldolase                                 128   2e-31   
ref|WP_042650284.1|  L-allo-threonine aldolase                          128   2e-31   
ref|WP_042016636.1|  L-allo-threonine aldolase                          128   2e-31   
ref|WP_042501630.1|  threonine aldolase                                 127   2e-31   
ref|WP_014757710.1|  MULTISPECIES: threonine aldolase                   128   3e-31   
ref|WP_032552639.1|  threonine aldolase                                 127   3e-31   
ref|WP_023072817.1|  threonine aldolase                                 128   3e-31   
gb|EFL90728.1|  threonine aldolase                                      128   3e-31   
ref|WP_012324966.1|  threonine aldolase                                 127   3e-31   
ref|WP_006665336.1|  threonine aldolase                                 128   3e-31   
ref|WP_009705325.1|  threonine aldolase                                 127   3e-31   
emb|CEG01512.1|  Aromatic amino acid beta-eliminating lyase/threo...    128   3e-31   
gb|AIV07123.1|  threonine aldolase                                      127   3e-31   
ref|WP_006166339.1|  threonine aldolase                                 128   3e-31   
ref|WP_013787005.1|  threonine aldolase                                 128   3e-31   
gb|ADU51350.1|  L-threonine aldolase                                    128   3e-31   
ref|WP_029774242.1|  threonine aldolase                                 127   3e-31   
gb|EKM29605.1|  low specificity L-threonine aldolase                    127   3e-31   
ref|WP_004513587.1|  threonine aldolase                                 127   3e-31   
ref|WP_029710900.1|  MULTISPECIES: threonine aldolase                   124   3e-31   
ref|WP_040110649.1|  threonine aldolase                                 127   3e-31   
ref|WP_032088129.1|  threonine aldolase                                 127   3e-31   
ref|WP_015727709.1|  threonine aldolase                                 127   3e-31   
ref|WP_039987426.1|  threonine aldolase                                 127   3e-31   
ref|WP_022611326.1|  Low specificity L-threonine aldolase               127   3e-31   
ref|WP_010644227.1|  threonine aldolase                                 127   3e-31   
ref|WP_017008285.1|  threonine aldolase                                 127   3e-31   
ref|WP_009696116.1|  MULTISPECIES: threonine aldolase                   127   3e-31   
ref|WP_038963804.1|  threonine aldolase                                 127   3e-31   
ref|XP_002907740.1|  L-allo-threonine aldolase                          127   3e-31   
ref|WP_012155441.1|  threonine aldolase                                 127   3e-31   
ref|WP_038891255.1|  threonine aldolase                                 127   3e-31   
gb|EQL91328.1|  cys/Met metabolism PLP-dependent enzyme family pr...    127   3e-31   
ref|WP_039839175.1|  threonine aldolase                                 127   4e-31   
ref|WP_029789292.1|  threonine aldolase                                 127   4e-31   
ref|WP_005532104.1|  L-allo-threonine aldolase                          127   4e-31   
ref|WP_017013973.1|  threonine aldolase                                 127   4e-31   
ref|WP_004411494.1|  threonine aldolase                                 127   4e-31   
ref|WP_004588784.1|  low-specificity L-threonine aldolase               127   4e-31   
ref|WP_042013238.1|  L-allo-threonine aldolase                          127   4e-31   
ref|WP_025767724.1|  threonine aldolase                                 127   4e-31   
ref|WP_042656520.1|  L-allo-threonine aldolase                          127   4e-31   
ref|XP_003080829.1|  L-allo-threonine aldolase, putative (ISS)          128   4e-31   
ref|WP_025794376.1|  threonine aldolase                                 127   4e-31   
ref|WP_025504468.1|  threonine aldolase                                 127   4e-31   
ref|WP_042468228.1|  L-allo-threonine aldolase                          127   4e-31   
ref|WP_031855575.1|  threonine aldolase                                 127   4e-31   
ref|WP_031781926.1|  threonine aldolase                                 127   4e-31   
ref|WP_005480299.1|  threonine aldolase                                 127   4e-31   
ref|WP_025629171.1|  threonine aldolase                                 127   4e-31   
ref|WP_025551796.1|  threonine aldolase                                 127   4e-31   
ref|WP_029849857.1|  threonine aldolase                                 127   4e-31   
ref|WP_042601515.1|  threonine aldolase                                 127   4e-31   
ref|WP_025817565.1|  threonine aldolase                                 127   4e-31   
ref|WP_017820204.1|  threonine aldolase                                 127   4e-31   
ref|WP_022579030.1|  threonine aldolase                                 127   4e-31   



>ref|XP_009798339.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
 ref|XP_009798340.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
 ref|XP_009798341.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
 ref|XP_009798342.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
 ref|XP_009798343.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
Length=359

 Score =   258 bits (658),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVGSV+VG KSFI +A+I+RKTLGGGMRQ+GVLCAAA + F
Sbjct  193  RLVRAADSVSVCLSKGLGAPVGSVVVGSKSFIAKAKILRKTLGGGMRQVGVLCAAAFIAF  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KLEGDHKKAK LAE LNKI GL+VD+A+VETNIV+CDILK +  +E E+CK L +
Sbjct  253  QENLVKLEGDHKKAKILAEELNKIKGLKVDIAAVETNIVYCDILKGSKISETEMCKTLEQ  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            HG+LILPEGP+RIRFVIHHQIS+ DV YA S VQRA+ GVA  +GD
Sbjct  313  HGLLILPEGPQRIRFVIHHQISENDVHYAASCVQRALAGVAEENGD  358



>ref|XP_009631531.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
tomentosiformis]
 ref|XP_009631532.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
tomentosiformis]
 ref|XP_009631533.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
tomentosiformis]
Length=359

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVGSV+VG KSFI +A+I+RKTLGGGMRQ+GVLCAAA +GF
Sbjct  193  RLVRAADSVSVCLSKGLGAPVGSVVVGSKSFIAKAKILRKTLGGGMRQVGVLCAAAFIGF  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KLEGDHKKAK LAE LNKI GL+VD+A+VETNIV+CDILK +  +E E+CK L +
Sbjct  253  QENLVKLEGDHKKAKILAEELNKIKGLKVDIAAVETNIVYCDILKGSKISETEMCKILEQ  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            HG+LILPEG  RIRFVIHHQIS+ DV YA+S VQRA+ GVA  +GD
Sbjct  313  HGLLILPEGLMRIRFVIHHQISENDVHYAVSCVQRALAGVAEENGD  358



>emb|CDO99988.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   251 bits (642),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVS+CLSKGLGAPVG+VIVG ++FI RARI+RKTLGGGMRQ+GVLCAAAL+  
Sbjct  174  RLVQAADSVSICLSKGLGAPVGTVIVGSETFIARARILRKTLGGGMRQVGVLCAAALIAL  233

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QENVGKLEGDHKKAKTLA GLNKI GL VD+ SVETNIV+CDILK  N TE +LCK L  
Sbjct  234  QENVGKLEGDHKKAKTLAVGLNKIKGLNVDIDSVETNIVYCDILKSVNITETKLCKILEG  293

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGV  201
            HG+LILPEGP RIR V+HHQIS++DV Y LS +Q+AV GV
Sbjct  294  HGILILPEGPFRIRMVLHHQISESDVHYTLSCMQQAVNGV  333



>ref|XP_004236787.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Solanum lycopersicum]
 ref|XP_004236788.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Solanum lycopersicum]
 ref|XP_004236789.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Solanum lycopersicum]
Length=359

 Score =   247 bits (631),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVGSVIVG KSFI RA+I+RKTLGGGMRQIGVLCAAA    
Sbjct  193  RLVQAADSVSVCLSKGLGAPVGSVIVGSKSFIARAKILRKTLGGGMRQIGVLCAAAFTAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KLEGDH+KAK LA  LNKI GL+VD+A+VETNIV+CDILK +  +E EL K L +
Sbjct  253  QENLVKLEGDHRKAKILAAELNKIKGLKVDVATVETNIVYCDILKGSRISEAELVKTLEQ  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            +G+LILPEGP R+RFV+HHQIS++DV YA+S +QRA+ GVA  +GD
Sbjct  313  YGLLILPEGPLRVRFVLHHQISESDVHYAVSCIQRALAGVAEENGD  358



>ref|XP_010319280.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010319281.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010319282.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Solanum lycopersicum]
Length=361

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVGSVIVG KSFI RA+I+RKTLGGGMRQIGVLCAAA    
Sbjct  195  RLVQAADSVSVCLSKGLGAPVGSVIVGSKSFIARAKILRKTLGGGMRQIGVLCAAAFTAL  254

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KLEGDH+KAK LA  LNKI GL+VD+A+VETNIV+CDILK +  +E EL K L +
Sbjct  255  QENLVKLEGDHRKAKILAAELNKIKGLKVDVATVETNIVYCDILKGSRISEAELVKTLEQ  314

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            +G+LILPEGP R+RFV+HHQIS++DV YA+S +QRA+ GVA  +GD
Sbjct  315  YGLLILPEGPLRVRFVLHHQISESDVHYAVSCIQRALAGVAEENGD  360



>ref|NP_001275261.1| L-allo-threonine aldolase-related protein [Solanum tuberosum]
 ref|XP_006361424.1| PREDICTED: uncharacterized protein R102.4 isoform X5 [Solanum 
tuberosum]
 ref|XP_006361425.1| PREDICTED: uncharacterized protein R102.4 isoform X6 [Solanum 
tuberosum]
 gb|ABB72802.1| L-allo-threonine aldolase-related protein [Solanum tuberosum]
Length=359

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVGSV+VG KSFI RA+I+RKTLGGGMRQIGVLCAAA    
Sbjct  193  RLVQAADSVSVCLSKGLGAPVGSVVVGSKSFIARAKILRKTLGGGMRQIGVLCAAAFTAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KLEGDH+KAK+LA  LNKI GL+VD+A+VETNIV+CDILK +  +E EL K L +
Sbjct  253  QENLVKLEGDHRKAKSLAAELNKIKGLKVDVATVETNIVYCDILKGSRISETELVKTLEQ  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            +G+LILPEGP R+RFV+HHQIS++DV YA+S +QRA+ GVA  +GD
Sbjct  313  YGLLILPEGPLRVRFVLHHQISESDVHYAVSCLQRALAGVAEENGD  358



>ref|XP_006361420.1| PREDICTED: uncharacterized protein R102.4 isoform X1 [Solanum 
tuberosum]
 ref|XP_006361421.1| PREDICTED: uncharacterized protein R102.4 isoform X2 [Solanum 
tuberosum]
 ref|XP_006361422.1| PREDICTED: uncharacterized protein R102.4 isoform X3 [Solanum 
tuberosum]
Length=361

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVGSV+VG KSFI RA+I+RKTLGGGMRQIGVLCAAA    
Sbjct  195  RLVQAADSVSVCLSKGLGAPVGSVVVGSKSFIARAKILRKTLGGGMRQIGVLCAAAFTAL  254

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KLEGDH+KAK+LA  LNKI GL+VD+A+VETNIV+CDILK +  +E EL K L +
Sbjct  255  QENLVKLEGDHRKAKSLAAELNKIKGLKVDVATVETNIVYCDILKGSRISETELVKTLEQ  314

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            +G+LILPEGP R+RFV+HHQIS++DV YA+S +QRA+ GVA  +GD
Sbjct  315  YGLLILPEGPLRVRFVLHHQISESDVHYAVSCLQRALAGVAEENGD  360



>emb|CBI22386.3| unnamed protein product [Vitis vinifera]
Length=345

 Score =   238 bits (606),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RL+QAADS SVCLSKGLGAPVGSVIVG KSFI +AR +RKTLGGGMRQ+G++CAAALV  
Sbjct  174  RLLQAADSASVCLSKGLGAPVGSVIVGSKSFIAKARRLRKTLGGGMRQVGIICAAALVAL  233

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KLEGDHKKAK LAEGLN+I GL+V++ SVETNIV+ +I++ +N T  +LCK L E
Sbjct  234  QENIAKLEGDHKKAKILAEGLNQIKGLKVNVTSVETNIVYFEIVEGSNITAEKLCKYLQE  293

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            HGVL++PE   RIR V+HHQIS TDVQY LS +Q+AVTGV + +GD
Sbjct  294  HGVLMMPESSSRIRVVLHHQISGTDVQYTLSCIQQAVTGVHDCNGD  339



>ref|XP_009795458.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
Length=372

 Score =   238 bits (608),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 136/166 (82%), Gaps = 0/166 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVS CLSKGLGAP GSVIVG KSFI RA+I+RKTLGGGMRQIGVLCAAA V  
Sbjct  193  RLVQAADSVSACLSKGLGAPAGSVIVGSKSFIARAKILRKTLGGGMRQIGVLCAAASVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KLEGDH+KAK LAE LNKI GL+VD A+VETNIV+C ILK +  +   LCK L +
Sbjct  253  QENLVKLEGDHRKAKLLAEELNKIKGLKVDSAAVETNIVYCHILKGSKVSRTHLCKILEQ  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            HG+L+LPEGP RIRFVIHHQIS++DV Y +S +Q+ + G A  +GD
Sbjct  313  HGILVLPEGPMRIRFVIHHQISESDVHYTVSCLQQTLAGEAEENGD  358



>ref|XP_002266992.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Vitis 
vinifera]
 ref|XP_003633695.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Vitis 
vinifera]
 ref|XP_003633696.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Vitis 
vinifera]
 ref|XP_010660226.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Vitis 
vinifera]
Length=364

 Score =   238 bits (607),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RL+QAADS SVCLSKGLGAPVGSVIVG KSFI +AR +RKTLGGGMRQ+G++CAAALV  
Sbjct  193  RLLQAADSASVCLSKGLGAPVGSVIVGSKSFIAKARRLRKTLGGGMRQVGIICAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KLEGDHKKAK LAEGLN+I GL+V++ SVETNIV+ +I++ +N T  +LCK L E
Sbjct  253  QENIAKLEGDHKKAKILAEGLNQIKGLKVNVTSVETNIVYFEIVEGSNITAEKLCKYLQE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            HGVL++PE   RIR V+HHQIS TDVQY LS +Q+AVTGV + +GD
Sbjct  313  HGVLMMPESSSRIRVVLHHQISGTDVQYTLSCIQQAVTGVHDCNGD  358



>ref|XP_007030420.1| Threonine aldolase 1 isoform 1 [Theobroma cacao]
 ref|XP_007030421.1| Threonine aldolase 1 isoform 1 [Theobroma cacao]
 gb|EOY10922.1| Threonine aldolase 1 isoform 1 [Theobroma cacao]
 gb|EOY10923.1| Threonine aldolase 1 isoform 1 [Theobroma cacao]
Length=358

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADS+SVCLSKGLGAPVGSVIVG KSFI +AR +RKTLGGGMRQ+G +CAAA V  
Sbjct  193  RLVQAADSISVCLSKGLGAPVGSVIVGSKSFITKARRLRKTLGGGMRQVGFICAAAFVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QENVGKLEGDHKKAK LAEGLN+I GL VD+A+V+TNI++ DI++ +  T  +L K L E
Sbjct  253  QENVGKLEGDHKKAKVLAEGLNQIKGLRVDVAAVQTNIIYFDIVEGSKLTAEKLYKNLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            HGVL++PEGP R+R V+HHQIS +DVQY LS  Q+A+TGV   +G+
Sbjct  313  HGVLVMPEGPARMRIVLHHQISSSDVQYTLSCFQQALTGVQEENGN  358



>ref|XP_007030422.1| Threonine aldolase 1 isoform 3, partial [Theobroma cacao]
 gb|EOY10924.1| Threonine aldolase 1 isoform 3, partial [Theobroma cacao]
Length=355

 Score =   234 bits (598),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADS+SVCLSKGLGAPVGSVIVG KSFI +AR +RKTLGGGMRQ+G +CAAA V  
Sbjct  193  RLVQAADSISVCLSKGLGAPVGSVIVGSKSFITKARRLRKTLGGGMRQVGFICAAAFVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QENVGKLEGDHKKAK LAEGLN+I GL VD+A+V+TNI++ DI++ +  T  +L K L E
Sbjct  253  QENVGKLEGDHKKAKVLAEGLNQIKGLRVDVAAVQTNIIYFDIVEGSKLTAEKLYKNLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGV  201
            HGVL++PEGP R+R V+HHQIS +DVQY LS  Q+A+TGV
Sbjct  313  HGVLVMPEGPARMRIVLHHQISSSDVQYTLSCFQQALTGV  352



>ref|XP_002521974.1| l-allo-threonine aldolase, putative [Ricinus communis]
 gb|EEF40378.1| l-allo-threonine aldolase, putative [Ricinus communis]
Length=358

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVGSVIVG +SFI +AR++RKTLGGGMRQ+G+LCAAALV  
Sbjct  193  RLVQAADSVSVCLSKGLGAPVGSVIVGSESFIAKARVLRKTLGGGMRQVGILCAAALVAV  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN GKLE DHKK K LAEGLN+I GL VD+A+VETNI++ DI++ +  T  +LCK L +
Sbjct  253  QENAGKLENDHKKTKALAEGLNQIKGLSVDVATVETNIIYLDIIEGSKFTAEKLCKYLEK  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            HGVL++ EGP  IR V+HHQIS +DVQY LS  Q+A+TGV   +G+
Sbjct  313  HGVLVMKEGPFSIRIVLHHQISASDVQYTLSIFQQALTGVQEENGN  358



>ref|XP_010024956.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024958.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024959.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024960.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024961.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024962.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024963.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 gb|KCW61509.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
 gb|KCW61510.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
Length=358

 Score =   229 bits (584),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVC+SKGLGAPVGSVIVG +SFI +AR +RKTLGGGMRQ+G+LCAAALV  
Sbjct  193  RLVQAADSVSVCISKGLGAPVGSVIVGSESFITKARRLRKTLGGGMRQVGILCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENVGKLE DHKKAK LAEGLNKI GL +++ASVETNI++ DI + +N T  +LCK L E
Sbjct  253  RENVGKLESDHKKAKILAEGLNKIRGLALNVASVETNIIYFDINEGSNMTVQKLCKNLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSG  186
            HG+L++PE   R+R V+HHQIS+ DV YALS  QR + G  + +G
Sbjct  313  HGILVMPETSTRVRLVVHHQISENDVHYALSCFQRIMMGTPSENG  357



>gb|KCW61508.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
Length=362

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVC+SKGLGAPVGSVIVG +SFI +AR +RKTLGGGMRQ+G+LCAAALV  
Sbjct  197  RLVQAADSVSVCISKGLGAPVGSVIVGSESFITKARRLRKTLGGGMRQVGILCAAALVAL  256

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENVGKLE DHKKAK LAEGLNKI GL +++ASVETNI++ DI + +N T  +LCK L E
Sbjct  257  RENVGKLESDHKKAKILAEGLNKIRGLALNVASVETNIIYFDINEGSNMTVQKLCKNLEE  316

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSG  186
            HG+L++PE   R+R V+HHQIS+ DV YALS  QR + G  + +G
Sbjct  317  HGILVMPETSTRVRLVVHHQISENDVHYALSCFQRIMMGTPSENG  361



>ref|XP_011101617.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Sesamum 
indicum]
 ref|XP_011101618.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Sesamum 
indicum]
Length=359

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSV+ CLSKGLGAP G+VI G KSFI +A+I+RKTLGG MRQ+GV+CAAALV  
Sbjct  193  RLVRAADSVTACLSKGLGAPAGTVIAGSKSFISKAKILRKTLGGAMRQVGVICAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             ENVGKLE DHKKAK L+EGLNKI GL++++ASVETNIV+ DIL+E   TE+EL K+L  
Sbjct  253  GENVGKLESDHKKAKILSEGLNKIEGLKINLASVETNIVYFDILEEVGITEIELVKKLEA  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSG  186
            HG+L++ EG  +IR VIHHQIS+ DVQY LS +Q+AVTG+   +G
Sbjct  313  HGILVMAEGRLKIRLVIHHQISEYDVQYTLSCIQKAVTGMKAENG  357



>ref|XP_007030424.1| Threonine aldolase 1 isoform 5 [Theobroma cacao]
 gb|EOY10926.1| Threonine aldolase 1 isoform 5 [Theobroma cacao]
Length=357

 Score =   226 bits (577),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADS+SVCLSKGLGAPVGSVIVG KSFI +AR +RKTLGGGMRQ+G +CAAA V  
Sbjct  193  RLVQAADSISVCLSKGLGAPVGSVIVGSKSFITKARRLRKTLGGGMRQVGFICAAAFVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QENVGKLEGDHKKAK LAEGLN+I GL VD+A+V+TNI++ DI++ +  T  +L K L E
Sbjct  253  QENVGKLEGDHKKAKVLAEGLNQIKGLRVDVAAVQTNIIYFDIVEGSKLTAEKLYKNLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  219
            HGVL++PEGP R+R V+HHQIS +DVQY LS  Q
Sbjct  313  HGVLVMPEGPARMRIVLHHQISSSDVQYTLSCFQ  346



>gb|AFK43649.1| unknown [Lotus japonicus]
Length=358

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 135/166 (81%), Gaps = 0/166 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVGSVIVG  SFI +AR +RKTLGGGMRQ+G+LCAAALV  
Sbjct  193  RLVQAADSVSVCLSKGLGAPVGSVIVGSSSFIAKARRLRKTLGGGMRQVGILCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            Q+ VG+LE DHKKA+TLA+GLN+I GL VD +SVETNIV+ +I + + TT  +L K L  
Sbjct  253  QDIVGELESDHKKARTLADGLNQIKGLRVDTSSVETNIVYIEIKEGSGTTAAKLSKDLEN  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            +GVL++P G  +IR V HHQISD+DVQYALS  Q+AV GV N +G+
Sbjct  313  YGVLLMPLGSSKIRVVFHHQISDSDVQYALSCFQQAVNGVGNENGN  358



>gb|KJB82283.1| hypothetical protein B456_013G187300 [Gossypium raimondii]
 gb|KJB82284.1| hypothetical protein B456_013G187300 [Gossypium raimondii]
Length=358

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = -3

Query  683  SRLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVG  504
            +RLVQAADSVSVCLSKGLGAPVGSVIVG KSFI +AR +RKTLGGGMRQ+G +CAAA V 
Sbjct  192  NRLVQAADSVSVCLSKGLGAPVGSVIVGSKSFISKARRLRKTLGGGMRQLGFICAAAFVA  251

Query  503  FQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
             +ENV KLEGDHKKAK LAEGLN+I GL V++A+VETNI+F DI++ +  T  +L K+L 
Sbjct  252  LKENVAKLEGDHKKAKVLAEGLNQIKGLRVNVAAVETNIIFFDIVEGSKITAEKLYKKLE  311

Query  323  EHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            EHGVL++ EGP R+R V+HHQIS +DV Y LS  Q+A+ GV   +G+
Sbjct  312  EHGVLVMLEGPLRMRIVLHHQISSSDVLYTLSCFQQALIGVQVENGN  358



>gb|KCW61511.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
Length=365

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVC+SKGLGAPVGSVIVG +SFI +AR +RKTLGGGMRQ+G+LCAAALV  
Sbjct  193  RLVQAADSVSVCISKGLGAPVGSVIVGSESFITKARRLRKTLGGGMRQVGILCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENVGKLE DHKKAK LAEGLNKI GL +++ASVETNI++ DI + +N T  +LCK L E
Sbjct  253  RENVGKLESDHKKAKILAEGLNKIRGLALNVASVETNIIYFDINEGSNMTVQKLCKNLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  219
            HG+L++PE   R+R V+HHQIS+ DV YALS  Q
Sbjct  313  HGILVMPETSTRVRLVVHHQISENDVHYALSCFQ  346



>ref|XP_003521772.1| PREDICTED: uncharacterized protein R102.4-like isoform X1 [Glycine 
max]
 gb|KHN31499.1| L-allo-threonine aldolase [Glycine soja]
Length=358

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 135/166 (81%), Gaps = 0/166 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVGSVIVG  +FI +AR +RKTLGGGMRQ+G+LCAAALV  
Sbjct  193  RLVQAADSVSVCLSKGLGAPVGSVIVGSNNFITKARRLRKTLGGGMRQVGILCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QENVGKL+ DH KAK LA+GLN+I GL VD++SVETNI++ ++ + +  T  +LCK L +
Sbjct  253  QENVGKLQSDHNKAKLLADGLNEIKGLRVDISSVETNIIYVEVEEGSRATAAKLCKDLED  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            +G+L++P G  R+R V HHQIS +DVQYALS  Q+AV GV N +G+
Sbjct  313  YGILLMPMGSSRLRIVFHHQISASDVQYALSCFQQAVNGVRNENGN  358



>ref|XP_004494746.1| PREDICTED: L-allo-threonine aldolase-like isoform X1 [Cicer arietinum]
 ref|XP_004494747.1| PREDICTED: L-allo-threonine aldolase-like isoform X2 [Cicer arietinum]
Length=358

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            +LV+AADSVSVCLSKGLGAPVGSVIVG  SFI +AR +RKTLGGGMRQ+GVLCAAALV  
Sbjct  193  KLVRAADSVSVCLSKGLGAPVGSVIVGSNSFITKARRLRKTLGGGMRQVGVLCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QENVGKLE DHK A+  A+GLNKI GL+VD++SVETN+VF +I + + TT  ++CK L +
Sbjct  253  QENVGKLESDHKNARFFADGLNKIKGLKVDISSVETNMVFIEIEESSGTTAAKICKDLED  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            +G+L+LP G  R+R V HHQIS++DV+YALS  Q+AV+G  N +G+
Sbjct  313  YGILLLPIGSSRLRVVFHHQISNSDVKYALSCFQQAVSGGLNENGN  358



>gb|KDP23711.1| hypothetical protein JCGZ_23544 [Jatropha curcas]
Length=354

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVG+VIVG KSFI ++RI+RKTLGGGMRQ+G+LCAA LV  
Sbjct  189  RLVQAADSVSVCLSKGLGAPVGTVIVGSKSFIAKSRILRKTLGGGMRQVGMLCAAGLVAV  248

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QENVGKLE DHKKAKT+AEGL++   L VD A+VETNI++ D+++ +  T  +LCK L +
Sbjct  249  QENVGKLEDDHKKAKTIAEGLHQFKELRVDAAAVETNIIYVDVVESSKFTAEKLCKSLEQ  308

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            HGVL++ EGP   R V+HHQIS +DVQY LS  Q+ +TGV   +G+
Sbjct  309  HGVLVMLEGPFSFRIVLHHQISASDVQYTLSCFQQILTGVQAENGN  354



>ref|XP_002325334.2| L-allo-threonine aldolase-related family protein [Populus trichocarpa]
 gb|EEE99715.2| L-allo-threonine aldolase-related family protein [Populus trichocarpa]
Length=359

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RL+QAADS SVCLSKGLGAPVGSVIVG KSFI +ARI+RKTLGGGMRQ+GVLCAAALV  
Sbjct  193  RLLQAADSASVCLSKGLGAPVGSVIVGSKSFIAKARILRKTLGGGMRQVGVLCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             E V KLE DHKK K LAEGLN+I GL +++A+VETNI+F D+++ A  T  +LCK L +
Sbjct  253  HETVLKLEDDHKKTKMLAEGLNQIKGLRLNVAAVETNIIFFDVVEGAKITAEKLCKNLEQ  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  204
            HG+L++ E P RIR V+HHQIS++DVQYALS  ++A+TG
Sbjct  313  HGILVMQESPVRIRVVLHHQISESDVQYALSCFKQALTG  351



>gb|KJB44860.1| hypothetical protein B456_007G276400 [Gossypium raimondii]
Length=370

 Score =   223 bits (567),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVGSVIVG KSFI +AR +RKTLGGGMRQ+G +CAAA V  
Sbjct  193  RLVQAADSVSVCLSKGLGAPVGSVIVGSKSFITKARRLRKTLGGGMRQVGFICAAAFVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENV KL+GDHKKAK LAEGLN+I GL+VD+A+VETNI++ DI++ +  T  +L K L E
Sbjct  253  KENVEKLDGDHKKAKELAEGLNQIKGLKVDIAAVETNIIYVDIVEGSKITAEKLYKNLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGDH  180
            HGVL++P+G  R+R V+HHQIS +DV Y LS  Q+A +G+   +G +
Sbjct  313  HGVLVMPKGLSRMRIVLHHQISSSDVHYTLSCFQQAFSGMHQENGSY  359



>ref|XP_011036295.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
 ref|XP_011036297.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
 ref|XP_011036298.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
 ref|XP_011036299.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
 ref|XP_011036300.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
Length=359

 Score =   221 bits (564),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RL+QAADS SVCLSKGLGAPVGSVIVG KSFI +ARI+RKTLGGGMRQ+G+LCAA LV  
Sbjct  193  RLLQAADSASVCLSKGLGAPVGSVIVGSKSFIAKARILRKTLGGGMRQVGILCAADLVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             ENV KLE DHKKAK LAEGLN+I GL +++A+VETNI+F DI++ A  T  +LCK L  
Sbjct  253  HENVLKLEDDHKKAKMLAEGLNQIKGLRLNVAAVETNIIFFDIVEGAKITAEKLCKNLEH  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  204
            HG+L++ E P RIR V+HHQIS++DVQYALS  ++A++G
Sbjct  313  HGILVMQESPVRIRVVLHHQISESDVQYALSCFKQALSG  351



>ref|XP_002319106.2| L-allo-threonine aldolase-related family protein [Populus trichocarpa]
 gb|EEE95029.2| L-allo-threonine aldolase-related family protein [Populus trichocarpa]
Length=356

 Score =   221 bits (564),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 133/161 (83%), Gaps = 3/161 (2%)
 Frame = -3

Query  683  SRLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVG  504
            SRLVQ ADSVSVCLSKGLGAPVGSVIVG KSF+ +ARI+RKTLGGGMRQ+GVLCAAALVG
Sbjct  192  SRLVQDADSVSVCLSKGLGAPVGSVIVGSKSFVAKARILRKTLGGGMRQVGVLCAAALVG  251

Query  503  FQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
             QENV KLE DHKKAK LAEGLN+I GL V++A+VETNI++ D+++ A     +LCK L 
Sbjct  252  VQENVSKLEDDHKKAKMLAEGLNQIKGLRVNVAAVETNIIYIDVVEGAAE---KLCKNLE  308

Query  323  EHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGV  201
            +HG+LI+ E P  IR  +HHQIS +DVQY LS  ++A+TGV
Sbjct  309  QHGILIMQESPISIRVALHHQISASDVQYTLSCFKQALTGV  349



>gb|KJB44862.1| hypothetical protein B456_007G276400 [Gossypium raimondii]
Length=413

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVGSVIVG KSFI +AR +RKTLGGGMRQ+G +CAAA V  
Sbjct  236  RLVQAADSVSVCLSKGLGAPVGSVIVGSKSFITKARRLRKTLGGGMRQVGFICAAAFVAL  295

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENV KL+GDHKKAK LAEGLN+I GL+VD+A+VETNI++ DI++ +  T  +L K L E
Sbjct  296  KENVEKLDGDHKKAKELAEGLNQIKGLKVDIAAVETNIIYVDIVEGSKITAEKLYKNLEE  355

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGDH  180
            HGVL++P+G  R+R V+HHQIS +DV Y LS  Q+A +G+   +G +
Sbjct  356  HGVLVMPKGLSRMRIVLHHQISSSDVHYTLSCFQQAFSGMHQENGSY  402



>gb|KJB44861.1| hypothetical protein B456_007G276400 [Gossypium raimondii]
Length=417

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVGSVIVG KSFI +AR +RKTLGGGMRQ+G +CAAA V  
Sbjct  240  RLVQAADSVSVCLSKGLGAPVGSVIVGSKSFITKARRLRKTLGGGMRQVGFICAAAFVAL  299

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENV KL+GDHKKAK LAEGLN+I GL+VD+A+VETNI++ DI++ +  T  +L K L E
Sbjct  300  KENVEKLDGDHKKAKELAEGLNQIKGLKVDIAAVETNIIYVDIVEGSKITAEKLYKNLEE  359

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGDH  180
            HGVL++P+G  R+R V+HHQIS +DV Y LS  Q+A +G+   +G +
Sbjct  360  HGVLVMPKGLSRMRIVLHHQISSSDVHYTLSCFQQAFSGMHQENGSY  406



>ref|XP_010102233.1| L-allo-threonine aldolase [Morus notabilis]
 gb|EXB93176.1| L-allo-threonine aldolase [Morus notabilis]
Length=358

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 133/167 (80%), Gaps = 0/167 (0%)
 Frame = -3

Query  683  SRLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVG  504
            SRLVQAADSVSVCLSKGLGAPVG+VIVG +SFI +AR +RKTLGGGMRQ+GVLCAAA V 
Sbjct  192  SRLVQAADSVSVCLSKGLGAPVGTVIVGSESFIKKARRLRKTLGGGMRQVGVLCAAAFVA  251

Query  503  FQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
             QENVGKLE DHK AK LA+GL+KI GL VD+ASVETNI+F DI + +  T  +LCK L 
Sbjct  252  VQENVGKLEADHKNAKFLADGLHKIKGLFVDVASVETNIIFIDIEEGSKMTAEKLCKNLE  311

Query  323  EHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            EHG++++ E   RIR V+HHQIS  DV++ LS  Q A+ GV+  +G+
Sbjct  312  EHGIVVMKESSSRIRIVLHHQISYDDVKFTLSCFQNALNGVSVENGN  358



>gb|EYU19887.1| hypothetical protein MIMGU_mgv1a008896mg [Erythranthe guttata]
 gb|EYU19888.1| hypothetical protein MIMGU_mgv1a008896mg [Erythranthe guttata]
 gb|EYU19889.1| hypothetical protein MIMGU_mgv1a008896mg [Erythranthe guttata]
 gb|EYU19890.1| hypothetical protein MIMGU_mgv1a008896mg [Erythranthe guttata]
Length=359

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 130/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAAD+V+ CLSKGLGAP G++I GP+ FI +A+I+RKTLGGGMRQ+GV+CAAALV  
Sbjct  193  RLVQAADTVTACLSKGLGAPAGTIIAGPRDFIYKAKILRKTLGGGMRQVGVICAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENV KLE DHKKAKTLAEG+N I GL VD+ASVETNIV+ DI +    TE +L K L  
Sbjct  253  EENVAKLETDHKKAKTLAEGVNNIKGLNVDLASVETNIVYFDIQESLGITEGKLLKNLEA  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSG  186
            HG+  + EGP +IR VIHHQIS+TDVQY +S +Q+ V G+   +G
Sbjct  313  HGIFAMSEGPLKIRLVIHHQISETDVQYTVSCIQKIVGGLVGENG  357



>ref|XP_011038517.1| PREDICTED: LOW QUALITY PROTEIN: probable low-specificity L-threonine 
aldolase 1 [Populus euphratica]
Length=356

 Score =   219 bits (558),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 131/160 (82%), Gaps = 3/160 (2%)
 Frame = -3

Query  683  SRLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVG  504
            SRLVQ ADSVSVCLSKGLGAPVGSVIVG KSF+ +ARI+RKTLGGGMRQ+GVLCAAALV 
Sbjct  192  SRLVQDADSVSVCLSKGLGAPVGSVIVGSKSFVAKARILRKTLGGGMRQVGVLCAAALVA  251

Query  503  FQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
             QENV KLE DHKKAK LAEGLN+I GL V++A+VET I++ D+++ A     +LCK L 
Sbjct  252  VQENVSKLEDDHKKAKMLAEGLNQIKGLRVNVAAVETKIIYIDVVEGAAE---KLCKNLE  308

Query  323  EHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  204
            +HG+LI+ E P  IR V+HHQIS +DVQY LS  Q+A+TG
Sbjct  309  QHGILIMQESPISIRVVLHHQISTSDVQYTLSCFQQALTG  348



>ref|XP_007147215.1| hypothetical protein PHAVU_006G105400g [Phaseolus vulgaris]
 ref|XP_007147216.1| hypothetical protein PHAVU_006G105400g [Phaseolus vulgaris]
 gb|ESW19209.1| hypothetical protein PHAVU_006G105400g [Phaseolus vulgaris]
 gb|ESW19210.1| hypothetical protein PHAVU_006G105400g [Phaseolus vulgaris]
Length=362

 Score =   219 bits (557),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVGSVIVG  SFI +AR +RKTLGGGMRQ+G+LCAAALV  
Sbjct  193  RLVQAADSVSVCLSKGLGAPVGSVIVGSNSFISKARRLRKTLGGGMRQVGILCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QENV KLE DHKKAK LA+GLN+I GL VD +SVETN++F ++ +   TT  +LCK L +
Sbjct  253  QENVEKLESDHKKAKLLADGLNEIKGLSVDTSSVETNMMFVEVEEGLGTTASKLCKDLED  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVAN  195
            +G+L++  G  R+R V HHQIS +DVQYALS  Q+AV GV N
Sbjct  313  YGILLMAIGSSRLRIVFHHQISASDVQYALSCFQQAVNGVRN  354



>ref|XP_006577318.1| PREDICTED: uncharacterized protein R102.4-like isoform X3 [Glycine 
max]
Length=357

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 134/166 (81%), Gaps = 1/166 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVGSVIVG  +FI +AR +RKTLGGGMRQ+G+LCAAALV  
Sbjct  193  RLVQAADSVSVCLSKGLGAPVGSVIVGSNNFITKARRLRKTLGGGMRQVGILCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QENVGKL+ DH KAK LA+GLN+I GL VD++SVETNI++ ++ + +  T  +LCK L +
Sbjct  253  QENVGKLQSDHNKAKLLADGLNEIKGLRVDISSVETNIIYVEVEEGSRATAAKLCKDLED  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            +G+L++P G  R+R V HHQIS +DVQYALS  Q AV GV N +G+
Sbjct  313  YGILLMPMGSSRLRIVFHHQISASDVQYALSCFQ-AVNGVRNENGN  357



>gb|KJB46043.1| hypothetical protein B456_007G345500 [Gossypium raimondii]
 gb|KJB46044.1| hypothetical protein B456_007G345500 [Gossypium raimondii]
Length=358

 Score =   217 bits (552),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKG+GAPVGSVIVG ++FI +AR +RKTLGGGMRQ+GV+CAAALV  
Sbjct  193  RLVQAADSVSVCLSKGIGAPVGSVIVGSETFITKARRLRKTLGGGMRQVGVICAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KLEGDHK AK LAEGLN+I GL V++A+VETNI+F DI++ +  +  +L K L E
Sbjct  253  QENLIKLEGDHKNAKVLAEGLNQIKGLRVNVAAVETNIIFFDIVEGSKISGEKLYKHLVE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
             GV +L EGP R+R V+HHQIS +DVQY LS  Q+A +G+   +G+
Sbjct  313  RGVFVLLEGPSRMRIVLHHQISSSDVQYTLSCFQQAFSGLQEENGN  358



>ref|XP_009364444.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Pyrus 
x bretschneideri]
 ref|XP_009364445.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Pyrus 
x bretschneideri]
 ref|XP_009364446.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Pyrus 
x bretschneideri]
Length=359

 Score =   217 bits (552),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKG+GAPVGSVIVG KSFI +AR ++KTLGGGMRQ+G+LCAAALVG 
Sbjct  193  RLVQAADSVSVCLSKGIGAPVGSVIVGSKSFITKARRLKKTLGGGMRQVGILCAAALVGL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
              NV KLE DHK+AK LAEGLN+I GL VD+ASVETNI++  + + +N T  +L K L E
Sbjct  253  HNNVAKLETDHKRAKILAEGLNQIKGLSVDVASVETNILYIHVEEGSNVTTEKLVKNLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  204
            HG+L++ E    IR VIHHQIS +DVQY LS  Q+A+TG
Sbjct  313  HGILMMQESSSSIRIVIHHQISASDVQYTLSCFQKALTG  351



>ref|XP_008218319.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
 ref|XP_008218320.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
 ref|XP_008218321.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
 ref|XP_008218322.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
 ref|XP_008218323.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
Length=359

 Score =   216 bits (551),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKG+GAPVGSVIVG KSFI +AR +RKTLGGGMRQ+G+LCAAALV  
Sbjct  193  RLVQAADSVSVCLSKGIGAPVGSVIVGSKSFITKARRLRKTLGGGMRQVGILCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             ENV KLE DHK+AK LAEGLN+I GL VD+ +VETNIV+  +++ +N +  +L K L E
Sbjct  253  HENVAKLETDHKRAKILAEGLNQIKGLRVDIDTVETNIVYIHVVEGSNISAEKLLKNLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  204
            HG+L++ E    IR V+HHQIS +DVQY LS  QRAVTG
Sbjct  313  HGILMMRESSSSIRIVLHHQISASDVQYTLSCFQRAVTG  351



>gb|KHN04944.1| L-allo-threonine aldolase [Glycine soja]
Length=360

 Score =   216 bits (551),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 132/168 (79%), Gaps = 2/168 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKG+GAPVGSVIVG K+FI +AR +RKTLGGGMRQIG+LCAAALV  
Sbjct  193  RLVQAADSVSVCLSKGIGAPVGSVIVGSKNFIAKARRLRKTLGGGMRQIGILCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QENVGKLE DHKKA+ LA+GLN++ GL VD  SVETN+VF DI +   T   ++CK + E
Sbjct  253  QENVGKLESDHKKARLLADGLNEVKGLRVDACSVETNMVFIDIEEGTKTRAEKICKYMEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVT--GVANGSGD  183
             G+L++ E   R+R V+HHQIS +DVQYALS  Q+AV   GV N  G+
Sbjct  313  RGILVMQESSSRMRVVLHHQISASDVQYALSCFQQAVAVKGVQNEMGN  360



>gb|KHG25609.1| L-allo-threonine aldolase [Gossypium arboreum]
Length=358

 Score =   216 bits (550),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKG+GAPVGSVIVG ++FI +AR +RKTLGGGMRQ+GV+CAAALV  
Sbjct  193  RLVQAADSVSVCLSKGIGAPVGSVIVGSETFITKARRLRKTLGGGMRQVGVICAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KLEGDHK AK LAEGLN+I GL V++A+VETNI+F DI++ +  +  +L K L E
Sbjct  253  QENLVKLEGDHKNAKVLAEGLNQIKGLRVNVAAVETNIIFFDIVEGSKISGEKLYKHLVE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
             GV ++ EGP R+R V+HHQIS +DVQY LS  Q+A +G+   +G+
Sbjct  313  RGVFVMLEGPSRMRIVLHHQISSSDVQYTLSCFQQAFSGLQEENGN  358



>gb|AFK40044.1| unknown [Medicago truncatula]
Length=358

 Score =   216 bits (550),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKG+GAPVGSVIVG  SFI +AR +RKTLGGGMRQ+G+LCAAALV  
Sbjct  193  RLVRAADSVSVCLSKGIGAPVGSVIVGSNSFITKARRLRKTLGGGMRQVGILCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             ENV KLE DHK A+ LA+GLN+I GL VD +SVETNI++ +I + + TT  +L K L E
Sbjct  253  HENVEKLESDHKNARFLADGLNEIKGLRVDTSSVETNIIYIEIEENSGTTAAKLSKDLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            +G+LI+P G  R+R V HHQISD+DV+Y LS  +RAV G  N +G+
Sbjct  313  YGILIMPMGTSRLRVVFHHQISDSDVRYTLSCFERAVAGEPNENGN  358



>gb|KEH24599.1| L-allo-threonine aldolase-like protein [Medicago truncatula]
Length=358

 Score =   216 bits (550),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKG+GAPVGSVIVG  SFI +AR +RKTLGGGMRQ+G+LCAAALV  
Sbjct  193  RLVRAADSVSVCLSKGIGAPVGSVIVGSNSFITKARRLRKTLGGGMRQVGILCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             ENV KLE DHK A+ LA+GLN+I GL VD +SVETNI++ +I + + TT  +L K L E
Sbjct  253  HENVEKLESDHKNARFLADGLNEIKGLRVDTSSVETNIIYIEIEENSGTTAAKLSKDLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            +G+LI+P G  R+R V HHQISD+DV+Y LS  +RAV G  N +G+
Sbjct  313  YGILIMPMGTSRLRVVFHHQISDSDVRYTLSCFERAVAGEPNENGN  358



>ref|XP_008388714.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Malus domestica]
 ref|XP_008388715.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Malus domestica]
 ref|XP_008388716.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Malus domestica]
Length=359

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKG+GAPVGSVIVG KSFI +AR ++KTLGGGMRQ+G+LCAAALVG 
Sbjct  193  RLVQAADSVSVCLSKGIGAPVGSVIVGSKSFIAKARRLKKTLGGGMRQVGILCAAALVGL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             +NV KLE DHK+AK LAEGLN+I GL VD+ASVETNI++  + + +N T  +L K L E
Sbjct  253  HDNVAKLETDHKRAKILAEGLNQIKGLSVDVASVETNILYIHVEEGSNVTTEKLVKNLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  204
            HGVL++ E    IR VIHHQIS +DVQY LS  Q+A+ G
Sbjct  313  HGVLMMQESSSSIRIVIHHQISASDVQYTLSCFQKALXG  351



>ref|XP_004170828.1| PREDICTED: L-allo-threonine aldolase-like [Cucumis sativus]
Length=359

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVGSVIVG ++FI++AR +RKTLGGGMRQ+G+LCAAALV  
Sbjct  193  RLVQAADSVSVCLSKGLGAPVGSVIVGSRAFINKARRLRKTLGGGMRQVGILCAAALVAI  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KLEGDH+ AK LA+GLNKI GL+V+   +ETNI+F DI + +  T  +L K L E
Sbjct  253  QENIVKLEGDHENAKILADGLNKIKGLQVESHLIETNIIFVDIKEGSTITGDKLSKILEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG-VANGSG  186
            HG+L+LPE   RIR V+HHQIS TD QY LS  Q+A+ G + N +G
Sbjct  313  HGILVLPESSSRIRIVLHHQISATDTQYTLSCFQQAMAGAITNENG  358



>gb|KDO44520.1| hypothetical protein CISIN_1g0182431mg, partial [Citrus sinensis]
 gb|KDO44521.1| hypothetical protein CISIN_1g0182431mg, partial [Citrus sinensis]
Length=174

 Score =   209 bits (532),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 127/167 (76%), Gaps = 1/167 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADS SVCLSKGLGAPVGSVIVG K FI +AR +RKTLGGGMRQ+GVLCAAALV  
Sbjct  8    RLVQAADSASVCLSKGLGAPVGSVIVGSKEFIKKARRLRKTLGGGMRQVGVLCAAALVAL  67

Query  500  QENV-GKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
            QENV   L+GDHKKAK LAEGLN++ GL VD+ +VETNIV+ +I +++      L K+L 
Sbjct  68   QENVLVMLDGDHKKAKLLAEGLNQLKGLRVDVDAVETNIVYFEITEDSKLYAACLLKKLE  127

Query  323  EHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            EHGVL++PE   R+R V+HHQIS  DV Y LS  Q+   GV   +G+
Sbjct  128  EHGVLVMPESSTRVRIVVHHQISANDVHYTLSCFQKIYAGVCEENGN  174



>ref|XP_008388713.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Malus domestica]
Length=371

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKG+GAPVGSVIVG KSFI +AR ++KTLGGGMRQ+G+LCAAALVG 
Sbjct  205  RLVQAADSVSVCLSKGIGAPVGSVIVGSKSFIAKARRLKKTLGGGMRQVGILCAAALVGL  264

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             +NV KLE DHK+AK LAEGLN+I GL VD+ASVETNI++  + + +N T  +L K L E
Sbjct  265  HDNVAKLETDHKRAKILAEGLNQIKGLSVDVASVETNILYIHVEEGSNVTTEKLVKNLEE  324

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  204
            HGVL++ E    IR VIHHQIS +DVQY LS  Q+A+ G
Sbjct  325  HGVLMMQESSSSIRIVIHHQISASDVQYTLSCFQKALXG  363



>ref|XP_010262335.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010262336.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Nelumbo nucifera]
Length=358

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 128/158 (81%), Gaps = 0/158 (0%)
 Frame = -3

Query  683  SRLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVG  504
            S+LVQAADSVSVCLSKGLGAP+GSVIVG KSFI +A+ +RKTLGGGMRQ+G+LCAAA V 
Sbjct  192  SKLVQAADSVSVCLSKGLGAPIGSVIVGSKSFIAKAKRLRKTLGGGMRQVGILCAAAYVA  251

Query  503  FQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
              ENVGKLE DHKK K LA+G+N+I  L +DM+S+ETNI+F DIL+ +N T  +L + L 
Sbjct  252  LHENVGKLEDDHKKTKILADGINQIKELSIDMSSIETNIIFFDILEGSNVTVEKLVQFLE  311

Query  323  EHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            +HG+L++P     IR V+HHQIS+ DVQY LS +Q+AV
Sbjct  312  KHGILVMPASSSSIRLVLHHQISECDVQYTLSCIQQAV  349



>ref|XP_008456444.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Cucumis 
melo]
Length=358

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 133/166 (80%), Gaps = 2/166 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVGSVIVG ++FI++AR +RKTLGGGMRQ+G+LCAAALV  
Sbjct  193  RLVQAADSVSVCLSKGLGAPVGSVIVGSRAFINKARRLRKTLGGGMRQVGILCAAALVAI  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KLEGDH+ AK LA+GLNKI GL+V+   +ETNI+F DI K++  T  +L K L E
Sbjct  253  QENIVKLEGDHENAKFLADGLNKIKGLQVESHLIETNIIFVDI-KDSTITGEKLSKILEE  311

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG-VANGSG  186
            HG+L+LPE   RIR V+HHQIS TD QY LS  Q+A+ G + N +G
Sbjct  312  HGILVLPESSSRIRIVLHHQISATDTQYTLSCFQQAMAGAITNENG  357



>ref|XP_004139254.1| PREDICTED: L-allo-threonine aldolase-like [Cucumis sativus]
 gb|KGN60769.1| hypothetical protein Csa_2G009560 [Cucumis sativus]
Length=359

 Score =   214 bits (544),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVGSVIVG ++FI++AR +RKTLGGGMRQ+G+LCAAALV  
Sbjct  193  RLVQAADSVSVCLSKGLGAPVGSVIVGSRAFINKARRLRKTLGGGMRQVGILCAAALVAI  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KLEGDH+ AK LA+GLNKI GL+V+   +ETNI+F DI + +  T  +L K L E
Sbjct  253  QENIVKLEGDHENAKILADGLNKIKGLQVESHLIETNIIFVDIKEGSIITGDKLSKILEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG-VANGSG  186
            HG+L+LPE   RIR V+HHQIS TD QY LS  Q+A+ G + N +G
Sbjct  313  HGILVLPESSSRIRIVLHHQISATDTQYTLSCFQQAMAGAITNENG  358



>ref|XP_006577317.1| PREDICTED: uncharacterized protein R102.4-like isoform X2 [Glycine 
max]
Length=368

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVGSVIVG  +FI +AR +RKTLGGGMRQ+G+LCAAALV  
Sbjct  193  RLVQAADSVSVCLSKGLGAPVGSVIVGSNNFITKARRLRKTLGGGMRQVGILCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QENVGKL+ DH KAK LA+GLN+I GL VD++SVETNI++ ++ + +  T  +LCK L +
Sbjct  253  QENVGKLQSDHNKAKLLADGLNEIKGLRVDISSVETNIIYVEVEEGSRATAAKLCKDLED  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQR  216
            +G+L++P G  R+R V HHQIS +DVQYALS  Q+
Sbjct  313  YGILLMPMGSSRLRIVFHHQISASDVQYALSCFQK  347



>ref|XP_010694951.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010694952.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Beta 
vulgaris subsp. vulgaris]
Length=371

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVG+VIVG KSFI +A+ +RKTLGGGMRQIG+LCAAALV  
Sbjct  205  RLVQAADSVSVCLSKGLGAPVGTVIVGSKSFITKAKNLRKTLGGGMRQIGILCAAALVAL  264

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            Q+NV KLE DHK AK LA+GLN+I+GL+VD +SVETNI++  + + +NTT  +L K L E
Sbjct  265  QDNVRKLEDDHKNAKLLADGLNQITGLKVDNSSVETNIIYVRVCENSNTTAPKLSKSLEE  324

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVAN  195
            +G+L++ E   R R VIHHQI+ +DVQ ALS +Q+AVTG ++
Sbjct  325  NGILVMLENTFRFRVVIHHQITTSDVQRALSCIQQAVTGASS  366



>ref|XP_010246795.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nelumbo 
nucifera]
Length=358

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 128/158 (81%), Gaps = 0/158 (0%)
 Frame = -3

Query  683  SRLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVG  504
            SRLVQAADSVSVCLSKGLGAP+GSVIVG KSFI +A+ +RKTLGGGMRQIG+LCAAA V 
Sbjct  192  SRLVQAADSVSVCLSKGLGAPIGSVIVGSKSFIAKAKRLRKTLGGGMRQIGILCAAAYVA  251

Query  503  FQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
              ENVGKLEGDHKKAK LAEGLN+I  L VD++SVETNI+F  +L+ +     +L + L 
Sbjct  252  LHENVGKLEGDHKKAKVLAEGLNQIKELRVDVSSVETNIIFFHVLEGSEVIVEKLTQFLE  311

Query  323  EHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            +HG+L++P     IR V+HHQIS++DVQY LS +Q+AV
Sbjct  312  KHGILVMPVSSSGIRLVLHHQISESDVQYTLSCIQQAV  349



>ref|XP_011465993.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011465994.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011465995.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Fragaria 
vesca subsp. vesca]
Length=359

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKG+GAPVGSVIVG +SFI +AR +RKTLGGGMRQ+G+LCAAALV  
Sbjct  193  RLVQAADSVSVCLSKGIGAPVGSVIVGSESFISKARRLRKTLGGGMRQVGILCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QENV KLEGDHKKAKTLAEGLN+I G+ VD   VETNI++  + + +  +  +L K+L +
Sbjct  253  QENVAKLEGDHKKAKTLAEGLNRIKGIRVDTEMVETNILYVHVDEGSTISAEKLYKKLED  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGDH  180
            +G+L + E    IR V+HHQIS++DVQY LS  Q+A+TG    +G +
Sbjct  313  YGILAMKESSSSIRIVLHHQISESDVQYTLSCFQKALTGAPEENGHY  359



>ref|XP_003556456.2| PREDICTED: uncharacterized protein R102.4-like isoform X1 [Glycine 
max]
Length=421

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKG+GAPVGSVIVG K+FI +AR +RKTLGGGMRQIG+LCAAALV  
Sbjct  254  RLVQAADSVSVCLSKGIGAPVGSVIVGSKNFIAKARRLRKTLGGGMRQIGILCAAALVAL  313

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QENVGKLE DHKKA+ LA+GLN++ GL VD  SVETN+VF DI +   T   ++CK + E
Sbjct  314  QENVGKLESDHKKARLLADGLNEVKGLRVDACSVETNMVFIDIEEGTKTRAEKICKYMEE  373

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
             G+L++ E   R+R V+HHQIS +DVQYALS  Q+AV
Sbjct  374  RGILVMQESSSRMRVVLHHQISASDVQYALSCFQQAV  410



>gb|KJB46045.1| hypothetical protein B456_007G345500 [Gossypium raimondii]
Length=388

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 142/205 (69%), Gaps = 20/205 (10%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKG+GAPVGSVIVG ++FI +AR +RKTLGGGMRQ+GV+CAAALV  
Sbjct  193  RLVQAADSVSVCLSKGIGAPVGSVIVGSETFITKARRLRKTLGGGMRQVGVICAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KLEGDHK AK LAEGLN+I GL V++A+VETNI+F DI++ +  +  +L K L E
Sbjct  253  QENLIKLEGDHKNAKVLAEGLNQIKGLRVNVAAVETNIIFFDIVEGSKISGEKLYKHLVE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGDHXN*GNCYLCFKIF  141
             GV +L EGP R+R V+HHQIS +DVQY LS  Q  +                +L F++F
Sbjct  313  RGVFVLLEGPSRMRIVLHHQISSSDVQYTLSCFQVII--------------RAFLLFRLF  358

Query  140  YLVK------KCNIPVDLQFIFIFK  84
              +K           V +Q+  +F+
Sbjct  359  IFIKTLISDSSSYTSVGIQWCMLFR  383



>ref|XP_007205422.1| hypothetical protein PRUPE_ppa007684mg [Prunus persica]
 ref|XP_007205423.1| hypothetical protein PRUPE_ppa007684mg [Prunus persica]
 gb|EMJ06621.1| hypothetical protein PRUPE_ppa007684mg [Prunus persica]
 gb|EMJ06622.1| hypothetical protein PRUPE_ppa007684mg [Prunus persica]
Length=359

 Score =   212 bits (539),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKG+GAPVGSVIVG KSFI +AR +RKTLGGGMRQ+G+LCAAALV  
Sbjct  193  RLVQAADSVSVCLSKGIGAPVGSVIVGSKSFITKARRLRKTLGGGMRQVGILCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             ENV KLE DHK+AK LAEGLN+I GL VD+ +VETNI++  +++ +N +  +L   L E
Sbjct  253  HENVAKLETDHKRAKILAEGLNQIKGLRVDIDTVETNIIYIHVVEGSNISAEKLLMNLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  204
            HG+L++ E    +R V+HHQIS +DVQY LS  QRA+TG
Sbjct  313  HGILMMRESSSSVRIVLHHQISASDVQYTLSCFQRALTG  351



>ref|XP_006606453.1| PREDICTED: uncharacterized protein R102.4-like isoform X4 [Glycine 
max]
Length=380

 Score =   212 bits (539),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 126/158 (80%), Gaps = 0/158 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKG+GAPVGSVIVG K+FI +AR +RKTLGGGMRQIG+LCAAALV  
Sbjct  193  RLVQAADSVSVCLSKGIGAPVGSVIVGSKNFIAKARRLRKTLGGGMRQIGILCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QENVGKLE DHKKA+ LA+GLN++ GL VD  SVETN+VF DI +   T   ++CK + E
Sbjct  253  QENVGKLESDHKKARLLADGLNEVKGLRVDACSVETNMVFIDIEEGTKTRAEKICKYMEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVT  207
             G+L++ E   R+R V+HHQIS +DVQYALS  Q  +T
Sbjct  313  RGILVMQESSSRMRVVLHHQISASDVQYALSCFQVMLT  350



>gb|ADI24921.1| L-allo-threonine aldolase [Carica papaya]
Length=360

 Score =   211 bits (538),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 131/162 (81%), Gaps = 2/162 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVGSVIVG ++FI +AR +RKTLGGGMRQ+G+LCAAA+V  
Sbjct  193  RLVQAADSVSVCLSKGLGAPVGSVIVGSETFITKARRLRKTLGGGMRQVGILCAAAVVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++N+ KLEGDHKKAK LA+GLN+I+GL VD A VETNI++  +++ +  T   LCK L +
Sbjct  253  RKNLSKLEGDHKKAKILADGLNQINGLRVDAAKVETNIIYFKVMEYSRMTAERLCKYLKD  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVAN  195
            HG+L++ EG  RIR V+HHQIS +DVQY LS  Q  VT +A+
Sbjct  313  HGILVIYEGEFRIRIVLHHQISASDVQYTLSCFQ--VTNLAH  352



>ref|XP_006606452.1| PREDICTED: uncharacterized protein R102.4-like isoform X3 [Glycine 
max]
Length=390

 Score =   212 bits (539),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 126/158 (80%), Gaps = 0/158 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKG+GAPVGSVIVG K+FI +AR +RKTLGGGMRQIG+LCAAALV  
Sbjct  203  RLVQAADSVSVCLSKGIGAPVGSVIVGSKNFIAKARRLRKTLGGGMRQIGILCAAALVAL  262

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QENVGKLE DHKKA+ LA+GLN++ GL VD  SVETN+VF DI +   T   ++CK + E
Sbjct  263  QENVGKLESDHKKARLLADGLNEVKGLRVDACSVETNMVFIDIEEGTKTRAEKICKYMEE  322

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVT  207
             G+L++ E   R+R V+HHQIS +DVQYALS  Q  +T
Sbjct  323  RGILVMQESSSRMRVVLHHQISASDVQYALSCFQVMLT  360



>ref|XP_006417664.1| hypothetical protein EUTSA_v10008026mg [Eutrema salsugineum]
 gb|ESQ36017.1| hypothetical protein EUTSA_v10008026mg [Eutrema salsugineum]
Length=358

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 130/164 (79%), Gaps = 0/164 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAP+GSVIVG +SFI++A+ +RKTLGGGMRQIGVLCAAALV  
Sbjct  193  RLVKAADSVSVCLSKGLGAPIGSVIVGSQSFIEKAKTLRKTLGGGMRQIGVLCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KL+ DHKKAK LAEGLN++ G+ VD+A+VETN++F D+   +  T  +L K L E
Sbjct  253  QENLPKLQFDHKKAKLLAEGLNQLKGIRVDVAAVETNMIFMDMEDGSRLTAEKLSKSLTE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
            +G+L++P    RIR VIHHQI+ +DV Y LS VQ+AV  +   S
Sbjct  313  YGILVIPANSSRIRMVIHHQITTSDVHYTLSCVQQAVQTIREPS  356



>emb|CDX93548.1| BnaA06g05000D [Brassica napus]
Length=358

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAP+GSVIVG +SFI++A+ +RKTLGGGMRQIGVLCAAALV  
Sbjct  193  RLVKAADSVSVCLSKGLGAPIGSVIVGSQSFIEKAKTLRKTLGGGMRQIGVLCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KL+ DHKKAK LAEGLNK+ G+ V++A++ETN++F D+   +  T  +L K L E
Sbjct  253  QENLPKLQFDHKKAKLLAEGLNKMKGIRVNVAAMETNMIFMDMEDGSRLTAEKLRKSLTE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            HG+L++PE   RIR VIHHQI+ +DV Y LS +Q+AV
Sbjct  313  HGILVIPESSSRIRMVIHHQITTSDVHYTLSCLQQAV  349



>ref|XP_009148115.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009148116.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009148118.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
Length=358

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAP+GSVIVG +SFI++A+ +RKTLGGGMRQIGVLCAAALV  
Sbjct  193  RLVKAADSVSVCLSKGLGAPIGSVIVGSQSFIEKAKTLRKTLGGGMRQIGVLCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KL+ DHKK K LAEGLNK+ G+ V++A++ETN++F D+   +  T  +L K L E
Sbjct  253  QENLPKLQSDHKKTKLLAEGLNKMKGIRVNVAAMETNMIFMDMEDGSRLTAEKLRKSLTE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            HG+L++PE   RIR VIHHQI+ +DV Y LS +Q+AV
Sbjct  313  HGILVIPESSSRIRMVIHHQITTSDVHYTLSCLQQAV  349



>ref|XP_006606451.1| PREDICTED: uncharacterized protein R102.4-like isoform X2 [Glycine 
max]
Length=441

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 126/158 (80%), Gaps = 0/158 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKG+GAPVGSVIVG K+FI +AR +RKTLGGGMRQIG+LCAAALV  
Sbjct  254  RLVQAADSVSVCLSKGIGAPVGSVIVGSKNFIAKARRLRKTLGGGMRQIGILCAAALVAL  313

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QENVGKLE DHKKA+ LA+GLN++ GL VD  SVETN+VF DI +   T   ++CK + E
Sbjct  314  QENVGKLESDHKKARLLADGLNEVKGLRVDACSVETNMVFIDIEEGTKTRAEKICKYMEE  373

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVT  207
             G+L++ E   R+R V+HHQIS +DVQYALS  Q  +T
Sbjct  374  RGILVMQESSSRMRVVLHHQISASDVQYALSCFQVMLT  411



>emb|CDX95045.1| BnaC05g06260D [Brassica napus]
Length=358

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAP+GSVIVG +SFI++A+ +RKTLGGGMRQIGVLCAAALV  
Sbjct  193  RLVKAADSVSVCLSKGLGAPIGSVIVGSQSFIEKAKTLRKTLGGGMRQIGVLCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KL+ DHKK K LAEGLNK+ G+ V++A++ETN++F D+   +  T  +L K L E
Sbjct  253  QENLPKLQSDHKKTKLLAEGLNKMKGIRVNVAAMETNMIFMDMEDGSKLTAEKLRKSLTE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            HG+L++PE   RIR V+HHQI+ +DV Y LS +Q+AV
Sbjct  313  HGILVIPENSTRIRMVLHHQITTSDVHYTLSCLQQAV  349



>ref|XP_009118358.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009118360.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009118361.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009118362.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009118363.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
Length=358

 Score =   209 bits (532),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAP+GSV+VG +SFI++A+ +RKTLGGGMRQIGVLCAAALV  
Sbjct  193  RLVQAADSVSVCLSKGLGAPIGSVVVGSQSFIEKAKTLRKTLGGGMRQIGVLCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KL+ DHKK K LAEGLN++ G+ V++A+VETN++F D+   +  T  +L K LAE
Sbjct  253  QENLPKLQFDHKKTKLLAEGLNQMKGIRVNVAAVETNMIFMDMEDGSKLTAEKLRKSLAE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            HG+L++PE   RIR VIHHQI+ +DV Y LS  ++AV
Sbjct  313  HGILVIPENSSRIRMVIHHQITTSDVHYTLSCFKQAV  349



>emb|CDY06323.1| BnaA09g48800D [Brassica napus]
Length=358

 Score =   209 bits (531),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAP+GSV+VG +SFI++A+ +RKTLGGGMRQIGVLCAAALV  
Sbjct  193  RLVQAADSVSVCLSKGLGAPIGSVVVGSQSFIEKAKTLRKTLGGGMRQIGVLCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KL+ DHKK K LAEGLN++ G+ V++A+VETN++F D+   +  T  +L K LAE
Sbjct  253  QENLPKLQFDHKKTKLLAEGLNQMKGIRVNVAAVETNMIFMDMEDGSKLTAEKLRKSLAE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            HG+L++PE   RIR VIHHQI+ +DV Y LS  ++AV
Sbjct  313  HGILVIPENSSRIRMVIHHQITTSDVHYTLSCFKQAV  349



>ref|XP_006487715.1| PREDICTED: uncharacterized protein R102.4-like isoform X1 [Citrus 
sinensis]
 ref|XP_006487716.1| PREDICTED: uncharacterized protein R102.4-like isoform X2 [Citrus 
sinensis]
 ref|XP_006487717.1| PREDICTED: uncharacterized protein R102.4-like isoform X3 [Citrus 
sinensis]
 ref|XP_006487718.1| PREDICTED: uncharacterized protein R102.4-like isoform X4 [Citrus 
sinensis]
Length=359

 Score =   208 bits (530),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 128/167 (77%), Gaps = 1/167 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADS SVCLSKGLGAPVGSVIVG K FI +AR +RKTLGGGMRQ+GVLCAAALV  
Sbjct  193  RLVQAADSASVCLSKGLGAPVGSVIVGSKEFIKKARRLRKTLGGGMRQVGVLCAAALVAL  252

Query  500  QENV-GKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
            QENV   L+GDHKKAK LAEGLN++ GL VD+ +VETNIV+ +I +++      L K+L 
Sbjct  253  QENVLVMLDGDHKKAKLLAEGLNQLKGLRVDVDAVETNIVYFEITEDSKLDAACLLKKLE  312

Query  323  EHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            EHGVL++PE   R+R V+HHQIS +DV Y LS  Q+   GV   +G+
Sbjct  313  EHGVLVMPESSTRVRIVVHHQISASDVHYTLSCFQKIYAGVCEENGN  359



>ref|XP_006442676.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442677.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442678.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442679.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442680.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442681.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442682.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442683.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55916.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55917.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55918.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55919.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55920.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55921.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55922.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55923.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
Length=359

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 127/167 (76%), Gaps = 1/167 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADS SVCLSKGLGAPVGSVIVG K FI +AR +RKTLGGGMRQ+GVLCAAALV  
Sbjct  193  RLVQAADSASVCLSKGLGAPVGSVIVGSKEFIKKARRLRKTLGGGMRQVGVLCAAALVAL  252

Query  500  QENV-GKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
            QENV   L+GDHKKAK LAEGLN++ GL VD+ +VETNIV+ +I +++      L K+L 
Sbjct  253  QENVLVMLDGDHKKAKLLAEGLNQLKGLRVDVDAVETNIVYFEITEDSKLYAACLLKKLE  312

Query  323  EHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            EHGVL++PE   R+R V+HHQIS  DV Y LS  Q+   GV   +G+
Sbjct  313  EHGVLVMPESSTRVRIVVHHQISANDVHYTLSCFQKIYAGVCEENGN  359



>emb|CDY22672.1| BnaC08g43060D [Brassica napus]
Length=358

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAP+GS++VG +SFI++A+ +RKTLGGGMRQIGVLCAAALV  
Sbjct  193  RLVQAADSVSVCLSKGLGAPIGSIVVGSQSFIEKAKTLRKTLGGGMRQIGVLCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KL+ DHKK K LAEGLN++ G+ V++A+VETN++F D+   +  T  +L K L E
Sbjct  253  QENLPKLQFDHKKTKLLAEGLNQMKGIRVNVAAVETNMIFMDMEDGSKLTAEKLRKSLTE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            HG+L++PE   RIR VIHH I+ +DV Y LS  Q+AV
Sbjct  313  HGILVIPENSSRIRMVIHHHITTSDVHYTLSCFQQAV  349



>gb|ACF86035.1| unknown [Zea mays]
 tpg|DAA36966.1| TPA: putative threonine aldolase family protein [Zea mays]
Length=231

 Score =   202 bits (514),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 128/164 (78%), Gaps = 1/164 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVGSVIVG K+FID+ARI+RKTLGGGMRQ+GVLCAAA V  
Sbjct  52   RLVKAADSVSVCLSKGLGAPVGSVIVGSKAFIDKARILRKTLGGGMRQVGVLCAAAHVAV  111

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ VGKL  DH+KAK LAEGL KI  + VD ASVETN+VF +++ +   +  +LC+ L +
Sbjct  112  RDTVGKLADDHRKAKALAEGLKKIEQITVDSASVETNMVFFEVM-DPRISPDKLCQVLEQ  170

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
              VL LP   K IRFVIH+QISD DV YAL+ V++A+  +  GS
Sbjct  171  DNVLALPANSKSIRFVIHYQISDADVGYALACVEKAIKELLEGS  214



>ref|XP_009123981.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Brassica 
rapa]
 ref|XP_009123982.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Brassica 
rapa]
Length=360

 Score =   206 bits (524),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = -3

Query  683  SRLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVG  504
            +R+VQAADSVS+CLSKG+GAPVGSVIVG KSFI +AR +RKTLGGGMRQIGVLCAAALV 
Sbjct  195  TRIVQAADSVSICLSKGIGAPVGSVIVGSKSFITKARWLRKTLGGGMRQIGVLCAAALVA  254

Query  503  FQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
             +ENV KLE DHKKAK LAEGLN+I  L+VD+A+VETNI++ D+ K+      + CK L 
Sbjct  255  LRENVAKLEDDHKKAKILAEGLNRIERLKVDVAAVETNIIYVDLPKDPKFGAEDACKSLE  314

Query  323  EHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGV  201
              GV ++P+   RIR V+HHQISD+D+ Y LS  ++  + V
Sbjct  315  VLGVFVIPQTTFRIRIVLHHQISDSDLDYVLSCFEKLFSSV  355



>ref|XP_003590971.1| L-allo-threonine aldolase [Medicago truncatula]
Length=336

 Score =   205 bits (522),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 130/164 (79%), Gaps = 1/164 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKG+GAPVGSVIVG K+FI +A+ +RKTLGGGMRQIG+LCAAALV  
Sbjct  174  RLVEAADSVSVCLSKGIGAPVGSVIVGSKNFITKAKRLRKTLGGGMRQIGILCAAALVAL  233

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENVGKLE DHKK + LA+GLN+I GL V+  S+ETNI+F DI+  + TT  ++ K L E
Sbjct  234  KENVGKLESDHKKTRLLADGLNEIKGLRVNPCSIETNIIFIDIVDGSRTTTEKIFKYLEE  293

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
             G+L++ E   R+R V+HHQIS +DVQY LS  Q+AV  + NG+
Sbjct  294  RGILLMQEKASRLRVVLHHQISASDVQYTLSCFQQAVQ-IENGN  336



>gb|AES61221.2| L-allo-threonine aldolase-like protein [Medicago truncatula]
Length=355

 Score =   206 bits (523),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 130/164 (79%), Gaps = 1/164 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKG+GAPVGSVIVG K+FI +A+ +RKTLGGGMRQIG+LCAAALV  
Sbjct  193  RLVEAADSVSVCLSKGIGAPVGSVIVGSKNFITKAKRLRKTLGGGMRQIGILCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENVGKLE DHKK + LA+GLN+I GL V+  S+ETNI+F DI+  + TT  ++ K L E
Sbjct  253  KENVGKLESDHKKTRLLADGLNEIKGLRVNPCSIETNIIFIDIVDGSRTTTEKIFKYLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
             G+L++ E   R+R V+HHQIS +DVQY LS  Q+AV  + NG+
Sbjct  313  RGILLMQEKASRLRVVLHHQISASDVQYTLSCFQQAVQ-IENGN  355



>ref|XP_006408182.1| hypothetical protein EUTSA_v10021036mg [Eutrema salsugineum]
 gb|ESQ49635.1| hypothetical protein EUTSA_v10021036mg [Eutrema salsugineum]
Length=352

 Score =   206 bits (523),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            R+VQAADSVS+CLSKG+GAPVGSVIVG KSFI +AR +RKTLGGGMRQIGVLCAAALV  
Sbjct  196  RIVQAADSVSICLSKGIGAPVGSVIVGSKSFITKARWLRKTLGGGMRQIGVLCAAALVAL  255

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             ENV KL+ DHKKAK LAEGLN+I  L VD+ +VETNI++ DI K+      + CK L  
Sbjct  256  HENVAKLDDDHKKAKILAEGLNRIERLRVDVTAVETNIIYVDIPKDPKFRAEDACKSLEV  315

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALS  228
             GVL++P+   RIR V+HHQISD+DV+Y LS
Sbjct  316  LGVLVIPQATFRIRIVLHHQISDSDVEYVLS  346



>gb|AFK38526.1| unknown [Medicago truncatula]
Length=370

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 130/164 (79%), Gaps = 1/164 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKG+GAPVGSVIVG K+FI +A+ +RKTLGGGMRQIG+LCAAALV  
Sbjct  208  RLVEAADSVSVCLSKGIGAPVGSVIVGSKNFITKAKRLRKTLGGGMRQIGILCAAALVAL  267

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENVGKLE DHKK + LA+GLN+I GL V+  S+ETNI+F DI+  + TT  ++ K L E
Sbjct  268  KENVGKLESDHKKTRLLADGLNEIKGLRVNPCSIETNIIFIDIVDGSRTTTEKIFKYLEE  327

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
             G+L++ E   R+R V+HHQIS +DVQY LS  Q+AV  + NG+
Sbjct  328  RGILLMQEKASRLRVVLHHQISASDVQYTLSCFQQAVQ-IENGN  370



>ref|XP_003590972.1| L-allo-threonine aldolase [Medicago truncatula]
 gb|AES61223.1| L-allo-threonine aldolase-like protein [Medicago truncatula]
Length=370

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 130/164 (79%), Gaps = 1/164 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKG+GAPVGSVIVG K+FI +A+ +RKTLGGGMRQIG+LCAAALV  
Sbjct  208  RLVEAADSVSVCLSKGIGAPVGSVIVGSKNFITKAKRLRKTLGGGMRQIGILCAAALVAL  267

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENVGKLE DHKK + LA+GLN+I GL V+  S+ETNI+F DI+  + TT  ++ K L E
Sbjct  268  KENVGKLESDHKKTRLLADGLNEIKGLRVNPCSIETNIIFIDIVDGSRTTTEKIFKYLEE  327

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
             G+L++ E   R+R V+HHQIS +DVQY LS  Q+AV  + NG+
Sbjct  328  RGILLMQEKASRLRVVLHHQISASDVQYTLSCFQQAVQ-IENGN  370



>ref|XP_003590973.1| L-allo-threonine aldolase [Medicago truncatula]
 gb|AES61224.1| L-allo-threonine aldolase-like protein [Medicago truncatula]
Length=396

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 130/164 (79%), Gaps = 1/164 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKG+GAPVGSVIVG K+FI +A+ +RKTLGGGMRQIG+LCAAALV  
Sbjct  234  RLVEAADSVSVCLSKGIGAPVGSVIVGSKNFITKAKRLRKTLGGGMRQIGILCAAALVAL  293

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENVGKLE DHKK + LA+GLN+I GL V+  S+ETNI+F DI+  + TT  ++ K L E
Sbjct  294  KENVGKLESDHKKTRLLADGLNEIKGLRVNPCSIETNIIFIDIVDGSRTTTEKIFKYLEE  353

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
             G+L++ E   R+R V+HHQIS +DVQY LS  Q+AV  + NG+
Sbjct  354  RGILLMQEKASRLRVVLHHQISASDVQYTLSCFQQAVQ-IENGN  396



>ref|XP_004495577.1| PREDICTED: L-allo-threonine aldolase-like isoform X2 [Cicer arietinum]
Length=355

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 130/164 (79%), Gaps = 1/164 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVGSVIVG K+FI +A+ +RKTLGGGMRQIG+LCAA+LV  
Sbjct  193  RLVKAADSVSVCLSKGLGAPVGSVIVGSKNFITKAKRLRKTLGGGMRQIGILCAASLVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENVGKLE DHKK + LA+GLN+I GL V+  SVETNI+F DI + + TT  ++CK L E
Sbjct  253  KENVGKLESDHKKTRLLADGLNEIEGLRVNPCSVETNIIFIDIEEGSRTTAEKICKYLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
             G+L+L +   R+R V+H QIS +DVQY LS  Q+A+  + NG+
Sbjct  313  RGILLLQDKSSRLRVVLHFQISSSDVQYTLSCFQQALQ-IENGN  355



>ref|XP_010906812.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X4 [Elaeis guineensis]
 ref|XP_010906813.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X4 [Elaeis guineensis]
Length=359

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVC+SKGLGAPVGSVIVG + FI +A+ +RKTLGGGMRQ+GVLCAAA V  
Sbjct  193  RLVEAADSVSVCMSKGLGAPVGSVIVGSREFITKAKRLRKTLGGGMRQVGVLCAAAYVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++NVGKLE DHKKAK  A+GL +I  L VD +SVETN+VF DI++ +  T   LC+ L E
Sbjct  253  RDNVGKLEDDHKKAKMFADGLRQIKELTVDTSSVETNMVFFDIVESSLITPERLCQVLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            HGVL +P     +RFV+H+QIS++D+ YAL+ VQ+AV
Sbjct  313  HGVLAMPASSTSVRFVVHYQISESDIHYALACVQQAV  349



>emb|CDY42933.1| BnaC05g47180D [Brassica napus]
Length=360

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            R+VQAADSVS+CLSKG+GAPVGSVIVG KSFI +AR +RKTLGGGMRQIGVLCAAALV  
Sbjct  196  RIVQAADSVSICLSKGIGAPVGSVIVGSKSFITKARWLRKTLGGGMRQIGVLCAAALVAL  255

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENV KLE DHK AK LAEGLN+I  L+V++A+VETNI++ D+ K+      + CK L  
Sbjct  256  RENVAKLEDDHKNAKILAEGLNRIERLKVNVAAVETNIIYVDLPKDPKFGAEDACKSLEV  315

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVA  198
             GVL++P+   RIR V+HHQISD+D+ Y LS  ++  + VA
Sbjct  316  LGVLVIPQTTFRIRIVLHHQISDSDLDYVLSCFEKLFSSVA  356



>ref|NP_566228.1| threonine aldolase 2 [Arabidopsis thaliana]
 sp|Q9FPH3.1|THA2_ARATH RecName: Full=Probable low-specificity L-threonine aldolase 2; 
AltName: Full=Threonine aldolase 2 [Arabidopsis thaliana]
 gb|AAG40385.1|AF325033_1 AT3g04520 [Arabidopsis thaliana]
 gb|AAM14044.1| putative L-allo-threonine aldolase [Arabidopsis thaliana]
 gb|AAM62682.1| L-allo-threonine aldolase, putative [Arabidopsis thaliana]
 gb|AAM67566.1| putative L-allo-threonine aldolase [Arabidopsis thaliana]
 dbj|BAD43108.1| L-allo-threonine aldolase like protein [Arabidopsis thaliana]
 gb|AEE74091.1| threonine aldolase 2 [Arabidopsis thaliana]
Length=355

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            R+VQAADSVS+CLSKG+GAPVGSVIVG K FI +AR +RKTLGGGMRQIGVLCAAALV  
Sbjct  197  RIVQAADSVSICLSKGIGAPVGSVIVGSKKFITKARWLRKTLGGGMRQIGVLCAAALVAL  256

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             ENV KLE DHKKA+ LAEGLN+I  L V++A+VETNI++ DI ++      E CK L +
Sbjct  257  HENVAKLEDDHKKARVLAEGLNRIERLRVNVAAVETNIIYVDIPEDPKFGAEEACKSLED  316

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALS  228
             GVL++P+   RIR V+HHQISD DV+Y LS
Sbjct  317  VGVLVIPQATFRIRIVLHHQISDVDVEYVLS  347



>ref|XP_010906811.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X3 [Elaeis guineensis]
Length=365

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVC+SKGLGAPVGSVIVG + FI +A+ +RKTLGGGMRQ+GVLCAAA V  
Sbjct  199  RLVEAADSVSVCMSKGLGAPVGSVIVGSREFITKAKRLRKTLGGGMRQVGVLCAAAYVAL  258

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++NVGKLE DHKKAK  A+GL +I  L VD +SVETN+VF DI++ +  T   LC+ L E
Sbjct  259  RDNVGKLEDDHKKAKMFADGLRQIKELTVDTSSVETNMVFFDIVESSLITPERLCQVLEE  318

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            HGVL +P     +RFV+H+QIS++D+ YAL+ VQ+AV
Sbjct  319  HGVLAMPASSTSVRFVVHYQISESDIHYALACVQQAV  355



>ref|XP_004495576.1| PREDICTED: L-allo-threonine aldolase-like isoform X1 [Cicer arietinum]
Length=370

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 130/164 (79%), Gaps = 1/164 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVGSVIVG K+FI +A+ +RKTLGGGMRQIG+LCAA+LV  
Sbjct  208  RLVKAADSVSVCLSKGLGAPVGSVIVGSKNFITKAKRLRKTLGGGMRQIGILCAASLVAL  267

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENVGKLE DHKK + LA+GLN+I GL V+  SVETNI+F DI + + TT  ++CK L E
Sbjct  268  KENVGKLESDHKKTRLLADGLNEIEGLRVNPCSVETNIIFIDIEEGSRTTAEKICKYLEE  327

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
             G+L+L +   R+R V+H QIS +DVQY LS  Q+A+  + NG+
Sbjct  328  RGILLLQDKSSRLRVVLHFQISSSDVQYTLSCFQQALQ-IENGN  370



>emb|CDY49330.1| BnaA05g32920D [Brassica napus]
Length=360

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 125/160 (78%), Gaps = 0/160 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            R+VQAADSVS+CLSKG+GAPVGSVIVG KSFI +AR +RKTLGGGMRQIGVLCAAALV  
Sbjct  196  RIVQAADSVSICLSKGIGAPVGSVIVGSKSFITKARWLRKTLGGGMRQIGVLCAAALVAL  255

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENV KLE DHKKAK LAEGLN+I  L+VD+A+VETNI++ D+ K+      + CK L  
Sbjct  256  RENVAKLEDDHKKAKILAEGLNRIERLKVDVAAVETNIIYVDLPKDPKFGAEDACKSLEV  315

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGV  201
              VL++P+   RIR V+HHQISD+D+ Y LS  ++  + V
Sbjct  316  LSVLVIPQTTFRIRIVLHHQISDSDLDYVLSCFEKLFSSV  355



>gb|ACG34432.1| L-allo-threonine aldolase [Zea mays]
Length=377

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 127/164 (77%), Gaps = 1/164 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVC+SKGLGAPVGSVIVG K+FID+A+I+RKTLGGGMRQ+GVLCAAA V  
Sbjct  194  RLVRAADSVSVCISKGLGAPVGSVIVGSKAFIDKAKILRKTLGGGMRQVGVLCAAAHVAV  253

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             +NVGKL  DH+KAK LA+GLNKI    VD ASV+TN+VF DI+ ++  +  +LC+ L  
Sbjct  254  HDNVGKLADDHRKAKALADGLNKIEQFRVDSASVQTNMVFLDIV-DSRISSNKLCQVLGT  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
            H VL  P  PK +R V+H+QISD DVQYAL+  ++A   +  GS
Sbjct  313  HNVLASPRSPKSVRLVLHYQISDDDVQYALTCFKKAAEQLLMGS  356



>ref|XP_008661960.1| PREDICTED: L-allo-threonine aldolase isoform X1 [Zea mays]
 ref|XP_008661961.1| PREDICTED: L-allo-threonine aldolase isoform X1 [Zea mays]
 gb|ACG33933.1| L-allo-threonine aldolase [Zea mays]
 gb|AFW58856.1| putative threonine aldolase family protein [Zea mays]
Length=377

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 128/164 (78%), Gaps = 1/164 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVC+SKGLGAPVGSVIVG K+FID+A+I+RKTLGGGMRQ+GVLCAAA V  
Sbjct  194  RLVRAADSVSVCISKGLGAPVGSVIVGSKAFIDKAKILRKTLGGGMRQVGVLCAAAHVAV  253

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++NVGKL  DH+KAK LA+GLNKI    VD ASV+TN+VF DI+ ++  +  +LC+ L  
Sbjct  254  RDNVGKLADDHRKAKALADGLNKIEQFRVDSASVQTNMVFLDIV-DSRISSNKLCQVLGT  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
            H VL  P  PK +R V+H+QISD DVQYAL+  ++A   +  GS
Sbjct  313  HNVLASPRSPKSVRLVLHYQISDDDVQYALTCFKKAAEQLLMGS  356



>tpg|DAA36971.1| TPA: putative threonine aldolase family protein isoform 1 [Zea 
mays]
 tpg|DAA36972.1| TPA: putative threonine aldolase family protein isoform 2 [Zea 
mays]
Length=372

 Score =   204 bits (519),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 129/163 (79%), Gaps = 1/163 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAP+GSV+VG ++FID+ARI+RKTLGGGMRQ+GVLCAAA V  
Sbjct  193  RLVKAADSVSVCLSKGLGAPIGSVVVGSEAFIDKARILRKTLGGGMRQVGVLCAAAYVAV  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ VGKL  DH+KAK LAEGL KI  L VD +SVETN+VF DI+ +   +  +LC+ L +
Sbjct  253  RDTVGKLADDHRKAKALAEGLKKIKQLTVDSSSVETNMVFFDIV-DPRISPSKLCQVLEQ  311

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANG  192
              VL +P   K +RFVIH+QISD+DVQYAL+ V++AV  +  G
Sbjct  312  RNVLAMPASSKSVRFVIHYQISDSDVQYALTCVEKAVEELLKG  354



>ref|XP_007144017.1| hypothetical protein PHAVU_007G122200g [Phaseolus vulgaris]
 ref|XP_007144018.1| hypothetical protein PHAVU_007G122200g [Phaseolus vulgaris]
 gb|ESW16011.1| hypothetical protein PHAVU_007G122200g [Phaseolus vulgaris]
 gb|ESW16012.1| hypothetical protein PHAVU_007G122200g [Phaseolus vulgaris]
Length=365

 Score =   204 bits (519),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = -3

Query  683  SRLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVG  504
             RLVQAADSVSVCLSKG+GAPVGSVIVG ++FI +AR +RKTLGGGMRQIG+LCAAALV 
Sbjct  192  DRLVQAADSVSVCLSKGIGAPVGSVIVGSENFIAKARRLRKTLGGGMRQIGILCAAALVA  251

Query  503  FQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
             QEN+GKLE DHKKA+ LA+GL ++ GL VD   VETNIVF DI     T   ++CK L 
Sbjct  252  LQENIGKLENDHKKARLLADGLRELKGLRVDTLGVETNIVFIDIEDGIQTRAEKICKYLE  311

Query  323  EHGVLILPEGPKRIRFVIHHQISDTDVQYALS  228
            E G+L++ E   R+R V+HHQIS +DVQYALS
Sbjct  312  ERGILLMQESSSRMRVVLHHQISASDVQYALS  343



>ref|XP_010906809.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Elaeis guineensis]
Length=387

 Score =   204 bits (520),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVC+SKGLGAPVGSVIVG + FI +A+ +RKTLGGGMRQ+GVLCAAA V  
Sbjct  221  RLVEAADSVSVCMSKGLGAPVGSVIVGSREFITKAKRLRKTLGGGMRQVGVLCAAAYVAL  280

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++NVGKLE DHKKAK  A+GL +I  L VD +SVETN+VF DI++ +  T   LC+ L E
Sbjct  281  RDNVGKLEDDHKKAKMFADGLRQIKELTVDTSSVETNMVFFDIVESSLITPERLCQVLEE  340

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            HGVL +P     +RFV+H+QIS++D+ YAL+ VQ+AV
Sbjct  341  HGVLAMPASSTSVRFVVHYQISESDIHYALACVQQAV  377



>ref|XP_010906810.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Elaeis guineensis]
Length=384

 Score =   204 bits (520),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVC+SKGLGAPVGSVIVG + FI +A+ +RKTLGGGMRQ+GVLCAAA V  
Sbjct  218  RLVEAADSVSVCMSKGLGAPVGSVIVGSREFITKAKRLRKTLGGGMRQVGVLCAAAYVAL  277

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++NVGKLE DHKKAK  A+GL +I  L VD +SVETN+VF DI++ +  T   LC+ L E
Sbjct  278  RDNVGKLEDDHKKAKMFADGLRQIKELTVDTSSVETNMVFFDIVESSLITPERLCQVLEE  337

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            HGVL +P     +RFV+H+QIS++D+ YAL+ VQ+AV
Sbjct  338  HGVLAMPASSTSVRFVVHYQISESDIHYALACVQQAV  374



>dbj|BAK03835.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   204 bits (518),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 127/164 (77%), Gaps = 1/164 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVGSVIVG K+FID+ARI+RKTLGGGMRQ+GVLCAAA V  
Sbjct  195  RLVRAADSVSVCLSKGLGAPVGSVIVGSKAFIDQARILRKTLGGGMRQVGVLCAAAYVAV  254

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++NVGKL  DH+KAK LA+GL KI    VD+ SVETN+VF DI  +   T  +LC+ L  
Sbjct  255  RDNVGKLADDHRKAKVLADGLKKIKQFTVDLTSVETNMVFFDI-ADPRITSDKLCQLLER  313

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
              VL +P   K +R VIH+QISD+DVQY L+ +++AV  + +GS
Sbjct  314  RNVLAMPGTSKSVRLVIHYQISDSDVQYTLTCIEKAVEEILSGS  357



>ref|XP_003580135.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Brachypodium 
distachyon]
 ref|XP_010240138.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Brachypodium 
distachyon]
Length=372

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 128/164 (78%), Gaps = 1/164 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVGSVIVG K+FID+A+I+RKTLGGGMRQ+G+LCAAA VG 
Sbjct  193  RLVRAADSVSVCLSKGLGAPVGSVIVGSKAFIDKAKIVRKTLGGGMRQVGILCAAAYVGV  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ VGKL  DH+KAK LAEGL KI    VD+ SVETN+VF DI  +   +  +LC+ L +
Sbjct  253  RDTVGKLADDHRKAKVLAEGLKKIKQFTVDLTSVETNMVFFDI-TDPRISPDKLCQVLEQ  311

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
              VL +P   K +R VIH+QISDTDVQYAL+ +++ V  + +G+
Sbjct  312  RNVLAMPASSKSVRLVIHYQISDTDVQYALTCIEKVVEEILSGN  355



>ref|XP_010553776.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Tarenaya hassleriana]
Length=339

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV AADSVSVCLSKGLGAPVGSVIVG   FI++AR +RKTLGGGMRQIGVLCAAAL+  
Sbjct  174  RLVHAADSVSVCLSKGLGAPVGSVIVGSHRFIEKARTLRKTLGGGMRQIGVLCAAALIAL  233

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QENV KLE DHKKAK LA+GLN+I G+ V+ A+VETNI+F ++   +     +L K L E
Sbjct  234  QENVSKLEYDHKKAKILAQGLNQIKGIRVNAAAVETNIIFLEMEDSSRLGAEKLRKNLEE  293

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            +G+L++P    RIR VIHHQIS  DV + LS +Q+AV G    + D
Sbjct  294  NGILVIPVNSSRIRIVIHHQISAGDVYHTLSCIQQAVNGAQEANVD  339



>ref|XP_008443794.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Cucumis 
melo]
 ref|XP_008443795.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Cucumis 
melo]
Length=360

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 125/160 (78%), Gaps = 0/160 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQ ADSVSVCLSKGLGAPVGSVIVG KSFI +AR +RKTLGGGMRQIG+LCAA LV  
Sbjct  194  RLVQVADSVSVCLSKGLGAPVGSVIVGSKSFISKARRVRKTLGGGMRQIGILCAAGLVAL  253

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENV KLE DH KAK LA GL +I G++VD+ SVETNI+F +I +++  +   LCK + E
Sbjct  254  KENVQKLEADHHKAKQLASGLCQIKGIKVDLKSVETNIIFFEIEEDSQISAKLLCKSMEE  313

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGV  201
            HG+L++ E   RIR V+HHQIS +DV+Y L  +++ + GV
Sbjct  314  HGILLMQESLSRIRIVLHHQISTSDVEYTLKCMKQFLCGV  353



>ref|XP_006305180.1| hypothetical protein CARUB_v10009546mg [Capsella rubella]
 gb|EOA38078.1| hypothetical protein CARUB_v10009546mg [Capsella rubella]
Length=358

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 129/164 (79%), Gaps = 0/164 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAP+GSVIVG +SFI++A+ +RK LGGGMRQIGVLCAAALV  
Sbjct  193  RLVKAADSVSVCLSKGLGAPIGSVIVGSQSFIEKAKTVRKALGGGMRQIGVLCAAALVAI  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KL+ DHKK K LAEGLN++ G+ V++A+VETN++F D+   +  T  +L K L E
Sbjct  253  QENLPKLQHDHKKTKLLAEGLNQVKGIRVNVAAVETNMIFMDMEDGSRLTAEKLRKTLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
            +G+L++PE   RIR VIHHQI+ +DV Y LS +Q+A+  +   S
Sbjct  313  NGILVIPENSSRIRMVIHHQITTSDVHYTLSCLQQALQTIQEPS  356



>ref|XP_010553775.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Tarenaya hassleriana]
Length=365

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV AADSVSVCLSKGLGAPVGSVIVG   FI++AR +RKTLGGGMRQIGVLCAAAL+  
Sbjct  200  RLVHAADSVSVCLSKGLGAPVGSVIVGSHRFIEKARTLRKTLGGGMRQIGVLCAAALIAL  259

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QENV KLE DHKKAK LA+GLN+I G+ V+ A+VETNI+F ++   +     +L K L E
Sbjct  260  QENVSKLEYDHKKAKILAQGLNQIKGIRVNAAAVETNIIFLEMEDSSRLGAEKLRKNLEE  319

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  183
            +G+L++P    RIR VIHHQIS  DV + LS +Q+AV G    + D
Sbjct  320  NGILVIPVNSSRIRIVIHHQISAGDVYHTLSCIQQAVNGAQEANVD  365



>ref|XP_002448187.1| hypothetical protein SORBIDRAFT_06g022630 [Sorghum bicolor]
 gb|EES12515.1| hypothetical protein SORBIDRAFT_06g022630 [Sorghum bicolor]
Length=372

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVS+CLSKGLGAP+GSVIVG K+FID+A+I+RKTLGGGMRQ+GVLCAAA V  
Sbjct  193  RLVKAADSVSICLSKGLGAPIGSVIVGSKAFIDKAKILRKTLGGGMRQVGVLCAAAYVAV  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ VGKL  DH+KAK LAEGL KI    VD +SVETN+VF DI+ +   +  +LC+ L +
Sbjct  253  RDTVGKLADDHRKAKALAEGLKKIKQFTVDSSSVETNMVFFDIV-DPRISPNKLCQVLEQ  311

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANG  192
              VL +P   K +RFV+H+QISD+DVQYAL+ V++AV  +  G
Sbjct  312  RNVLAMPASSKSVRFVVHYQISDSDVQYALTCVEKAVEELLKG  354



>ref|XP_010489194.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010489200.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010489206.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
Length=358

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 130/164 (79%), Gaps = 0/164 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            +LV+AADSVSVCLSKGLGAP+GSVIVG +SFI++A+ +RK LGGGMRQIGVLCAAALV  
Sbjct  193  KLVKAADSVSVCLSKGLGAPIGSVIVGSQSFIEKAKTVRKALGGGMRQIGVLCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KL+ DHKKAK LAEGLN++ G++V++ +VETN++F D+   +  T  +L K L E
Sbjct  253  QENLPKLQHDHKKAKLLAEGLNQMKGIKVNVTAVETNMIFMDMEDGSRLTAEKLRKTLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
            +G+L++PE   RIR VIHHQI+ +DV Y LS +Q+AV  +   S
Sbjct  313  NGILVIPEKSSRIRMVIHHQITTSDVHYTLSCLQQAVETIQEPS  356



>ref|NP_001241763.1| L-allo-threonine aldolase [Zea mays]
 gb|ACG36649.1| L-allo-threonine aldolase [Zea mays]
Length=370

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 129/164 (79%), Gaps = 1/164 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVGSVIVG K+FID+ARI+RKTLGGGMRQ+GVLCAAA V  
Sbjct  191  RLVKAADSVSVCLSKGLGAPVGSVIVGSKAFIDKARILRKTLGGGMRQVGVLCAAAHVAV  250

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ +GKL  DH+KAK LA GL KI  + VD ASVETN+VF +++ +   +  +LC+ L +
Sbjct  251  RDTMGKLADDHRKAKALAVGLKKIEQITVDPASVETNMVFFEVM-DPRISPDKLCQVLEQ  309

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
            H VL +P   K IRFV+H+QISD DV+YAL+ VQ+A+  +  GS
Sbjct  310  HNVLAMPANSKSIRFVVHYQISDADVRYALACVQKAIKELLEGS  353



>ref|XP_010463930.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Camelina 
sativa]
Length=353

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 119/151 (79%), Gaps = 0/151 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            R+VQAADSVS+CLSKG+GAPVGSVIVG K FI +AR MRKTLGGGMRQIGVLCAAALV  
Sbjct  197  RIVQAADSVSICLSKGIGAPVGSVIVGSKKFITKARWMRKTLGGGMRQIGVLCAAALVAL  256

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             ENV KL  DHKKAK LAEGLN+I  L V++A+VE+NI++ DI ++      + CK L +
Sbjct  257  NENVPKLGDDHKKAKILAEGLNRIERLRVNVAAVESNIIYVDIPEDPKFGAEDACKSLKD  316

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALS  228
             GVL+LP+   RIR V+HHQISD DV+Y LS
Sbjct  317  VGVLVLPQATFRIRIVLHHQISDVDVEYVLS  347



>ref|XP_006298023.1| hypothetical protein CARUB_v10014068mg [Capsella rubella]
 gb|EOA30921.1| hypothetical protein CARUB_v10014068mg [Capsella rubella]
Length=353

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            R+VQAADSVS+CLSKG+GAPVGSVIVG K FI +AR +RKTLGGGMRQIGVLCAAALV  
Sbjct  197  RIVQAADSVSICLSKGIGAPVGSVIVGSKKFITKARWLRKTLGGGMRQIGVLCAAALVAL  256

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             ENV KL+ DHKKAK LAEGLN+I  L+V++A+VETNI++ DI ++      + CK L +
Sbjct  257  NENVPKLDDDHKKAKILAEGLNRIERLKVNVAAVETNIIYVDIPEDPKFGAEDACKSLKD  316

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQR  216
             GVL++P+   R+R V+HHQISD DV Y LS  Q+
Sbjct  317  VGVLVIPQSTFRMRIVLHHQISDDDVDYVLSCFQK  351



>ref|XP_008667491.1| PREDICTED: putative threonine aldolase family protein isoform 
X1 [Zea mays]
 tpg|DAA36968.1| TPA: putative threonine aldolase family protein [Zea mays]
Length=370

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 128/164 (78%), Gaps = 1/164 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVGSVIVG K+FID+ARI+RKTLGGGMRQ+GVLCAAA V  
Sbjct  191  RLVKAADSVSVCLSKGLGAPVGSVIVGSKAFIDKARILRKTLGGGMRQVGVLCAAAHVAV  250

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ VGKL  DH+KAK LAEGL KI  + VD ASVETN+VF +++ +   +  +LC+ L +
Sbjct  251  RDTVGKLADDHRKAKALAEGLKKIEQITVDSASVETNMVFFEVM-DPRISPDKLCQVLEQ  309

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
              VL LP   K IRFVIH+QISD DV YAL+ V++A+  +  GS
Sbjct  310  DNVLALPANSKSIRFVIHYQISDADVGYALACVEKAIKELLEGS  353



>ref|XP_010415759.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Camelina 
sativa]
Length=353

 Score =   201 bits (512),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 119/151 (79%), Gaps = 0/151 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            R+VQAADSVS+CLSKG+GAPVGSVIVG K FI +AR +RKTLGGGMRQIGVLCAAALV  
Sbjct  197  RIVQAADSVSICLSKGIGAPVGSVIVGSKKFITKARWLRKTLGGGMRQIGVLCAAALVAL  256

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             ENV KL  DHKKAK LAEGLN+I  L V++A+VETNI++ DI ++      + CK L +
Sbjct  257  NENVPKLGDDHKKAKILAEGLNRIERLRVNVAAVETNIIYVDIPEDPKFGAEDACKSLED  316

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALS  228
             GVL+LP+   RIR V+HHQISD DV+Y LS
Sbjct  317  VGVLVLPQATFRIRIVLHHQISDVDVEYVLS  347



>ref|XP_010475669.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010475670.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
Length=358

 Score =   201 bits (511),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 129/164 (79%), Gaps = 0/164 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            +LV+AADSVSVCLSKGLGAP+GSVIVG +SFI++A+ +RK LGGGMRQIGVLCAAALV  
Sbjct  193  KLVKAADSVSVCLSKGLGAPIGSVIVGSQSFIEKAKTVRKALGGGMRQIGVLCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KL+ DHKKAK LAEGLN++ G+ V++ +VETN++F D+   +  T  +L K L E
Sbjct  253  QENLPKLQHDHKKAKLLAEGLNQLKGIRVNVTAVETNMIFMDMEDGSRLTAGKLRKALEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
            +G+L++PE   RIR VIHHQI+  DVQY LS +Q+A+  +   S
Sbjct  313  NGILVIPENSSRIRMVIHHQITTCDVQYTLSCLQQALQTIQEPS  356



>ref|XP_002884450.1| hypothetical protein ARALYDRAFT_896488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60709.1| hypothetical protein ARALYDRAFT_896488 [Arabidopsis lyrata subsp. 
lyrata]
Length=353

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 119/151 (79%), Gaps = 0/151 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            R+V AADSVS+CLSKG+GAPVGSVIVG K FI +AR +RKTLGGGMRQIGVLCAAALV  
Sbjct  197  RIVHAADSVSICLSKGIGAPVGSVIVGSKEFITKARWLRKTLGGGMRQIGVLCAAALVAL  256

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             ENV KLE DHKKA+ LAEGL++I  L V++A+VETNI++ DI ++      E CK L +
Sbjct  257  HENVAKLEDDHKKARFLAEGLSRIERLRVNVAAVETNIIYVDIPEDPKFGAEEACKSLED  316

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALS  228
             GVLI+P+   RIR V+HHQISD DV+Y LS
Sbjct  317  VGVLIIPQATFRIRIVLHHQISDVDVEYVLS  347



>gb|ACJ85157.1| unknown [Medicago truncatula]
 gb|AFK44463.1| unknown [Medicago truncatula]
Length=421

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 129/164 (79%), Gaps = 1/164 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKG+GAPVGSVIVG K+FI +A+ ++KTL GGMRQIG+LCAAALV  
Sbjct  259  RLVEAADSVSVCLSKGIGAPVGSVIVGSKNFITKAKRLQKTLSGGMRQIGILCAAALVAL  318

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENVGKLE DHKK + LA+GLN+I GL V+  S+ETNI+F DI+  + TT  ++ K L E
Sbjct  319  KENVGKLESDHKKTRLLADGLNEIKGLRVNPCSIETNIIFIDIVDGSRTTTEKIFKYLEE  378

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
             G+L++ E   R+R V+HHQIS +DVQY LS  Q+AV  + NG+
Sbjct  379  RGILLMQEKASRLRVVLHHQISASDVQYTLSCFQQAVQ-IENGN  421



>ref|XP_003590970.1| L-allo-threonine aldolase [Medicago truncatula]
Length=463

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 131/180 (73%), Gaps = 7/180 (4%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKG+GAPVGSVIVG K+FI +A+ +RKTLGGGMRQIG+LCAAALV  
Sbjct  250  RLVEAADSVSVCLSKGIGAPVGSVIVGSKNFITKAKRLRKTLGGGMRQIGILCAAALVAL  309

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENVGKLE DHKK + LA+GLN+I GL V+  S+ETNI+F DI+  + TT  ++ K L E
Sbjct  310  KENVGKLESDHKKTRLLADGLNEIKGLRVNPCSIETNIIFIDIVDGSRTTTEKIFKYLEE  369

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGDHXN*GNCYLCFKIF  141
             G+L++ E   R+R V+HHQIS +DVQY LS  Q     +A         G   LC++I 
Sbjct  370  RGILLMQEKASRLRVVLHHQISASDVQYTLSCFQLYKLKMATS-------GKIALCWRII  422



>ref|NP_001149239.1| L-allo-threonine aldolase [Zea mays]
 gb|ACG34688.1| L-allo-threonine aldolase [Zea mays]
 gb|AFW58857.1| putative threonine aldolase family protein [Zea mays]
Length=375

 Score =   199 bits (507),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 128/164 (78%), Gaps = 3/164 (2%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVC+SKGLGAPVGSVIVG K+FID+A+I+RKTLGGGMRQ+GVLCAAA V  
Sbjct  194  RLVRAADSVSVCISKGLGAPVGSVIVGSKAFIDKAKILRKTLGGGMRQVGVLCAAAHVAV  253

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++NVGKL  DH+KAK LA+GLNKI    VD ASV+TN+VF DI+ ++  +  +LC+ L  
Sbjct  254  RDNVGKLADDHRKAKALADGLNKIEQFRVDSASVQTNMVFLDIV-DSRISSNKLCQVLGT  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
            H VL  P  PKR+  V+H+QISD DVQYAL+  ++A   +  GS
Sbjct  313  HNVLASPRSPKRL--VLHYQISDDDVQYALTCFKKAAEQLLMGS  354



>ref|XP_008802139.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Phoenix dactylifera]
Length=359

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 123/157 (78%), Gaps = 0/157 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVC+SKGLGAP+GSVIVG   FI +AR +RKTLGGGMRQ+GVLCAAA V  
Sbjct  193  RLVQAADSVSVCMSKGLGAPIGSVIVGSSEFITKARRLRKTLGGGMRQVGVLCAAAYVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++NVGKLE DHKKAK  A+GL +I  L VD +SVETN+VF DI++ ++ +   LC+ L E
Sbjct  253  RDNVGKLEDDHKKAKLFADGLKQIKELTVDTSSVETNMVFLDIVESSHISPERLCQVLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            HGVL +P     +R V+HHQI ++D++Y L+ +++AV
Sbjct  313  HGVLAMPASSTSVRLVVHHQILESDIRYVLACMKQAV  349



>gb|EMS52584.1| L-allo-threonine aldolase [Triticum urartu]
Length=349

 Score =   198 bits (504),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 127/164 (77%), Gaps = 1/164 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVGSVIVG K+FID+A+I+RKTLGGGMRQ+G+LCAAA +  
Sbjct  170  RLVRAADSVSVCLSKGLGAPVGSVIVGSKAFIDKAKILRKTLGGGMRQVGILCAAAYLAV  229

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ VGKL  DH+KAK LA+GL KI    VD+ASVETN+VF DI  +   T  +LC+ L +
Sbjct  230  RDTVGKLADDHRKAKVLADGLTKIKQFTVDLASVETNMVFFDI-ADPRITPDKLCQVLEQ  288

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
              VL +P   K +R V H+QISD+DVQY L+ +++AV  + +G+
Sbjct  289  RNVLAMPASSKSVRLVTHYQISDSDVQYTLTCIEKAVEEILSGN  332



>tpg|DAA45471.1| TPA: hypothetical protein ZEAMMB73_239903 [Zea mays]
Length=194

 Score =   193 bits (491),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 121/154 (79%), Gaps = 1/154 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAP+ SV+VG ++FID+ARI+RKTLGGGMRQ+G LCAAA V  
Sbjct  27   RLVKAADSVSVCLSKGLGAPIRSVVVGSEAFIDKARILRKTLGGGMRQVGFLCAAAYVAV  86

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ VGKL  DH+KAK LAEGL KI    VD +SVETN+VF DI+ + + +  +LC+ L +
Sbjct  87   RDTVGKLADDHRKAKALAEGLTKIKQFTVDSSSVETNMVFFDIV-DPHISPSKLCQVLEQ  145

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  219
              VL +P   K +RFVIH+QI D+DVQYAL+ V+
Sbjct  146  RNVLAMPASSKSVRFVIHYQILDSDVQYALTCVE  179



>ref|XP_008655940.1| PREDICTED: probable low-specificity L-threonine aldolase 2 isoform 
X2 [Zea mays]
Length=198

 Score =   193 bits (491),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 121/154 (79%), Gaps = 1/154 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAP+ SV+VG ++FID+ARI+RKTLGGGMRQ+G LCAAA V  
Sbjct  27   RLVKAADSVSVCLSKGLGAPIRSVVVGSEAFIDKARILRKTLGGGMRQVGFLCAAAYVAV  86

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ VGKL  DH+KAK LAEGL KI    VD +SVETN+VF DI+ + + +  +LC+ L +
Sbjct  87   RDTVGKLADDHRKAKALAEGLTKIKQFTVDSSSVETNMVFFDIV-DPHISPSKLCQVLEQ  145

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  219
              VL +P   K +RFVIH+QI D+DVQYAL+ V+
Sbjct  146  RNVLAMPASSKSVRFVIHYQILDSDVQYALTCVE  179



>ref|XP_010262337.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Nelumbo nucifera]
Length=341

 Score =   198 bits (503),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = -3

Query  662  DSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGK  483
            ++ +VCLSKGLGAP+GSVIVG KSFI +A+ +RKTLGGGMRQ+G+LCAAA V   ENVGK
Sbjct  182  NASTVCLSKGLGAPIGSVIVGSKSFIAKAKRLRKTLGGGMRQVGILCAAAYVALHENVGK  241

Query  482  LEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLIL  303
            LE DHKK K LA+G+N+I  L +DM+S+ETNI+F DIL+ +N T  +L + L +HG+L++
Sbjct  242  LEDDHKKTKILADGINQIKELSIDMSSIETNIIFFDILEGSNVTVEKLVQFLEKHGILVM  301

Query  302  PEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            P     IR V+HHQIS+ DVQY LS +Q+AV
Sbjct  302  PASSSSIRLVLHHQISECDVQYTLSCIQQAV  332



>ref|NP_001189807.1| threonine aldolase 2 [Arabidopsis thaliana]
 gb|AEE74092.1| threonine aldolase 2 [Arabidopsis thaliana]
Length=354

 Score =   198 bits (503),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 119/151 (79%), Gaps = 1/151 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            R+VQAADSVS+CLSKG+GAPVGSVIVG K FI +AR +RKTLGGGMRQIGVLCAAALV  
Sbjct  197  RIVQAADSVSICLSKGIGAPVGSVIVGSKKFITKARWLRKTLGGGMRQIGVLCAAALVAL  256

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             ENV KLE DHKKA+ LA GLN+I  L V++A+VETNI++ DI ++      E CK L +
Sbjct  257  HENVAKLEDDHKKARVLA-GLNRIERLRVNVAAVETNIIYVDIPEDPKFGAEEACKSLED  315

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALS  228
             GVL++P+   RIR V+HHQISD DV+Y LS
Sbjct  316  VGVLVIPQATFRIRIVLHHQISDVDVEYVLS  346



>ref|XP_010485829.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Camelina 
sativa]
Length=353

 Score =   198 bits (503),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            R+VQAADSVS+CLS+G+GAPVGSVIVG K FI +AR +RKTLGGGMRQ+GVLCAAALV  
Sbjct  197  RIVQAADSVSICLSEGIGAPVGSVIVGSKEFITKARWLRKTLGGGMRQVGVLCAAALVAL  256

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             ENV KL  DHKKAK LAEGLN+I    V++A+VETNI++ DI ++      + CK L +
Sbjct  257  NENVPKLGDDHKKAKILAEGLNRIERFRVNVAAVETNIIYVDIPEDPKFGAEDACKSLED  316

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALS  228
             GVL+LP+   RIR V+HHQISD DV+Y LS
Sbjct  317  VGVLVLPQATFRIRIVLHHQISDVDVEYVLS  347



>emb|CDY31134.1| BnaA08g26840D [Brassica napus]
Length=369

 Score =   198 bits (504),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVG+VIVG  +FI++A+ +RKTLGGGMRQIGVLCAAALV  
Sbjct  193  RLVEAADSVSVCLSKGLGAPVGTVIVGSHTFIEKAKTLRKTLGGGMRQIGVLCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KL+ DHKKAK LAEGLN++ G+ +++A+VETN++F D+   +  T  +L K L E
Sbjct  253  QENLPKLQFDHKKAKLLAEGLNQMKGIRINVAAVETNMIFMDMEDGSKLTAEKLRKSLTE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
             G+L+LP    RIR V+HHQI+ +DV Y LS +Q+A+
Sbjct  313  CGILVLPGNSSRIRMVVHHQITISDVHYTLSCLQQAM  349



>ref|XP_008655935.1| PREDICTED: probable low-specificity L-threonine aldolase 2 isoform 
X1 [Zea mays]
Length=216

 Score =   194 bits (492),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 121/154 (79%), Gaps = 1/154 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAP+ SV+VG ++FID+ARI+RKTLGGGMRQ+G LCAAA V  
Sbjct  45   RLVKAADSVSVCLSKGLGAPIRSVVVGSEAFIDKARILRKTLGGGMRQVGFLCAAAYVAV  104

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ VGKL  DH+KAK LAEGL KI    VD +SVETN+VF DI+ + + +  +LC+ L +
Sbjct  105  RDTVGKLADDHRKAKALAEGLTKIKQFTVDSSSVETNMVFFDIV-DPHISPSKLCQVLEQ  163

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  219
              VL +P   K +RFVIH+QI D+DVQYAL+ V+
Sbjct  164  RNVLAMPASSKSVRFVIHYQILDSDVQYALTCVE  197



>ref|XP_009110878.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
Length=369

 Score =   198 bits (504),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVG+VIVG  +FI++A+ +RKTLGGGMRQIGVLCAAALV  
Sbjct  193  RLVEAADSVSVCLSKGLGAPVGTVIVGSHTFIEKAKTLRKTLGGGMRQIGVLCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KL+ DHKKAK LAEGLN++ G+ +++A+VETN++F D+   +  T  +L K L E
Sbjct  253  QENLPKLQFDHKKAKLLAEGLNQMKGIRINVAAVETNMIFMDMEDGSRLTAEKLRKSLTE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
             G+L+LP    RIR V+HHQI+ +DV Y LS +Q+A+
Sbjct  313  CGILVLPGNSSRIRMVVHHQITISDVHYTLSCLQQAM  349



>ref|XP_010458106.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010458107.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010458108.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
Length=358

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 128/164 (78%), Gaps = 0/164 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            +LV+AADSVSVCLSKGLGAP+GSVIVG +SFI++A+ +RK LGGGMRQIGVL AAALV  
Sbjct  193  KLVKAADSVSVCLSKGLGAPIGSVIVGSQSFIEKAKTVRKALGGGMRQIGVLWAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KL+ DHKKAK LAEGLN++ G+ V++ +VETN++F D+   +  T  +L + L E
Sbjct  253  QENLPKLQHDHKKAKLLAEGLNQMKGIRVNVTAVETNMIFMDMEDGSRLTAEKLRRTLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
            +G+L++PE   RIR VIHHQI+ +DV Y LS +Q+AV  +   S
Sbjct  313  NGILVIPENSSRIRMVIHHQITTSDVHYTLSCLQQAVQTIQEPS  356



>ref|XP_004976222.1| PREDICTED: uncharacterized protein R102.4-like [Setaria italica]
Length=372

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVGSVIVG K+FID+A+I+RKTLGGGMRQ+GVLCAAA V  
Sbjct  193  RLVKAADSVSVCLSKGLGAPVGSVIVGSKAFIDKAKILRKTLGGGMRQVGVLCAAAHVAV  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +++V KL  DH++AK LAEGLNK+    VD  SVETN+VF DI+ ++  +  +LC+ L +
Sbjct  253  RDSVEKLADDHRRAKALAEGLNKMEQFTVDSTSVETNMVFFDIV-DSRISSYKLCQILEK  311

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANG  192
            H V + P  PK +R V+H+ ISD+DVQYAL+  ++ V  +  G
Sbjct  312  HNVHVNPRSPKSVRLVLHYHISDSDVQYALTCFEKVVEELLTG  354



>emb|CAE05443.2| OSJNBa0073E02.3 [Oryza sativa Japonica Group]
Length=349

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 127/164 (77%), Gaps = 1/164 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVC+SKGLGAPVGSVIVG  +FI++A+I+RKTLGGGMRQ+G+LCAAA V  
Sbjct  170  RLVKAADSVSVCISKGLGAPVGSVIVGSTAFIEKAKILRKTLGGGMRQVGILCAAAYVAV  229

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ VGKL  DH++AK LA+GL KI    VD  SVETN+VF DI+ ++  +  +LC+ L +
Sbjct  230  RDTVGKLADDHRRAKVLADGLKKIKHFRVDTTSVETNMVFFDIV-DSRISPDKLCQVLEQ  288

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
              VL +P G K +R VIH+QISD+DVQYAL+ V++A   +  GS
Sbjct  289  RNVLAMPAGSKSMRLVIHYQISDSDVQYALTCVEKAAEEILTGS  332



>ref|NP_001053314.1| Os04g0516600 [Oryza sativa Japonica Group]
 emb|CAD41482.2| OSJNBb0072M01.18 [Oryza sativa Japonica Group]
 dbj|BAF15228.1| Os04g0516600 [Oryza sativa Japonica Group]
 emb|CAH67219.1| OSIGBa0145M07.1 [Oryza sativa Indica Group]
 dbj|BAG94039.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87066.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77644.1| hypothetical protein OsI_16646 [Oryza sativa Indica Group]
 gb|EEE61341.1| hypothetical protein OsJ_15466 [Oryza sativa Japonica Group]
Length=372

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 127/164 (77%), Gaps = 1/164 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVC+SKGLGAPVGSVIVG  +FI++A+I+RKTLGGGMRQ+G+LCAAA V  
Sbjct  193  RLVKAADSVSVCISKGLGAPVGSVIVGSTAFIEKAKILRKTLGGGMRQVGILCAAAYVAV  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ VGKL  DH++AK LA+GL KI    VD  SVETN+VF DI+ ++  +  +LC+ L +
Sbjct  253  RDTVGKLADDHRRAKVLADGLKKIKHFRVDTTSVETNMVFFDIV-DSRISPDKLCQVLEQ  311

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
              VL +P G K +R VIH+QISD+DVQYAL+ V++A   +  GS
Sbjct  312  RNVLAMPAGSKSMRLVIHYQISDSDVQYALTCVEKAAEEILTGS  355



>ref|XP_008667492.1| PREDICTED: putative threonine aldolase family protein isoform 
X2 [Zea mays]
Length=360

 Score =   196 bits (498),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 122/154 (79%), Gaps = 1/154 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVGSVIVG K+FID+ARI+RKTLGGGMRQ+GVLCAAA V  
Sbjct  191  RLVKAADSVSVCLSKGLGAPVGSVIVGSKAFIDKARILRKTLGGGMRQVGVLCAAAHVAV  250

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ VGKL  DH+KAK LAEGL KI  + VD ASVETN+VF +++ +   +  +LC+ L +
Sbjct  251  RDTVGKLADDHRKAKALAEGLKKIEQITVDSASVETNMVFFEVM-DPRISPDKLCQVLEQ  309

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  219
              VL LP   K IRFVIH+QISD DV YAL+ V+
Sbjct  310  DNVLALPANSKSIRFVIHYQISDADVGYALACVE  343



>ref|XP_007030423.1| L-allo-threonine aldolase isoform 4 [Theobroma cacao]
 ref|XP_007030426.1| L-allo-threonine aldolase isoform 4 [Theobroma cacao]
 gb|EOY10925.1| L-allo-threonine aldolase isoform 4 [Theobroma cacao]
 gb|EOY10928.1| L-allo-threonine aldolase isoform 4 [Theobroma cacao]
Length=359

 Score =   196 bits (498),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADS+SVCLSKGLGAPVGSVIVG KSFI +AR +RKTLGGGMRQ+G +CAAA V  
Sbjct  193  RLVQAADSISVCLSKGLGAPVGSVIVGSKSFITKARRLRKTLGGGMRQVGFICAAAFVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QENVGKLEGDHKKAK LAEGLN+I GL VD+A+V+TNI++ DI++ +  T  +L K L E
Sbjct  253  QENVGKLEGDHKKAKVLAEGLNQIKGLRVDVAAVQTNIIYFDIVEGSKLTAEKLYKNLEE  312

Query  320  HGVLILPEGPKR  285
            HGVL++PEGP R
Sbjct  313  HGVLVMPEGPAR  324



>gb|AAM63785.1| unknown [Arabidopsis thaliana]
Length=358

 Score =   196 bits (498),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            +LV+AADSV VCLSKGLGAPVGSVIVG +SFI++A+ +RKTLGGGMRQIGVLCAAALV  
Sbjct  193  KLVKAADSVQVCLSKGLGAPVGSVIVGSQSFIEKAKTVRKTLGGGMRQIGVLCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KL+ DHKKAK LAEGLN++ G+ V++A+VETN++F D+   +  T  +L K L E
Sbjct  253  QENLPKLQHDHKKAKLLAEGLNQMKGIRVNVAAVETNMIFMDMEDGSRLTAEKLRKNLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            +G+L++     RIR VIHHQI+ +DV Y LS  Q+A+
Sbjct  313  NGILLIRGKSSRIRIVIHHQITTSDVHYTLSXFQQAM  349



>ref|XP_004142582.1| PREDICTED: L-allo-threonine aldolase-like [Cucumis sativus]
Length=365

 Score =   196 bits (498),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVGSVIVG KSFI +AR +RKTLGGGMRQIG+LCAA LV  
Sbjct  194  RLVQAADSVSVCLSKGLGAPVGSVIVGSKSFISKARRVRKTLGGGMRQIGILCAAGLVAI  253

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENV KLE DH KAK LA GL +I GL+V+  SVETNI+F +I +++  +   LC+ + E
Sbjct  254  KENVQKLEADHHKAKQLASGLCQIKGLKVNPKSVETNIIFFEIEEDSQISAKLLCESMKE  313

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYAL  231
             G+L++ E   RIR V+HHQIS +DVQY L
Sbjct  314  RGILLMQESLSRIRIVVHHQISTSDVQYTL  343



>ref|XP_006588445.1| PREDICTED: uncharacterized protein LOC100790890 isoform X1 [Glycine 
max]
 gb|KHN14818.1| L-allo-threonine aldolase [Glycine soja]
Length=360

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 131/168 (78%), Gaps = 2/168 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKG+GAPVGSVIVG K+FI +AR +RKTLGGGMRQIG+LCAAALV  
Sbjct  193  RLVQAADSVSVCLSKGIGAPVGSVIVGSKNFIAKARRLRKTLGGGMRQIGLLCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QENVGKLE DHKKA+ LA+GL ++ GL VD  SVETN+VF DI +   T   ++CK + E
Sbjct  253  QENVGKLESDHKKARLLADGLKEVKGLRVDAGSVETNMVFIDIEEGTKTRAEKICKYMEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQR--AVTGVANGSGD  183
             G+L++ E   R+R V+HHQIS +DVQYALS  Q+  AV GV N  G+
Sbjct  313  RGILVMQESSSRMRVVLHHQISASDVQYALSCFQQALAVKGVQNEMGN  360



>ref|NP_563822.1| threonine aldolase [Arabidopsis thaliana]
 ref|NP_849614.1| threonine aldolase [Arabidopsis thaliana]
 ref|NP_849615.1| threonine aldolase [Arabidopsis thaliana]
 ref|NP_001031001.2| threonine aldolase [Arabidopsis thaliana]
 sp|Q8RXU4.1|THA1_ARATH RecName: Full=Probable low-specificity L-threonine aldolase 1; 
AltName: Full=Threonine aldolase 1 [Arabidopsis thaliana]
 gb|AAL86346.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51302.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01898.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28320.1| threonine aldolase [Arabidopsis thaliana]
 gb|AEE28321.1| threonine aldolase [Arabidopsis thaliana]
 gb|AEE28322.1| threonine aldolase [Arabidopsis thaliana]
 gb|AEE28323.1| threonine aldolase [Arabidopsis thaliana]
Length=358

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            +LV+AADSV VCLSKGLGAPVGSVIVG +SFI++A+ +RKTLGGGMRQIGVLCAAALV  
Sbjct  193  KLVKAADSVQVCLSKGLGAPVGSVIVGSQSFIEKAKTVRKTLGGGMRQIGVLCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KL+ DHKKAK LAEGLN++ G+ V++A+VETN++F D+   +  T  +L K L E
Sbjct  253  QENLPKLQHDHKKAKLLAEGLNQMKGIRVNVAAVETNMIFMDMEDGSRLTAEKLRKNLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            +G+L++     RIR VIHHQI+ +DV Y LS  Q+A+
Sbjct  313  NGILLIRGNSSRIRIVIHHQITTSDVHYTLSCFQQAM  349



>ref|XP_006652519.1| PREDICTED: uncharacterized protein R102.4-like [Oryza brachyantha]
Length=372

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 125/164 (76%), Gaps = 1/164 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVC+SKGLGAPVGSVIVG  +FID+A+I+RKTLGGGMRQ+G+LCAAA V  
Sbjct  193  RLVQAADSVSVCISKGLGAPVGSVIVGSTAFIDKAKILRKTLGGGMRQVGILCAAAYVAV  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ VGKL  DH++AK LA+GL KI    VD  SVETN+VF DI+ ++  +  +LC+ L  
Sbjct  253  RDTVGKLADDHRRAKVLADGLKKIKHFRVDSTSVETNMVFFDIV-DSRISPNKLCQILEH  311

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
              VL +P   K +R V+H+QISD+DVQYAL+ +++A   +  GS
Sbjct  312  RNVLAMPASSKSMRLVVHYQISDSDVQYALACLEKAAEEILTGS  355



>gb|EMS67121.1| L-allo-threonine aldolase [Triticum urartu]
Length=367

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVS+CLSKG+GAPVGSVIVG K+FI +A+I+RKTLGGGMRQ+GVLCAAA VG 
Sbjct  193  RLVRAADSVSICLSKGIGAPVGSVIVGTKAFIHKAKILRKTLGGGMRQVGVLCAAAEVGV  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ VGKL  DH+KAK LA+GL KI    VD++SVETN+VF D + +   +  +LC+ L +
Sbjct  253  RDTVGKLADDHRKAKVLADGLKKIKQFTVDLSSVETNMVFFD-MADPRISPAKLCQALKQ  311

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
              VL +P   K +RFV+H+QISD+D+QY L  ++ AV
Sbjct  312  RNVLAMPTSSKSVRFVVHYQISDSDIQYTLKCIEEAV  348



>ref|XP_009389078.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Musa 
acuminata subsp. malaccensis]
Length=359

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVGSVIVG K FI +AR +RKTLGGGMRQIGVLCAAA V  
Sbjct  193  RLVRAADSVSVCLSKGLGAPVGSVIVGTKDFITKARRLRKTLGGGMRQIGVLCAAAYVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            Q+NV KLE DH+KAK  A+GL +I  L VD +SVETN+VF +I + +  + + LC+ L +
Sbjct  253  QDNVVKLEDDHRKAKIFADGLKEIKQLRVDSSSVETNMVFFNINESSMISPISLCEALEK  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
             GVL +P     +R VIH+QIS++DV YAL+ +++A+
Sbjct  313  FGVLAMPASSTSVRVVIHYQISESDVHYALTSIKQAI  349



>gb|AAF63783.1| L-allo-threonine aldolase, putative [Arabidopsis thaliana]
Length=370

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 116/151 (77%), Gaps = 6/151 (4%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            R+VQAADSVS+CLSKG+GAPVGSVIVG K FI +AR +RKTLGGGMRQIGVLCAAALV  
Sbjct  197  RIVQAADSVSICLSKGIGAPVGSVIVGSKKFITKARWLRKTLGGGMRQIGVLCAAALVAL  256

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             ENV KLE DHKKA+ LAEGLN+I  L V++A+VETNIV      E      E CK L +
Sbjct  257  HENVAKLEDDHKKARVLAEGLNRIERLRVNVAAVETNIVNPKFGAE------EACKSLED  310

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALS  228
             GVL++P+   RIR V+HHQISD DV+Y LS
Sbjct  311  VGVLVIPQATFRIRIVLHHQISDVDVEYVLS  341



>ref|XP_002892465.1| hypothetical protein ARALYDRAFT_470930 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68724.1| hypothetical protein ARALYDRAFT_470930 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 126/164 (77%), Gaps = 0/164 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            +LV+AADSV VCLSKGLGAPVGSVIVG +SFI++A+ +RKTLGGGMRQIGVLCAAALV  
Sbjct  193  KLVKAADSVQVCLSKGLGAPVGSVIVGSQSFIEKAKTVRKTLGGGMRQIGVLCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             EN+ KL+ DHKKAK LAEGLN++ G+ V++A+VETN++F D+   +  T  +L K L E
Sbjct  253  HENLPKLQHDHKKAKLLAEGLNQMKGIRVNVAAVETNMIFMDMEDGSRLTAEKLRKSLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
            +G+L++     RIR VIHHQI+ +DV Y LS  Q+A+  +   S
Sbjct  313  NGILLIRGNSSRIRMVIHHQITTSDVHYTLSCFQQAMQTIQEPS  356



>emb|CDY54493.1| BnaCnng27100D [Brassica napus]
Length=315

 Score =   192 bits (487),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 124/156 (79%), Gaps = 1/156 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVG+VIVG  +FI++A+ +RKTLGGGMRQIGVLCAAALV  
Sbjct  151  RLVEAADSVSVCLSKGLGAPVGTVIVGSHTFIEKAKTLRKTLGGGMRQIGVLCAAALVAL  210

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KL+ DHKKAK LAEGLN++ G+ +++A+VETN++F D+   +  T  +L K L E
Sbjct  211  QENLPKLQFDHKKAKLLAEGLNQMKGIRINVAAVETNMIFMDMEDGSKLTAEKLRKSLTE  270

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRA  213
             G+L+LP    RIR VI+H I+ +DV Y LS +Q+A
Sbjct  271  CGILVLPGNSSRIRMVIYHHIT-SDVHYTLSCLQQA  305



>ref|NP_001242307.1| uncharacterized protein LOC100790890 [Glycine max]
 gb|ACU17690.1| unknown [Glycine max]
Length=360

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 130/168 (77%), Gaps = 2/168 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSK +GAPVGSVIVG K+FI +AR +RKTLGGGMRQIG+LCAAALV  
Sbjct  193  RLVQAADSVSVCLSKSIGAPVGSVIVGSKNFIAKARRLRKTLGGGMRQIGLLCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QENVGKLE DHKKA+ LA+GL ++ GL VD  SVETN+VF DI +   T   ++CK + E
Sbjct  253  QENVGKLESDHKKARLLADGLKEVKGLRVDAGSVETNMVFIDIEEGTKTRAEKICKYMEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQR--AVTGVANGSGD  183
             G+L++ E   R+R V+HHQIS +DVQYALS  Q+  AV GV N  G+
Sbjct  313  RGILVMQESSSRMRVVLHHQISASDVQYALSCFQQALAVKGVQNEMGN  360



>ref|XP_006857300.1| hypothetical protein AMTR_s00067p00056150 [Amborella trichopoda]
 gb|ERN18767.1| hypothetical protein AMTR_s00067p00056150 [Amborella trichopoda]
Length=358

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 124/158 (78%), Gaps = 1/158 (1%)
 Frame = -3

Query  683  SRLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVG  504
            +RLVQAADSVSVCLSKGLGAPVGSVI+G K+FI +A+ +RKTLGG MRQ+G+LCAAALV 
Sbjct  192  ARLVQAADSVSVCLSKGLGAPVGSVIIGSKNFITKAKRLRKTLGGAMRQVGILCAAALVA  251

Query  503  FQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
             ++ V KLE DH+KAK LA+GLN + GL+VD+ASVETN+VF +I  +  T E +  + L 
Sbjct  252  LRDIVPKLEEDHQKAKILADGLNHVKGLKVDLASVETNLVFFEITDKRVTAE-KFSQVLN  310

Query  323  EHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            + G+L+LP     IR V+HHQIS +DVQY LS + +AV
Sbjct  311  DRGILVLPISSCSIRIVLHHQISFSDVQYTLSYITQAV  348



>ref|XP_004155692.1| PREDICTED: L-allo-threonine aldolase-like [Cucumis sativus]
Length=358

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 120/167 (72%), Gaps = 2/167 (1%)
 Frame = -3

Query  683  SRLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVG  504
             RLVQAADS+ VCLSKGLGAPVGS+IVG K FI +AR +RKTLGGGMRQIG+LCAA LV 
Sbjct  192  DRLVQAADSILVCLSKGLGAPVGSIIVGSKDFIAKARRVRKTLGGGMRQIGILCAAGLVA  251

Query  503  FQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
             +ENV KLE DHKKAK LA GL +I GL++D  SVETNI+  +I  +   +   LCK L 
Sbjct  252  IKENVQKLEADHKKAKQLASGLFQIKGLKIDPKSVETNIILFEIEDDYGISMETLCKSLE  311

Query  323  EHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG--VANGS  189
            E G+ ++ +   R R V HHQIS +DVQY LS  Q+ + G  V NG+
Sbjct  312  ERGIFVMLQTQTRARIVFHHQISTSDVQYILSCFQQTLNGIKVVNGN  358



>ref|XP_008453666.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Cucumis melo]
Length=400

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 122/166 (73%), Gaps = 2/166 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVGS+I+G K FI +A  +RKTLGGGMRQIG+LCAA LV  
Sbjct  235  RLVRAADSVSVCLSKGLGAPVGSIILGSKDFITKAIRIRKTLGGGMRQIGILCAAGLVAI  294

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENV KLE DH+KAK LA GL +I GL+VD  SVETNI+F +I  +   +   LCK L E
Sbjct  295  KENVQKLEADHEKAKQLASGLYQIKGLKVDPKSVETNIIFFEIEDDYGISMETLCKTLEE  354

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG--VANGS  189
             G+ ++ E   R R V+HHQIS +DVQY LS  ++ + G  V NG+
Sbjct  355  RGIFMMLESQTRARIVLHHQISTSDVQYTLSCFKQTLNGIKVVNGN  400



>dbj|BAJ93201.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score =   191 bits (484),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            LV+AADSVSVCLSKG+GAPVGSVIVG K+FI++ +I+RKTLGGGMRQ+GVLCAAA VG +
Sbjct  194  LVRAADSVSVCLSKGIGAPVGSVIVGSKAFINKTKILRKTLGGGMRQVGVLCAAAEVGVR  253

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            + +GKL  DH+KAK LA+GL KI    VD+ SVETN+VF   + +   T  +LCK L + 
Sbjct  254  DTIGKLTDDHRKAKVLADGLKKIEQFTVDLTSVETNMVFFH-MADPRITPAKLCKVLEQR  312

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
             VL +P   K +R V+H+QISD+DVQY L+ +++AV
Sbjct  313  NVLAMPTSSKSVRLVVHYQISDSDVQYTLTCIEKAV  348



>gb|KHG00003.1| ltaA [Gossypium arboreum]
Length=326

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -3

Query  683  SRLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVG  504
            +RLVQAADSVSVCLSKGLGAPVGSVIVG KSFI +AR +RKTLGGGMRQ+G +CAAA V 
Sbjct  192  NRLVQAADSVSVCLSKGLGAPVGSVIVGSKSFISKARRLRKTLGGGMRQLGFICAAAFVA  251

Query  503  FQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
             +ENV KLEGDHKKAK LAEGLN+I GL V++A+VETNI+F DI++ +  T  +L K+L 
Sbjct  252  LKENVAKLEGDHKKAKVLAEGLNQIKGLRVNVAAVETNIIFFDIVEGSKITAEKLYKKLE  311

Query  323  EHGVLILPEGP  291
            EHGVL++ EGP
Sbjct  312  EHGVLVMLEGP  322



>gb|KHG00004.1| ltaA [Gossypium arboreum]
Length=362

 Score =   188 bits (478),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -3

Query  683  SRLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVG  504
            +RLVQAADSVSVCLSKGLGAPVGSVIVG KSFI +AR +RKTLGGGMRQ+G +CAAA V 
Sbjct  228  NRLVQAADSVSVCLSKGLGAPVGSVIVGSKSFISKARRLRKTLGGGMRQLGFICAAAFVA  287

Query  503  FQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
             +ENV KLEGDHKKAK LAEGLN+I GL V++A+VETNI+F DI++ +  T  +L K+L 
Sbjct  288  LKENVAKLEGDHKKAKVLAEGLNQIKGLRVNVAAVETNIIFFDIVEGSKITAEKLYKKLE  347

Query  323  EHGVLILPEGP  291
            EHGVL++ EGP
Sbjct  348  EHGVLVMLEGP  358



>ref|XP_010906814.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Elaeis guineensis]
 ref|XP_010906816.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Elaeis guineensis]
Length=359

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 115/157 (73%), Gaps = 0/157 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RL+QAADS  +CLSKGLGAPVGSVIVG K FI +A+ +RKTLGGGMRQ+GVLCAAA V  
Sbjct  193  RLLQAADSALLCLSKGLGAPVGSVIVGSKDFIAKAKRLRKTLGGGMRQVGVLCAAAYVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+GKLE DH+KAK  A+GL +I  L +D  SVETN++F  I   +  +   LC+ L  
Sbjct  253  QENIGKLEDDHRKAKIFADGLKQIKELSIDATSVETNMIFFSIADSSLISPKRLCQVLEV  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            HG+L +P     +R V+H+QIS+ DV YAL+ ++ AV
Sbjct  313  HGILAMPASSTSVRLVLHYQISENDVYYALTCIKHAV  349



>ref|XP_004976228.1| PREDICTED: uncharacterized protein R102.4-like isoform X2 [Setaria 
italica]
Length=372

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 129/164 (79%), Gaps = 1/164 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVGSVIVG ++FID+A+I+RKTLGGGMRQIGV+CAAA V  
Sbjct  193  RLVKAADSVSVCLSKGLGAPVGSVIVGSQAFIDKAKILRKTLGGGMRQIGVVCAAAYVAV  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ VGKL  DH+KAK LAEGL KI   +VD ASVETN+VF DI+ +   +   LC+ L +
Sbjct  253  RDTVGKLADDHRKAKALAEGLKKIKQFKVDSASVETNMVFFDIM-DPRISPDRLCQVLEQ  311

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
              VL +P   K +RFV+H+QISD+DV+YAL+ V++AV  +  GS
Sbjct  312  RNVLAMPASSKSMRFVLHYQISDSDVKYALTCVEKAVEELLKGS  355



>ref|XP_008802138.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Phoenix 
dactylifera]
Length=359

 Score =   185 bits (470),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 121/167 (72%), Gaps = 1/167 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RL+QAADS  +CLSKGLGAPVGSVIVG K+FI +A+ +RKTLGGGMRQ+GVLCAAA V  
Sbjct  193  RLLQAADSALLCLSKGLGAPVGSVIVGSKAFIAKAKRLRKTLGGGMRQVGVLCAAAYVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KLE DH+KAK  A+GL +I  L +D  SVETN++F  I+  +  +   LC+ L E
Sbjct  253  QENIRKLEDDHRKAKIFADGLKQIKELSIDATSVETNMIFFSIVDSSLMSPKRLCQVLEE  312

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG-VANGSGD  183
             G+L +P     +R V+H+QIS+ DV YAL+ +++ V   V NG+ +
Sbjct  313  RGILAMPASSTSVRLVLHYQISENDVYYALTCIKQLVQQMVTNGTAE  359



>gb|AAF99780.1|AC003981_30 F22O13.11 [Arabidopsis thaliana]
Length=352

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 121/157 (77%), Gaps = 6/157 (4%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            +LV+AADSV VCLSKGLGAPVGSVIVG +SFI++A+ +RKTLGGGMRQIGVLCAAALV  
Sbjct  193  KLVKAADSVQVCLSKGLGAPVGSVIVGSQSFIEKAKTVRKTLGGGMRQIGVLCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KL+ DHKKAK LAEGLN++ G+ V++A+VETN      +  +  T  +L K L E
Sbjct  253  QENLPKLQHDHKKAKLLAEGLNQMKGIRVNVAAVETN------MDGSRLTAEKLRKNLEE  306

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            +G+L++     RIR VIHHQI+ +DV Y LS  Q+A+
Sbjct  307  NGILLIRGNSSRIRIVIHHQITTSDVHYTLSCFQQAM  343



>gb|KJB44863.1| hypothetical protein B456_007G276400 [Gossypium raimondii]
Length=339

 Score =   182 bits (461),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 112/140 (80%), Gaps = 5/140 (4%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVGSVIVG KSFI +AR +RKTLGGGMRQ+G +CAAA V  
Sbjct  193  RLVQAADSVSVCLSKGLGAPVGSVIVGSKSFITKARRLRKTLGGGMRQVGFICAAAFVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNI-----VFCDILKEANTTEMELC  336
            +ENV KL+GDHKKAK LAEGLN+I GL+VD+A+VETNI     ++ DI++ +  T  +L 
Sbjct  253  KENVEKLDGDHKKAKELAEGLNQIKGLKVDIAAVETNIALFQQIYVDIVEGSKITAEKLY  312

Query  335  KRLAEHGVLILPEGPKRIRF  276
            K L EHGVL++P+G  R  F
Sbjct  313  KNLEEHGVLVMPKGLSRSVF  332



>gb|EPS60604.1| hypothetical protein M569_14199, partial [Genlisea aurea]
Length=322

 Score =   181 bits (460),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSV+ CLSKGLGAP G++I G K+FI +ARI+RKTLGGGMRQ+GVLCAAAL+  
Sbjct  193  RLVQAADSVTACLSKGLGAPAGTMIAGSKAFIHKARILRKTLGGGMRQVGVLCAAALIAV  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             ENV KLE DHKKAK LAEGLNKI GL VD+ASVETNIVF D+L+++  T+ +L K L  
Sbjct  253  DENVDKLESDHKKAKILAEGLNKIKGLHVDLASVETNIVFFDVLEDSCITKDDLLKSLEA  312

Query  320  HGVLILPEGP  291
            +GV  + EGP
Sbjct  313  YGVYAMSEGP  322



>gb|ABR18450.1| unknown [Picea sitchensis]
Length=379

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 111/151 (74%), Gaps = 0/151 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV AADSVSVCLSKGLGAPVGSVIVG + FI +A+ +RKTLGGGMRQ+GVLCAA LV  
Sbjct  209  RLVSAADSVSVCLSKGLGAPVGSVIVGSQEFIAKAKKLRKTLGGGMRQVGVLCAAGLVAL  268

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             + VG+L+ DH K + LAEGLN I GL V++ +V TNIVF +I  ++     ELC+ +  
Sbjct  269  HDMVGRLKDDHHKCRILAEGLNGIDGLHVNLDAVHTNIVFVNITADSIPGAEELCEAMKH  328

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALS  228
             GVL +P    R RFV HHQIS+ D++Y L+
Sbjct  329  EGVLAIPMSHTRFRFVTHHQISEDDIRYTLA  359



>ref|XP_004976227.1| PREDICTED: uncharacterized protein R102.4-like isoform X1 [Setaria 
italica]
Length=374

 Score =   181 bits (458),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 123/154 (80%), Gaps = 1/154 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVGSVIVG ++FID+A+I+RKTLGGGMRQIGV+CAAA V  
Sbjct  193  RLVKAADSVSVCLSKGLGAPVGSVIVGSQAFIDKAKILRKTLGGGMRQIGVVCAAAYVAV  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ VGKL  DH+KAK LAEGL KI   +VD ASVETN+VF DI+ +   +   LC+ L +
Sbjct  253  RDTVGKLADDHRKAKALAEGLKKIKQFKVDSASVETNMVFFDIM-DPRISPDRLCQVLEQ  311

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  219
              VL +P   K +RFV+H+QISD+DV+YAL+ V+
Sbjct  312  RNVLAMPASSKSMRFVLHYQISDSDVKYALTCVE  345



>ref|XP_010520652.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Tarenaya 
hassleriana]
Length=349

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 110/138 (80%), Gaps = 2/138 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            R+VQAADSVS+CLSKG+GAPVGSVIVG KSFI +AR +RKTLGGGMRQIGV+CAAAL+  
Sbjct  211  RIVQAADSVSICLSKGIGAPVGSVIVGTKSFIAKARWLRKTLGGGMRQIGVICAAALMAL  270

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             EN+ KLEGDHKKAK LAEGLN+I  + VD+A+VETNI++ DI ++   T  + CK L  
Sbjct  271  HENLPKLEGDHKKAKFLAEGLNRIDRVRVDVAAVETNIIYIDIPEDPKFTAEDACKSLEH  330

Query  320  HGVLILPEGPKRIRFVIH  267
             GV ++P+   + R+VI+
Sbjct  331  VGVHVIPQ--SKFRYVIY  346



>ref|XP_008453667.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Cucumis melo]
Length=392

 Score =   176 bits (446),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 112/156 (72%), Gaps = 2/156 (1%)
 Frame = -3

Query  650  VCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGD  471
            VCLSKGLGAPVGS+I+G K FI +A  +RKTLGGGMRQIG+LCAA LV  +ENV KLE D
Sbjct  237  VCLSKGLGAPVGSIILGSKDFITKAIRIRKTLGGGMRQIGILCAAGLVAIKENVQKLEAD  296

Query  470  HKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGP  291
            H+KAK LA GL +I GL+VD  SVETNI+F +I  +   +   LCK L E G+ ++ E  
Sbjct  297  HEKAKQLASGLYQIKGLKVDPKSVETNIIFFEIEDDYGISMETLCKTLEERGIFMMLESQ  356

Query  290  KRIRFVIHHQISDTDVQYALSRVQRAVTG--VANGS  189
             R R V+HHQIS +DVQY LS  ++ + G  V NG+
Sbjct  357  TRARIVLHHQISTSDVQYTLSCFKQTLNGIKVVNGN  392



>ref|XP_008802141.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Phoenix dactylifera]
Length=333

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVC+SKGLGAP+GSVIVG   FI +AR +RKTLGGGMRQ+GVLCAAA V  
Sbjct  193  RLVQAADSVSVCMSKGLGAPIGSVIVGSSEFITKARRLRKTLGGGMRQVGVLCAAAYVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++NVGKLE DHKKAK  A+GL +I  L VD +SVETN+VF DI++ ++ +   LC+ L E
Sbjct  253  RDNVGKLEDDHKKAKLFADGLKQIKELTVDTSSVETNMVFLDIVESSHISPERLCQVLEE  312

Query  320  HGVLILPEGPKR  285
            HGVL +P    R
Sbjct  313  HGVLAMPASSTR  324



>ref|XP_004976226.1| PREDICTED: uncharacterized protein R102.4-like [Setaria italica]
Length=321

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 104/132 (79%), Gaps = 1/132 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVGSVIVG K+FID+ARI+RKTLGGGMRQ+GVLCAAA V  
Sbjct  191  RLVKAADSVSVCLSKGLGAPVGSVIVGSKAFIDKARILRKTLGGGMRQVGVLCAAAQVAV  250

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ +GKLE DH+KAK LAEGL KI  + VD ASVETN+VF DI     + +  LC+ L +
Sbjct  251  RDTLGKLEDDHRKAKALAEGLKKIKHITVDPASVETNMVFFDITNPRISPD-NLCQVLEQ  309

Query  320  HGVLILPEGPKR  285
            H VL +P   KR
Sbjct  310  HNVLAMPASSKR  321



>ref|NP_001077492.1| threonine aldolase [Arabidopsis thaliana]
 dbj|BAH19728.1| AT1G08630 [Arabidopsis thaliana]
 gb|AEE28324.1| threonine aldolase [Arabidopsis thaliana]
Length=344

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 113/157 (72%), Gaps = 14/157 (9%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            +LV+AADSV VCLSKGLGAPVGSVIVG +SFI++A+ +RKTLGGGMRQIGVLCAAALV  
Sbjct  193  KLVKAADSVQVCLSKGLGAPVGSVIVGSQSFIEKAKTVRKTLGGGMRQIGVLCAAALVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KL+ DHKKAK L              A+VETN++F D+   +  T  +L K L E
Sbjct  253  QENLPKLQHDHKKAKLL--------------AAVETNMIFMDMEDGSRLTAEKLRKNLEE  298

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            +G+L++     RIR VIHHQI+ +DV Y LS  Q+A+
Sbjct  299  NGILLIRGNSSRIRIVIHHQITTSDVHYTLSCFQQAM  335



>dbj|BAK01917.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=339

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVGSVIVG K+FID+ARI+RKTLGGGMRQ+GVLCAAA V  
Sbjct  195  RLVRAADSVSVCLSKGLGAPVGSVIVGSKAFIDQARILRKTLGGGMRQVGVLCAAAYVAV  254

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++NVGKL  DH+KAK LA+GL KI    VD+ SVETN+VF DI  +   T  +LC+ L  
Sbjct  255  RDNVGKLADDHRKAKVLADGLKKIKQFTVDLTSVETNMVFFDI-ADPRITSDKLCQLLER  313

Query  320  HGVLILPEGPKRIRFV  273
              VL +P   KR   V
Sbjct  314  RNVLAMPGTSKRFNSV  329



>ref|NP_001140767.1| putative threonine aldolase family protein [Zea mays]
 gb|ACF84582.1| unknown [Zea mays]
 tpg|DAA36967.1| TPA: putative threonine aldolase family protein [Zea mays]
Length=321

 Score =   166 bits (420),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 104/132 (79%), Gaps = 1/132 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVGSVIVG K+FID+ARI+RKTLGGGMRQ+GVLCAAA V  
Sbjct  191  RLVKAADSVSVCLSKGLGAPVGSVIVGSKAFIDKARILRKTLGGGMRQVGVLCAAAHVAV  250

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ VGKL  DH+KAK LAEGL KI  + VD ASVETN+VF +++ +   +  +LC+ L +
Sbjct  251  RDTVGKLADDHRKAKALAEGLKKIEQITVDSASVETNMVFFEVM-DPRISPDKLCQVLEQ  309

Query  320  HGVLILPEGPKR  285
              VL LP   KR
Sbjct  310  DNVLALPANSKR  321



>gb|KGN66765.1| hypothetical protein Csa_1G680120 [Cucumis sativus]
Length=331

 Score =   166 bits (420),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVGSVIVG KSFI +AR +RKTLGGGMRQIG+LCAA LV  
Sbjct  194  RLVQAADSVSVCLSKGLGAPVGSVIVGSKSFISKARRVRKTLGGGMRQIGILCAAGLVAI  253

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENV KLE DH KAK LA GL +I GL+V+  SVETNI+F +I +++  +   LC+ + E
Sbjct  254  KENVQKLEADHHKAKQLASGLCQIKGLKVNPKSVETNIIFFEIEEDSQISAKLLCESMKE  313

Query  320  HGVLILPEGPKR  285
             G+L++ E   R
Sbjct  314  RGILLMQESLSR  325



>ref|XP_008675991.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Zea 
mays]
Length=161

 Score =   161 bits (407),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 102/127 (80%), Gaps = 1/127 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSV VCLSKGLGAPVGSVIVG K+FID+ARI+RKTLGGG+RQ+GVLCAAA V  
Sbjct  26   RLVKAADSVLVCLSKGLGAPVGSVIVGSKAFIDKARILRKTLGGGIRQVGVLCAAAHVVV  85

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ VGKL  DHKKAK LAEGL KI  + VD ASVETN+VF +++ +   +  +LC+ L +
Sbjct  86   RDTVGKLADDHKKAKALAEGLKKIEQITVDSASVETNMVFFEVM-DPRISPDKLCQVLEQ  144

Query  320  HGVLILP  300
            H VL +P
Sbjct  145  HNVLAMP  151



>ref|XP_008655946.1| PREDICTED: probable low-specificity L-threonine aldolase 2 isoform 
X3 [Zea mays]
Length=191

 Score =   162 bits (409),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 102/135 (76%), Gaps = 1/135 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAP+ SV+VG ++FID+ARI+RKTLGGGMRQ+G LCAAA V  
Sbjct  45   RLVKAADSVSVCLSKGLGAPIRSVVVGSEAFIDKARILRKTLGGGMRQVGFLCAAAYVAV  104

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ VGKL  DH+KAK LAEGL KI    VD +SVETN+VF DI+ + + +  +LC+ L +
Sbjct  105  RDTVGKLADDHRKAKALAEGLTKIKQFTVDSSSVETNMVFFDIV-DPHISPSKLCQVLEQ  163

Query  320  HGVLILPEGPKRIRF  276
              VL +P   K   F
Sbjct  164  RNVLAMPASSKSRYF  178



>ref|XP_004170415.1| PREDICTED: L-allo-threonine aldolase-like, partial [Cucumis sativus]
Length=326

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADSVSVCLSKGLGAPVGSVIVG KSFI +AR +RKTLGGGMRQIG+LCAA LV  
Sbjct  196  RLVQAADSVSVCLSKGLGAPVGSVIVGSKSFISKARRVRKTLGGGMRQIGILCAAGLVAI  255

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENV KLE DH KAK LA GL +I GL+V+  SVETNI+F +I +++  +   LC+ + E
Sbjct  256  KENVQKLEADHHKAKQLASGLCQIKGLKVNPKSVETNIIFFEIEEDSQISAKLLCESMKE  315

Query  320  HGVLILPE  297
             G+L++ E
Sbjct  316  RGILLMQE  323



>ref|XP_008657658.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Zea 
mays]
Length=210

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 101/127 (80%), Gaps = 1/127 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSV VCLSKGLGAPVGSVIVG K+FID+ARI+RKTLGGGMRQ+GVLCAAA V  
Sbjct  75   RLVKAADSVLVCLSKGLGAPVGSVIVGLKAFIDKARILRKTLGGGMRQVGVLCAAAHVAV  134

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ VGKL  DHK AK LAEGL KI  + VD ASVETN+VF +++ +   +  +LC+ L +
Sbjct  135  RDTVGKLADDHKNAKALAEGLKKIEQITVDSASVETNMVFFEVM-DPRISPDKLCQVLEQ  193

Query  320  HGVLILP  300
            H VL +P
Sbjct  194  HNVLAMP  200



>emb|CDY59150.1| BnaC08g13650D, partial [Brassica napus]
Length=447

 Score =   167 bits (422),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 108/140 (77%), Gaps = 2/140 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVG+V VG  +FI++A+ +RKTLGGGMRQIGVLCAAALV  
Sbjct  303  RLVEAADSVSVCLSKGLGAPVGTVFVGSHTFIEKAKTLRKTLGGGMRQIGVLCAAALVAL  362

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            QEN+ KL+ DH KAK LAEGLN+++G+ +++A+VETN++F D+   +  T  +L K L E
Sbjct  363  QENLPKLQFDHNKAKLLAEGLNQMTGIRINVAAVETNMIFMDMEDGSKLTAEKLRKSLTE  422

Query  320  HGVLILPEGPKRIRFVIHHQ  261
             G+L+LP      R+V H  
Sbjct  423  CGILVLPGNSS--RYVSHEH  440



>ref|XP_001768407.1| predicted protein [Physcomitrella patens]
 gb|EDQ66769.1| predicted protein [Physcomitrella patens]
Length=383

 Score =   165 bits (417),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 111/162 (69%), Gaps = 0/162 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGL  PVG+V+VG K FI +AR +RK LGGGMRQ+G+L AA LV  
Sbjct  202  RLVRAADSVSVCLSKGLATPVGTVLVGSKEFITKARRLRKALGGGMRQVGILAAAGLVAM  261

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ V +L  DH  AK +AEGLN + GL VDM+ VETNIV+ ++  ++  T  E+ +   E
Sbjct  262  RDMVDRLNVDHANAKLMAEGLNAVKGLRVDMSIVETNIVYAEVTDDSVLTPKEIVEAWKE  321

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVAN  195
            +GVL +  G   IR + H+QI++ DV +ALS  +      AN
Sbjct  322  YGVLAMTWGRNMIRVLTHYQITEDDVLFALSFFKTTSLQAAN  363



>ref|XP_007030425.1| Threonine aldolase 1 isoform 6 [Theobroma cacao]
 gb|EOY10927.1| Threonine aldolase 1 isoform 6 [Theobroma cacao]
Length=319

 Score =   163 bits (412),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADS+SVCLSKGLGAPVGSVIVG KSFI +AR +RKTLGGGMRQ+G +CAAA V  
Sbjct  193  RLVQAADSISVCLSKGLGAPVGSVIVGSKSFITKARRLRKTLGGGMRQVGFICAAAFVAL  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIV  384
            QENVGKLEGDHKKAK LAEGLN+I GL VD+A+V+TNIV
Sbjct  253  QENVGKLEGDHKKAKVLAEGLNQIKGLRVDVAAVQTNIV  291



>ref|XP_008453668.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X3 [Cucumis melo]
Length=382

 Score =   162 bits (410),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 109/153 (71%), Gaps = 5/153 (3%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVGS+I+G K FI +A  +RKTLGGGMRQIG+LCAA LV  
Sbjct  235  RLVRAADSVSVCLSKGLGAPVGSIILGSKDFITKAIRIRKTLGGGMRQIGILCAAGLVAI  294

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            +ENV KLE DH+KAK LA GL +I GL+VD  SVETNI+F +I  +   +   LCK L E
Sbjct  295  KENVQKLEADHEKAKQLASGLYQIKGLKVDPKSVETNIIFFEIEDDYGISMETLCKTLEE  354

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRV  222
             G+ ++ E   R +     Q+  + +  ALS++
Sbjct  355  RGIFMMLESQTRFQ-----QVMFSTLYLALSKL  382



>ref|XP_008671569.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Zea 
mays]
Length=257

 Score =   156 bits (395),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSV VCLSKGLGAPVGSVIVG K+ ID+ARI+RKTLGGGMR +GVLCAAA V  
Sbjct  36   RLVKAADSVLVCLSKGLGAPVGSVIVGSKASIDKARILRKTLGGGMRHVGVLCAAAHVAV  95

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ VGKL  DHKKAK LAEGL KI  + VD ASVETN+VF +++ +   +  +LC+ L +
Sbjct  96   RDTVGKLADDHKKAKALAEGLKKIEQITVDSASVETNMVFFEVM-DPRISPDKLCQVLEQ  154

Query  320  HGVL  309
            H VL
Sbjct  155  HNVL  158



>gb|AFK42511.1| unknown [Lotus japonicus]
Length=121

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -3

Query  545  MRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILK  366
            MRQ+G+LCAAALV  Q+ VG+LE DHKKA+TLA+GLN+I GL VD +SVETNIV+ +I +
Sbjct  1    MRQVGILCAAALVALQDIVGELESDHKKARTLADGLNQIKGLRVDTSSVETNIVYIEIKE  60

Query  365  EANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSG  186
             + TT  +L K L  +GVL++P G  +IR V HHQISD+DVQYALS  Q+AV GV N +G
Sbjct  61   GSGTTAAKLSKDLENYGVLLMPLGSSKIRVVFHHQISDSDVQYALSCFQQAVNGVGNENG  120

Query  185  D  183
            +
Sbjct  121  N  121



>ref|XP_008671685.1| PREDICTED: uncharacterized protein LOC103649121 [Zea mays]
Length=419

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 99/126 (79%), Gaps = 1/126 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSV VCLSKGLGAPVGSVIVG K+ ID+ARI+RKTLGGGMR +GVLCAAA V  
Sbjct  36   RLVKAADSVLVCLSKGLGAPVGSVIVGSKASIDKARILRKTLGGGMRHVGVLCAAAHVAV  95

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ VGKL  DHKKAK LAEGL KI  + VD ASVETN+VF +++ +   +  +LC+ L +
Sbjct  96   RDTVGKLADDHKKAKALAEGLKKIEQITVDSASVETNMVFFEVM-DPRISPDKLCQVLEQ  154

Query  320  HGVLIL  303
            H VL +
Sbjct  155  HNVLAM  160



>ref|XP_002973664.1| hypothetical protein SELMODRAFT_99781 [Selaginella moellendorffii]
 gb|EFJ25324.1| hypothetical protein SELMODRAFT_99781 [Selaginella moellendorffii]
Length=358

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 105/154 (68%), Gaps = 1/154 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AAD+VSVCLSKGL AP GSVIVG   FI++A+ +RK LGG MRQ+G+L A  LV  
Sbjct  198  RLVRAADTVSVCLSKGLAAPAGSVIVGSHEFIEKAKRLRKALGGAMRQVGILAAPGLVAL  257

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ V +L  DH  A+ LAEGL  + GL+VDM++VETNIV  D+ K   T E ELC+ + +
Sbjct  258  KDMVCRLYEDHSNARLLAEGLCGMKGLQVDMSAVETNIVNVDVTKSRFTAE-ELCRAMGK  316

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  219
             G+L        IR V H+ IS+ DV+Y L+  Q
Sbjct  317  IGILSYDLTKTSIRLVTHYHISEDDVRYTLACFQ  350



>ref|XP_008659428.1| PREDICTED: probable low-specificity L-threonine aldolase 2 isoform 
X1 [Zea mays]
Length=236

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVGSVIVG K+FID+ARI+RKTLGGGMRQ+GVLCAAA V  
Sbjct  130  RLVKAADSVSVCLSKGLGAPVGSVIVGSKAFIDKARILRKTLGGGMRQVGVLCAAAHVVV  189

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNI  387
            ++ VGKL  DH+KAK LAEGL KI  + VD+ASVETN+
Sbjct  190  RDTVGKLADDHRKAKALAEGLKKIEQITVDLASVETNM  227



>ref|XP_002975719.1| hypothetical protein SELMODRAFT_103881 [Selaginella moellendorffii]
 gb|EFJ23348.1| hypothetical protein SELMODRAFT_103881 [Selaginella moellendorffii]
Length=358

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 105/154 (68%), Gaps = 1/154 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AAD+VSVCLSKGL AP GSVIVG   FI++A+ +RK LGG MRQ+G+L A  LV  
Sbjct  198  RLVRAADTVSVCLSKGLAAPAGSVIVGSHEFIEKAKRLRKALGGAMRQVGILAAPGLVAL  257

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++ V +L  DH  A+ LAEGL  + GL+VDM++VETNIV  D+ K   T E ELC+ + +
Sbjct  258  KDMVCRLYEDHSNARLLAEGLCGMKGLQVDMSAVETNIVNVDVTKSRFTAE-ELCRAMGK  316

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  219
             G+L        IR V H+ IS+ DV+Y L+  Q
Sbjct  317  IGILSYDLTKTSIRLVTHYHISEDDVRYTLACFQ  350



>ref|XP_006442684.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442685.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442686.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442687.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55924.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55925.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55926.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55927.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
Length=297

 Score =   150 bits (378),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 86/100 (86%), Gaps = 1/100 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADS SVCLSKGLGAPVGSVIVG K FI +AR +RKTLGGGMRQ+GVLCAAALV  
Sbjct  193  RLVQAADSASVCLSKGLGAPVGSVIVGSKEFIKKARRLRKTLGGGMRQVGVLCAAALVAL  252

Query  500  QENV-GKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIV  384
            QENV   L+GDHKKAK LAEGLN++ GL VD+ +VETNIV
Sbjct  253  QENVLVMLDGDHKKAKLLAEGLNQLKGLRVDVDAVETNIV  292



>gb|AFW86293.1| putative threonine aldolase family protein [Zea mays]
Length=325

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSVCLSKGLGAPVGSVIVG K+FID+ARI+RKTLGGGMRQ+GVLCAAA V  
Sbjct  219  RLVKAADSVSVCLSKGLGAPVGSVIVGSKAFIDKARILRKTLGGGMRQVGVLCAAAHVVV  278

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNI  387
            ++ VGKL  DH+KAK LAEGL KI  + VD+ASVETN+
Sbjct  279  RDTVGKLADDHRKAKALAEGLKKIEQITVDLASVETNM  316



>ref|WP_020877756.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Desulfococcus multivorans]
 gb|EPR35940.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Desulfococcus multivorans DSM 2059]
Length=347

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 103/160 (64%), Gaps = 1/160 (1%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            L   ADS+S CLSKGL APVGS++ G + FI  AR  RK LGGGMRQ GV+ AA +V   
Sbjct  189  LAAPADSISFCLSKGLAAPVGSLLCGSREFIAEARRNRKVLGGGMRQAGVIAAAGIVALT  248

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            E V +L  DH  A+ LAEGL +I+G+ VD A V TNIV+ D+ +  +     L +R+   
Sbjct  249  EMVDRLPEDHANARKLAEGLAEIAGVAVDPAGVRTNIVYFDVTRP-DMDAQALARRMKAS  307

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVA  198
            GV +L  GP+RIR V H+Q+S  D++ ALS  +R + G A
Sbjct  308  GVALLAAGPRRIRAVTHYQVSAGDIEAALSAFRRVLAGDA  347



>ref|WP_011697570.1| threonine aldolase [Syntrophobacter fumaroxidans]
 gb|ABK16397.1| L-threonine aldolase [Syntrophobacter fumaroxidans MPOB]
Length=353

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 105/156 (67%), Gaps = 1/156 (1%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            L  AAD+V++CLSKGL APVGS++ G + FI RAR  RK +GGGMRQ G+L AA +V   
Sbjct  189  LSAAADTVTICLSKGLSAPVGSLVCGTRDFIARARRTRKVVGGGMRQAGILAAAGIVALD  248

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            E V +L  DH  A+ LAEGL+ ++GL VD+  V+TNIVF D+ +E + T   L  RL   
Sbjct  249  EMVTRLAEDHANARALAEGLSTMTGLSVDLEFVKTNIVFIDVERE-DLTAPVLAARLKPD  307

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            GVL+   GP+R+R V H+ +S  D+ + L+  ++A+
Sbjct  308  GVLVQVTGPRRMRAVTHYGVSAEDIDFTLTAFKKAM  343



>ref|WP_027408853.1| threonine aldolase [Anoxybacillus tepidamans]
Length=343

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 99/158 (63%), Gaps = 1/158 (1%)
 Frame = -3

Query  683  SRLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVG  504
            +   Q  D+V VCLSKGL APVGSV+ G KSFI  AR  RK LGGG+RQ GVL A  ++ 
Sbjct  186  TEFTQYVDTVQVCLSKGLSAPVGSVLAGSKSFIKEARKWRKRLGGGLRQAGVLAAPGIIA  245

Query  503  FQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
             ++ V +L  DH  A+ LAEGL  + GL VD+A VETNIV CDI K    +  E   RL 
Sbjct  246  LEKMVDRLAEDHANARQLAEGLAAVPGLHVDVAGVETNIVLCDI-KGTGLSNKEFLTRLK  304

Query  323  EHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            E G+L +P     IRFV H +++   VQ A+ R+++ V
Sbjct  305  EAGILAVPFDEGVIRFVTHREVTSDMVQTAIERIRQLV  342



>ref|XP_004151117.1| PREDICTED: L-allo-threonine aldolase-like, partial [Cucumis sativus]
Length=290

 Score =   144 bits (363),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLVQAADS+ VCLSKGLGAPVGS+IVG K FI +AR +RKTLGGGMRQIG+LCAA LV  
Sbjct  193  RLVQAADSILVCLSKGLGAPVGSIIVGSKDFIAKARRVRKTLGGGMRQIGILCAAGLVAI  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNI  387
            +ENV KLE DHKKAK LA GL +I GL++D  SVETNI
Sbjct  253  KENVQKLEADHKKAKQLASGLFQIKGLKIDPKSVETNI  290



>ref|XP_005854754.1| threonine aldolase, partial [Nannochloropsis gaditana CCMP526]
 gb|EKU21599.1| threonine aldolase, partial [Nannochloropsis gaditana CCMP526]
Length=283

 Score =   144 bits (362),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 105/154 (68%), Gaps = 0/154 (0%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            + + ADSV+VC+SKGLGAP GS++VG ++F ++AR +RK LGG MRQ+GVL AA LV  +
Sbjct  130  MTKHADSVTVCMSKGLGAPAGSLLVGSRAFTEKARKLRKALGGAMRQVGVLAAAGLVALK  189

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
              + +L  DH+ A+ LA+GL+ + GL+V++ +VETNIV  D       +  EL + L   
Sbjct  190  RTLPRLAEDHENARRLAKGLSTLPGLKVNVEAVETNIVMIDFEDRLPLSPPELLEELERR  249

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQR  216
             VL L  GP+RIR V H+ +S+ D++ A++  ++
Sbjct  250  NVLALAVGPRRIRMVTHYDVSEGDIKKAITVFEK  283



>ref|WP_027448368.1| threonine aldolase [Pontibacillus marinus]
 gb|KGX84447.1| threonine aldolase [Pontibacillus marinus BH030004 = DSM 16465]
Length=341

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 98/151 (65%), Gaps = 2/151 (1%)
 Frame = -3

Query  662  DSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGK  483
            D+V  CLSKGLGAPVGS++VGPKSFI RAR  RK LGGGMRQ GV+ A  LV   E V +
Sbjct  191  DTVQFCLSKGLGAPVGSILVGPKSFIKRARKWRKRLGGGMRQAGVIAAPGLVALNEMVDR  250

Query  482  LEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLIL  303
            LE DH+ AK LAE +N ISGLEV+   VETNIV  ++ KE          +L E GVL +
Sbjct  251  LEEDHEHAKNLAESVNSISGLEVE-GKVETNIVLINV-KETGMDAEAFLAKLKEQGVLAV  308

Query  302  PEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            P GP  IR V + ++S  D+     ++++ V
Sbjct  309  PFGPYTIRMVTNKEVSAEDLPEVKKQLEKCV  339



>gb|AIE93607.1| Beta-eliminating lyase superfamily protein (ltaE) [uncultured 
marine group II/III euryarchaeote AD1000_39_C05]
 gb|AIF05204.1| Beta-eliminating lyase superfamily protein (ltaE) [uncultured 
marine group II/III euryarchaeote KM3_181_A09]
Length=356

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 102/152 (67%), Gaps = 3/152 (2%)
 Frame = -3

Query  683  SRLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVG  504
            +R+V+  D+VS+CLSKGLGAP+GSV+VGP+SFID A   RK  GGGMRQ G+L AA L  
Sbjct  202  ARMVREYDTVSICLSKGLGAPIGSVLVGPRSFIDLAYRWRKMFGGGMRQAGILAAAGLYA  261

Query  503  FQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
              ++V +L  DH +A+ LA  +N++ G  VDM SV+TN+V+   +  AN    ++  +LA
Sbjct  262  LDQHVERLAEDHDRARRLAAAVNEMDGYAVDMNSVQTNMVY---ISTANGEAQKVVDQLA  318

Query  323  EHGVLILPEGPKRIRFVIHHQISDTDVQYALS  228
            EHGV  L      +R VIH  I+D D++ A++
Sbjct  319  EHGVDTLTIDDSTVRAVIHLHITDEDIERAIA  350



>ref|WP_037564212.1| threonine aldolase [Spirochaeta sp. JC202]
 gb|KGM38782.1| threonine aldolase [Spirochaeta sp. JC202]
Length=345

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 102/150 (68%), Gaps = 1/150 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            +L   ADS+S CLSKGLGAPVGSV+ G + FIDRAR  RK +GGGMRQ GVL AA +V  
Sbjct  188  KLAAEADSLSFCLSKGLGAPVGSVVCGSREFIDRARRARKVVGGGMRQAGVLAAAGIVAL  247

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             + V +L  DH  A+ LAEGL ++ GL +D+A +++NIVF +++++  T E +L + L +
Sbjct  248  NDMVDRLTEDHVNARKLAEGLAEMPGLAIDLARIKSNIVFFEVVRDDMTAE-QLVRMLDD  306

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYAL  231
             G  +LP G  RIR V H+ IS  ++ + L
Sbjct  307  QGARMLPVGVGRIRAVTHYHISSENIDHTL  336



>ref|WP_020265088.1| hypothetical protein [Atribacteria bacterium JGI 0000059-I14]
Length=348

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 105/156 (67%), Gaps = 1/156 (1%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            LV+ ADSV  CLSKGL APVGS++VG ++FI+RAR +RK LGGGMRQ GVL AA +V  +
Sbjct  187  LVKEADSVMFCLSKGLSAPVGSLLVGERTFIERARKIRKMLGGGMRQAGVLAAAGIVALE  246

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            + + +L  DH  A+ LAE L K+ GL++D+ +V+TN+V+CDI  +   + ++L + L   
Sbjct  247  KMINRLTEDHAHARYLAEELLKVKGLKIDLNTVQTNMVYCDI-SQLKASALQLTEWLKGE  305

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            G+L+ P  P +IR V H  I   D+  A+  ++  +
Sbjct  306  GLLVSPVPPDKIRLVTHRHICREDINKAVEIIKMVI  341



>ref|WP_009609982.1| threonine aldolase [Caldanaerobacter subterraneus]
 gb|EEB76295.1| Beta-eliminating lyase superfamily protein [Caldanaerobacter 
subterraneus subsp. pacificus DSM 12653]
Length=346

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 101/156 (65%), Gaps = 1/156 (1%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            + + ADSV  CLSKGL AP+GS++VG K FI+RAR  RK LGGGMRQ G + AA +V  +
Sbjct  188  IAKYADSVMFCLSKGLCAPIGSIVVGTKEFIERARKYRKMLGGGMRQAGFIAAAGIVALE  247

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            +   +L+ DH  A+ LAEGL  I G+++DM +V+TNIV  DI      T  E   +L EH
Sbjct  248  KMTKRLQEDHDNARLLAEGLKNIPGIDLDMETVQTNIVMTDI-SGTGMTGREFSLKLKEH  306

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            GVL+       +RFV H+ I+  DV+ ALS +++ V
Sbjct  307  GVLVNGGDDFSVRFVTHYYITKEDVKKALSAIEKVV  342



>ref|WP_011024735.1| threonine aldolase [Caldanaerobacter subterraneus]
 gb|AAM23563.1| Threonine aldolase [Caldanaerobacter subterraneus subsp. tengcongensis 
MB4]
 gb|ERM92570.1| threonine aldolase [Caldanaerobacter subterraneus subsp. yonseiensis 
KB-1]
Length=346

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 101/156 (65%), Gaps = 1/156 (1%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            + + ADSV  CLSKGL AP+GS++VG K FI+RAR  RK LGGGMRQ G + AA +V  +
Sbjct  188  IAKYADSVMFCLSKGLCAPIGSIVVGTKEFIERARKYRKMLGGGMRQAGFIAAAGIVALE  247

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            +   +L+ DH  A+ LAEGL  I G+++DM +V+TNIV  DI      T  E   +L EH
Sbjct  248  KMTKRLQEDHDNARLLAEGLKNIPGIDLDMETVQTNIVMTDI-SGTGMTGREFSLKLKEH  306

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            GVL+       +RFV H+ I+  DV+ ALS +++ V
Sbjct  307  GVLVNGGDDFSVRFVTHYYITKEDVKKALSAIEKVV  342



>tpg|DAA54991.1| TPA: putative threonine aldolase family protein [Zea mays]
Length=476

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSV VCLSKGLGAPVGSVIVG K+FID+ARI+RKTLGGG+RQ+GVLCAAA V  
Sbjct  302  RLVKAADSVLVCLSKGLGAPVGSVIVGSKAFIDKARILRKTLGGGIRQVGVLCAAAHVVV  361

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNI  387
            ++ VGKL  DHKKAK LAEGL KI  + VD ASVETN+
Sbjct  362  RDTVGKLADDHKKAKALAEGLKKIEQITVDSASVETNM  399



>emb|CAN82414.1| hypothetical protein VITISV_039151 [Vitis vinifera]
Length=397

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 103/169 (61%), Gaps = 36/169 (21%)
 Frame = -3

Query  680  RLVQAADSVSV-----------CLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQI  534
            RL+QAADS SV           CLSKGLGAPVGSVIVG KSFI +AR +RKTLGGGMRQ+
Sbjct  193  RLLQAADSASVLAFIMLCVSQVCLSKGLGAPVGSVIVGSKSFIAKARRLRKTLGGGMRQV  252

Query  533  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVET-------------  393
            G++CAAALV  QEN+ KLEGDHKKAK LA     +S     + +V+              
Sbjct  253  GIICAAALVALQENIAKLEGDHKKAKILAGNEPAVSFCSASLEAVDMFGSYNCKCPWCCD  312

Query  392  ---NIVFC---------DILKEANTTEMELCKRLAEHGVLILPEGPKRI  282
                +VFC         +I++ +N T  +LCK L EHGVL++PE   RI
Sbjct  313  DSGALVFCTSVMFPVYFEIVEGSNITAEKLCKYLQEHGVLMMPESSSRI  361



>ref|WP_025322967.1| threonine aldolase [Deferrisoma camini]
Length=347

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 97/158 (61%), Gaps = 1/158 (1%)
 Frame = -3

Query  683  SRLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVG  504
            + +   ADSV  CLSKGL APVGSV+ GPK+FI+RAR  RK LGGGMRQ G+L AA LV 
Sbjct  186  AEIAATADSVMFCLSKGLAAPVGSVLAGPKAFIERARRHRKLLGGGMRQAGILAAAGLVA  245

Query  503  FQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
                VG+L  DH  A+ LA G+  + GL VD+ +V+TNIV  +++  A      L   L 
Sbjct  246  LDTMVGRLTDDHANARALARGIASVDGLRVDLGAVQTNIVLFEVVDPA-WDAASLVAALG  304

Query  323  EHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
              GVL    GP++IR V H  +S  DV  AL R++  V
Sbjct  305  RVGVLCSAFGPRKIRLVTHCDVSTEDVSEALDRIETVV  342



>gb|ACJ83727.1| unknown [Medicago truncatula]
Length=118

 Score =   135 bits (339),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 88/119 (74%), Gaps = 1/119 (1%)
 Frame = -3

Query  545  MRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILK  366
            MRQIG++CAAALV  +ENVGKLE DHKK + LA+GLN+I GL V+  S+ETNI+F DI+ 
Sbjct  1    MRQIGIICAAALVALKENVGKLESDHKKTRLLADGLNEIKGLRVNPCSIETNIIFIDIVD  60

Query  365  EANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  189
             + TT  ++ K L E G+L++ E   R+R V+HHQIS +DVQY LS  Q+AV  + NG+
Sbjct  61   GSRTTTEKIFKYLEERGILLMQEKASRLRVVLHHQISASDVQYTLSCFQQAVQ-IENGN  118



>ref|WP_014100459.1| threonine aldolase [Candidatus Chloracidobacterium thermophilum]
 gb|AEP12722.1| L-threonine aldolase [Candidatus Chloracidobacterium thermophilum 
B]
Length=351

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 92/154 (60%), Gaps = 1/154 (1%)
 Frame = -3

Query  683  SRLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVG  504
            + L Q   SV +CLSKGLGAPVGS++ G + FI+RAR +RK LGGGMRQ GVL AA LV 
Sbjct  190  AELAQGFSSVMICLSKGLGAPVGSLVFGTRDFIERARTVRKMLGGGMRQAGVLAAAGLVA  249

Query  503  FQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
             +E    L  DH  A+ LA  L ++ GL+VD+  VETNIV CD+      T  + C  L 
Sbjct  250  LEEGPAHLADDHANARWLAAELAQLPGLDVDLTRVETNIVMCDV-TPTGMTASDFCAGLK  308

Query  323  EHGVLILPEGPKRIRFVIHHQISDTDVQYALSRV  222
              GVL  P GP  +RFV H     +  Q A+  +
Sbjct  309  SCGVLAGPAGPYTVRFVTHRDAPRSACQRAVEAI  342



>ref|WP_026475800.1| threonine aldolase [Alkaliphilus transvaalensis]
Length=346

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 100/153 (65%), Gaps = 1/153 (1%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            + Q ADSV  CLSKGL AP+GS++VG K FI +AR +RK LGGGMRQ+G++ AA LV  +
Sbjct  191  ITQYADSVMFCLSKGLSAPIGSMLVGTKDFIKKARKLRKMLGGGMRQVGIIAAAGLVALR  250

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            ++   +E DH  AK LA GLN I G+ V++  V TNI+  DI  E      +L  R++E 
Sbjct  251  DHSQWMEEDHLNAKKLAFGLNLIDGVRVNLDKVHTNILMADI-SETGFNAYDLVNRMSEK  309

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  219
            G+L+ P   + IRFV H  I++ DV+ A+  V+
Sbjct  310  GLLVNPRNERLIRFVTHRGINNRDVEAAIKIVK  342



>gb|EEG77367.1| Threonine aldolase [Dethiobacter alkaliphilus AHT 1]
Length=339

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 98/152 (64%), Gaps = 4/152 (3%)
 Frame = -3

Query  665  ADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVG  486
            ADSV  CLSKGLGAPVGS++ G   FI++AR  RK LGGGMRQ GVL AA LV   +++ 
Sbjct  192  ADSVMFCLSKGLGAPVGSILAGKNEFIEQARRYRKLLGGGMRQAGVLAAAGLVAL-DDIA  250

Query  485  KLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLI  306
            +L  DH+ A  LAEGL KI GL VD++ V+TN+V  +I      +  E   R+ E GV  
Sbjct  251  QLSDDHENAVRLAEGLAKIEGLSVDLSKVQTNMVMAEI---QELSVQEFLDRILEAGVAA  307

Query  305  LPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
             P GP R+RFV H  ++  D+  AL R+ +A+
Sbjct  308  GPMGPGRVRFVTHRDVTAADIDEALMRIGQAL  339



>ref|WP_040378796.1| threonine aldolase [Dethiobacter alkaliphilus]
Length=341

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 98/152 (64%), Gaps = 4/152 (3%)
 Frame = -3

Query  665  ADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVG  486
            ADSV  CLSKGLGAPVGS++ G   FI++AR  RK LGGGMRQ GVL AA LV   +++ 
Sbjct  194  ADSVMFCLSKGLGAPVGSILAGKNEFIEQARRYRKLLGGGMRQAGVLAAAGLVAL-DDIA  252

Query  485  KLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLI  306
            +L  DH+ A  LAEGL KI GL VD++ V+TN+V  +I      +  E   R+ E GV  
Sbjct  253  QLSDDHENAVRLAEGLAKIEGLSVDLSKVQTNMVMAEI---QELSVQEFLDRILEAGVAA  309

Query  305  LPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
             P GP R+RFV H  ++  D+  AL R+ +A+
Sbjct  310  GPMGPGRVRFVTHRDVTAADIDEALMRIGQAL  341



>ref|WP_004400281.1| MULTISPECIES: Threonine aldolase [Thermoanaerobacter]
 gb|EMT39215.1| Threonine aldolase [Thermoanaerobacter thermohydrosulfuricus 
WC1]
Length=345

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 100/157 (64%), Gaps = 1/157 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
             + + ADSV  CLSKGL AP+GSV+VG K FI++AR  RK LGGGMRQ G + AA +V  
Sbjct  187  EIAKYADSVMFCLSKGLCAPIGSVVVGTKDFIEKARKYRKMLGGGMRQAGFIAAAGIVAL  246

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++   +L+ DH  A+ LAEGL  I G+ +D+ +V+TNIV  DI K   T + E   +L E
Sbjct  247  EKMTKRLQEDHDNARFLAEGLKNIPGINLDLETVQTNIVMTDISKTGMTGK-EFALKLKE  305

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            HG+LI       +RFV H+ IS  D++  L  +++ V
Sbjct  306  HGILINGGNDFAVRFVTHYYISKKDIEKTLDAIEKIV  342



>ref|WP_026677955.1| threonine aldolase [Fictibacillus gelatini]
Length=342

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 99/153 (65%), Gaps = 1/153 (1%)
 Frame = -3

Query  662  DSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGK  483
            D+V +CLSKGL APVGS++ G KSFI +AR  RK LGGG+RQ+GVL A  +V  ++ V +
Sbjct  190  DTVQICLSKGLSAPVGSILAGSKSFIQKARKWRKRLGGGLRQVGVLAAPGIVALEKMVDR  249

Query  482  LEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLIL  303
            L  DH  A+  AEGL+ I G+ +D+  VETNI+ CDI +E   +  +   +L E G+L  
Sbjct  250  LAEDHANARQFAEGLSAIPGITIDVDGVETNIILCDI-RETGLSNEQFLTKLKEAGILAG  308

Query  302  PEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  204
            P     IRFV H ++++  VQ A+ R+ + + G
Sbjct  309  PFDDGIIRFVTHREVTNEMVQTAIERIAQIIAG  341



>ref|WP_018706849.1| hypothetical protein [Bacillus fordii]
Length=348

 Score =   140 bits (353),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 99/154 (64%), Gaps = 1/154 (1%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            + +  D+V  CLSKGL AP+GS++ GPK FI++AR  RK LGGG RQ G++ AA ++  +
Sbjct  187  ITKYTDTVQFCLSKGLSAPMGSILAGPKDFIEKARKWRKMLGGGTRQAGIVGAAGIIALE  246

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            E +G+L+ DH  AK LAEGL +I+G+++D   VETNI+   I +     + E  K+L  H
Sbjct  247  EIIGRLQEDHLHAKKLAEGLARINGIDIDAEGVETNIIMFSIARSGLDAD-EFIKKLHGH  305

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQR  216
             +L    GP RIRFV H  I+  D+  A+  ++R
Sbjct  306  EILANSAGPYRIRFVTHRGIATEDIDTAIEAIKR  339



>gb|EWM22625.1| threonine aldolase [Nannochloropsis gaditana]
Length=912

 Score =   145 bits (365),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 105/154 (68%), Gaps = 0/154 (0%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            + + ADSV+VC+SKGLGAP GS++VG ++F ++AR +RK LGG MRQ+GVL AA LV  +
Sbjct  294  MTKHADSVTVCMSKGLGAPAGSLLVGSRAFTEKARKLRKALGGAMRQVGVLAAAGLVALK  353

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
              + +L  DH+ A+ LA+GL+ + GL+V++ +VETNIV  D       +  EL + L   
Sbjct  354  RTLPRLAEDHENARRLAKGLSTLPGLKVNVEAVETNIVMIDFEDRLPLSPPELLEELERR  413

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQR  216
             VL L  GP+RIR V H+ +S+ D++ A++  ++
Sbjct  414  NVLALAVGPRRIRMVTHYDVSEGDIKKAITVFEK  447



>gb|EGU57937.1| L-allo-threonine aldolase [Vibrio nigripulchritudo ATCC 27043]
Length=173

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 98/156 (63%), Gaps = 4/156 (3%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            + Q  DS+++CLSKGL AP+GS+++G K+ I++AR +RK LGG MRQ+G+L AA  +   
Sbjct  22   IAQHFDSMTICLSKGLSAPIGSLLLGDKALIEKARRIRKMLGGAMRQVGILAAAGKIALT  81

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            E V +L+ DHK AK LAEGL  I G  V    V+TNIVF  + +  +     L  +LAE 
Sbjct  82   EQVEQLKADHKHAKQLAEGLATIPGFSVKPELVQTNIVFAKVDETIDVD--SLTNKLAEQ  139

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            G++I P  P  IRFV H  +S  DV   +  ++R +
Sbjct  140  GIIINPRSP--IRFVTHKDVSSDDVNTLVDTIKRLI  173



>ref|WP_038146243.1| threonine aldolase, partial [Vibrio nigripulchritudo]
Length=173

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 98/156 (63%), Gaps = 4/156 (3%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            + Q  DS+++CLSKGL AP+GS+++G K+ I++AR +RK LGG MRQ+G+L AA  +   
Sbjct  22   IAQHFDSMTICLSKGLSAPIGSLLLGDKALIEKARRIRKMLGGAMRQVGILAAAGKIALT  81

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            E V +L+ DHK AK LAEGL  I G  V    V+TNIVF  + +  +     L  +LAE 
Sbjct  82   EQVEQLKADHKHAKQLAEGLATIPGFSVKPELVQTNIVFAKVDETIDVD--SLTNKLAEQ  139

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            G++I P  P  IRFV H  +S  DV   +  ++R +
Sbjct  140  GIIINPRSP--IRFVTHKDVSSDDVNTLVDTIKRLI  173



>ref|WP_012269711.1| MULTISPECIES: threonine aldolase [Thermoanaerobacter]
 gb|ABY95633.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter pseudethanolicus ATCC 33223]
 gb|ADV80571.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter brockii subsp. finnii Ako-1]
Length=345

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 99/156 (63%), Gaps = 1/156 (1%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            + + ADSV  CLSKGL AP+GSV+VG K FI++AR  RK LGGGMRQ G + AA +V  +
Sbjct  188  IAKYADSVMFCLSKGLCAPIGSVVVGTKDFIEKARKYRKMLGGGMRQAGFIAAAGIVALE  247

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            +   +L+ DH  A+ LAEGL  I G+ +D+ +V+TNIV  DI      T  EL  RL EH
Sbjct  248  KMTKRLQEDHDNARFLAEGLKNIPGINLDLETVQTNIVMTDI-SGTGMTGKELSLRLKEH  306

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            G+LI       +RFV H+ IS  +++  L  +++ V
Sbjct  307  GILINDGNDFAVRFVTHYYISKKEIEKTLDAIEKIV  342



>ref|WP_014062139.1| threonine aldolase [Thermoanaerobacter wiegelii]
 gb|AEM77766.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter wiegelii Rt8.B1]
Length=345

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 99/157 (63%), Gaps = 1/157 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
             + +  DSV  CLSKGL AP+GSV+VG K FI++AR  RK LGGGMRQ G + AA +V  
Sbjct  187  EIAKYTDSVMFCLSKGLCAPIGSVVVGTKDFIEKARKYRKMLGGGMRQAGFIAAAGIVAL  246

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++   +L+ DH  A+ LAEGL  I G+ +D+ +V+TNIV  DI K   T + E   +L E
Sbjct  247  EKMTKRLQEDHDNARFLAEGLKNIPGINLDLETVQTNIVMTDISKTGMTGK-EFALKLKE  305

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            HG+LI       +RFV H+ IS  D++  L  +++ V
Sbjct  306  HGILINGGNDFAVRFVTHYYISKKDIEKTLDAIEKIV  342



>gb|ETK74181.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL27611.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETP03710.1| hypothetical protein, variant [Phytophthora parasitica CJ01A1]
Length=250

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 105/156 (67%), Gaps = 4/156 (3%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            LV+ ADSVS+CLSKGLGAPVGS++ G + FI  AR +RK+LGGGMRQ G++ +A L   +
Sbjct  92   LVRGADSVSLCLSKGLGAPVGSILAGSEEFIHHARRLRKSLGGGMRQAGIIASAGLYALE  151

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRL-AE  321
                +LE DH  A+ LA G++ I G+E+D ++V+TNIVF  + K+A      L ++L +E
Sbjct  152  NQFDRLEEDHVNAQALAHGISSIPGVEIDPSTVDTNIVFFTLTKDAKLDAATLVQKLGSE  211

Query  320  HGVLI--LPEGPKRIRFVIHHQISDTDVQYALSRVQ  219
             GVL+    +G  R+R V +  IS  DV+Y +S V+
Sbjct  212  KGVLVGAYADG-NRVRAVTNLHISAEDVEYTVSSVR  246



>ref|WP_013988231.1| threonine aldolase [Sulfobacillus acidophilus]
 gb|AEJ41517.1| L-allo-threonine aldolase [Sulfobacillus acidophilus TPY]
 gb|AEW05046.1| L-threonine aldolase [Sulfobacillus acidophilus DSM 10332]
Length=338

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 97/152 (64%), Gaps = 6/152 (4%)
 Frame = -3

Query  683  SRLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVG  504
            +RLV  ADSVSVCLSKGLGAPVGS++VGP  FIDRAR  RK LGGGMRQ GVL AA LV 
Sbjct  186  ARLVHDADSVSVCLSKGLGAPVGSLLVGPTDFIDRARRYRKWLGGGMRQAGVLAAAGLVA  245

Query  503  FQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
              + + +L  DH++A+ LAEGL  + G      SV TN+V  D+ ++A     E C+ L 
Sbjct  246  LTQ-IDRLAEDHERARRLAEGLRDL-GYRAWQPSVPTNMVMVDVDEDAGVL-AERCRAL-  301

Query  323  EHGVLILPEGPKRIRFVIHHQISDTDVQYALS  228
              GVL+ P G  RIR V H  I D  +  AL 
Sbjct  302  --GVLVSPMGAHRIRLVTHLDIDDCAISRALD  331



>ref|WP_006447171.1| threonine aldolase [Alicyclobacillus hesperidum]
 gb|EJY55439.1| O-acetylhomoserine/O-acetylserine sulfhydrylase [Alicyclobacillus 
hesperidum URH17-3-68]
Length=350

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 96/151 (64%), Gaps = 1/151 (1%)
 Frame = -3

Query  662  DSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGK  483
            DS+  CLSKGLGAPVGSV+VGP++ IDRAR+ RK LGGG+RQ GVL A  +      V +
Sbjct  194  DSLQFCLSKGLGAPVGSVVVGPRAMIDRARVWRKRLGGGLRQAGVLAAPCIWALTNMVER  253

Query  482  LEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLIL  303
            L  DH  AK LAE L  + G+ V++ +V+TNIV  ++  E    E      LA +GVL  
Sbjct  254  LAEDHAHAKVLAERLANMPGIAVNLETVQTNIVLAELTHEDVMAE-PFIAELANNGVLAT  312

Query  302  PEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
              GP+ +RFV H  ++  DV+ A+ R+++ +
Sbjct  313  AFGPRTVRFVTHKDVNQADVEMAVDRIRQTI  343



>dbj|GAL27114.1| low-specificity L-threonine aldolase [Vibrio variabilis]
Length=187

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 97/151 (64%), Gaps = 4/151 (3%)
 Frame = -3

Query  662  DSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGK  483
            DS+++CLSKGL AP+GS+++G KSFI+RAR +RK +GGGMRQ G+L AA  +   E V +
Sbjct  41   DSMTICLSKGLSAPIGSLLLGSKSFIERARRLRKMVGGGMRQAGILAAAGKLALTEQVAQ  100

Query  482  LEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLIL  303
            L  DH  AK LAEGLN ++G  V+   V+TNIVF  + +  +     + ++LA  G+ I 
Sbjct  101  LATDHANAKKLAEGLNAVAGFSVNADFVQTNIVFAKLDESVDIN--RIAEQLAVDGITIS  158

Query  302  PEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            P  P  +RFV H  +S  D+   L +++  V
Sbjct  159  PSNP--VRFVTHKDVSSNDIDVLLEKLKTLV  187



>ref|WP_003867083.1| MULTISPECIES: threonine aldolase [Thermoanaerobacter]
 ref|YP_001661860.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter sp. X514]
 ref|YP_003903199.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter sp. X513]
 gb|ABY91524.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter sp. X514]
 gb|EEU63053.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter ethanolicus CCSD1]
 gb|EFK85367.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter sp. X561]
 gb|ADN53908.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter sp. X513]
Length=345

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 99/156 (63%), Gaps = 1/156 (1%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            + + ADSV  CLSKGL AP+GSV+VG K FI++AR  RK LGGGMRQ G + AA +V  +
Sbjct  188  IAKYADSVMFCLSKGLCAPIGSVVVGTKDFIEKARKYRKMLGGGMRQAGFIAAAGIVALE  247

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            +   +L+ DH  A+ LAEGL  I G+ +D+ +V+TNIV  DI      T  EL  RL EH
Sbjct  248  KMTKRLQEDHDNARFLAEGLKNIPGINLDLETVQTNIVMTDI-SGTGMTGKELSLRLKEH  306

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            G+LI       +RFV H+ IS  +++  L  +++ V
Sbjct  307  GILINGGNDFAVRFVTHYYISKKEIEKTLDAIEKIV  342



>ref|WP_029688227.1| threonine aldolase [Thermoanaerobacter sp. A7A]
Length=345

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 99/156 (63%), Gaps = 1/156 (1%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            + + ADSV  CLSKGL AP+GSV+VG K FI++AR  RK LGGGMRQ G + AA +V  +
Sbjct  188  IAKYADSVMFCLSKGLCAPIGSVVVGTKDFIEKARKYRKMLGGGMRQAGFIAAAGIVALE  247

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            +   +L+ DH  A+ LAEGL  I G+ +D+ +V+TNIV  DI      T  EL  RL EH
Sbjct  248  KMTKRLQEDHDNARFLAEGLKNIPGINLDLETVQTNIVMTDI-SGTGMTGKELSLRLKEH  306

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            G+LI       +RFV H+ IS  +++  L  +++ V
Sbjct  307  GILINGGNDFAVRFVTHYYISKKEIEKTLDAIEKIV  342



>ref|XP_010906817.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Elaeis guineensis]
Length=335

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 94/144 (65%), Gaps = 2/144 (1%)
 Frame = -3

Query  641  SKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKK  462
            S  L  PV  ++    S +  A+ +RKTLGGGMRQ+GVLCAAA V  QEN+GKLE DH+K
Sbjct  184  SVALKVPVHRLLQAADSAL--AKRLRKTLGGGMRQVGVLCAAAYVALQENIGKLEDDHRK  241

Query  461  AKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRI  282
            AK  A+GL +I  L +D  SVETN++F  I   +  +   LC+ L  HG+L +P     +
Sbjct  242  AKIFADGLKQIKELSIDATSVETNMIFFSIADSSLISPKRLCQVLEVHGILAMPASSTSV  301

Query  281  RFVIHHQISDTDVQYALSRVQRAV  210
            R V+H+QIS+ DV YAL+ ++ AV
Sbjct  302  RLVLHYQISENDVYYALTCIKHAV  325



>gb|ETM34050.1| hypothetical protein, variant [Phytophthora parasitica]
Length=250

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 104/156 (67%), Gaps = 4/156 (3%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            L + ADSVS+CLSKGLGAPVGS++ G + FI  AR +RK+LGGGMRQ G++ +A L   +
Sbjct  92   LARGADSVSLCLSKGLGAPVGSILAGSEEFIHHARRLRKSLGGGMRQAGIIASAGLYALE  151

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRL-AE  321
                +LE DH  A+ LA G++ I G+E+D ++V+TNIVF  + K+A      L ++L +E
Sbjct  152  NQFDRLEEDHVNAQALAHGISSIPGVEIDPSTVDTNIVFFTLTKDAKLDATTLVQKLGSE  211

Query  320  HGVLI--LPEGPKRIRFVIHHQISDTDVQYALSRVQ  219
             GVL+    +G  R+R V +  IS  DV+Y +S V+
Sbjct  212  KGVLVGAYADG-NRVRAVTNLHISAEDVEYTISSVR  246



>ref|WP_018133494.1| hypothetical protein [Effusibacillus pohliae]
Length=345

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 94/151 (62%), Gaps = 1/151 (1%)
 Frame = -3

Query  662  DSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGK  483
            D+V VC SKGLGAPVGSV+ GP+ FI+ AR  RK LGGGMRQ GV+ A A+V   E V +
Sbjct  193  DTVQVCFSKGLGAPVGSVLAGPRDFIEAARQWRKRLGGGMRQAGVIAAPAIVALTEMVDR  252

Query  482  LEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLIL  303
            L  DH+ A+ LA  L ++ G +VD   VETNIV  D+     +   E    LA+ GVL +
Sbjct  253  LAEDHENARRLALALAEMKGWQVDPGLVETNIVIADVAGTGRSA-TEWLDWLAKEGVLAV  311

Query  302  PEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
              G   IRFV H  +S +D++ A+ R+ R V
Sbjct  312  DFGDTLIRFVTHKDVSSSDLEEAIRRIHRVV  342



>ref|XP_008897473.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETI33811.1| hypothetical protein, variant [Phytophthora parasitica P1569]
 gb|ETL80846.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETN17977.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETO62637.1| hypothetical protein, variant [Phytophthora parasitica P1976]
 gb|ETP31859.1| hypothetical protein, variant [Phytophthora parasitica P10297]
Length=250

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 104/156 (67%), Gaps = 4/156 (3%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            L + ADSVS+CLSKGLGAPVGS++ G + FI  AR +RK+LGGGMRQ G++ +A L   +
Sbjct  92   LARGADSVSLCLSKGLGAPVGSILAGSEEFIHHARRLRKSLGGGMRQAGIIASAGLYALE  151

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRL-AE  321
                +LE DH  A+ LA G++ I G+E+D ++V+TNIVF  + K+A      L ++L +E
Sbjct  152  NQFDRLEEDHVNAQALAHGISSIPGVEIDPSTVDTNIVFFTLTKDAKLDATTLVQKLGSE  211

Query  320  HGVLI--LPEGPKRIRFVIHHQISDTDVQYALSRVQ  219
             GVL+    +G  R+R V +  IS  DV+Y +S V+
Sbjct  212  KGVLVGAYADG-NRVRAVTNLHISAEDVEYTVSSVR  246



>ref|WP_003869086.1| threonine aldolase [Thermoanaerobacter ethanolicus]
 gb|EGD53170.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter ethanolicus JW 200]
Length=345

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 99/156 (63%), Gaps = 1/156 (1%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            + + ADSV  CLSKGL AP+GSV+VG K FI++AR  RK LGGGMRQ G + AA +V  +
Sbjct  188  IAKYADSVMFCLSKGLCAPIGSVVVGTKDFIEKARKYRKMLGGGMRQAGFIAAAGIVALE  247

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            +   +L+ DH  A+ LAEGL  I G+ +D+ +V+TNIV  DI K   T + E   +L E 
Sbjct  248  KMTKRLQEDHDNARFLAEGLKNIPGINLDLETVQTNIVMADISKTGMTGK-EFALKLKEQ  306

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            G+LI       +RFV H+ IS  D++  L  +++ V
Sbjct  307  GILINGGNDFAVRFVTHYYISKKDIEKTLDAIEKIV  342



>ref|WP_039929082.1| threonine aldolase [Thermoanaerobacter siderophilus]
 gb|AIS51424.1| L-allo-threonine aldolase LtaA [Thermoanaerobacter kivui]
Length=345

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 99/157 (63%), Gaps = 1/157 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
             + + ADSV  CLSKGL AP+GSV+VG K FI++AR  RK LGGGMRQ G + AA +V  
Sbjct  187  EIAKYADSVMFCLSKGLCAPIGSVVVGTKDFIEKARKYRKMLGGGMRQAGFIAAAGIVAL  246

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++   +L+ DH  A+ LAEGL  I G+ +D+ +V+TNIV  DI K   T + E   +L E
Sbjct  247  EKMTKRLQEDHDNARFLAEGLKNIPGINLDLETVQTNIVMTDISKTGMTGK-EFALKLKE  305

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
             G+LI       +RFV H+ IS  D++  L  +++ V
Sbjct  306  QGILINGGNDFAVRFVTHYYISKKDIEKTLDAIEKIV  342



>ref|WP_014645330.1| threonine aldolase [Halobacillus halophilus]
 emb|CCG47449.1| threonine aldolase [Halobacillus halophilus DSM 2266]
Length=339

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 95/149 (64%), Gaps = 2/149 (1%)
 Frame = -3

Query  662  DSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGK  483
            D++  CLSKGLGAPVGS+I G + FI +AR  RK LGGG+RQ+G++ A  LV   + V +
Sbjct  191  DTIQFCLSKGLGAPVGSIIAGSEDFIRKARKWRKRLGGGLRQVGIIAAPGLVALNDMVDR  250

Query  482  LEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLIL  303
            L  DH+ AK LAEGL  I GLE++  +V+TNI+  ++     T+  E  + L   GVL +
Sbjct  251  LAEDHEHAKQLAEGLGNIEGLEIE-NNVDTNILLVNVEGRGKTSH-EFLEELKSQGVLAV  308

Query  302  PEGPKRIRFVIHHQISDTDVQYALSRVQR  216
            P GP  +RFV H+ +S  D+   + RV R
Sbjct  309  PFGPYTVRFVTHYDVSGEDIDLVIERVHR  337



>ref|WP_038227001.1| threonine aldolase [Vibrio sp. ER1A]
 gb|KFA97958.1| threonine aldolase [Vibrio sp. ER1A]
Length=334

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 104/156 (67%), Gaps = 4/156 (3%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            + Q  DS+++CLSKGL AP+GS+++G K+FI+RAR +RK +GGGMRQ G+L AA  +   
Sbjct  183  IAQHFDSMTICLSKGLAAPIGSLLLGSKAFIERARRLRKMVGGGMRQAGILAAAGKLALT  242

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            E V +L+ DH  AK LA GLN ISG  V+   V+TNIVF   L E+   ++ + + LA+ 
Sbjct  243  EQVDQLKVDHANAKKLAFGLNDISGFSVNADFVQTNIVFAK-LDESVKIDV-IAESLAKE  300

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            G+ I P  P  IRFV H  IS  D+ + L+R+++ V
Sbjct  301  GITITPGNP--IRFVTHKDISSADIDHLLTRLKQLV  334



>gb|EIV99346.1| threonine aldolase [Thermoanaerobacter siderophilus SR4]
Length=362

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 99/156 (63%), Gaps = 1/156 (1%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            + + ADSV  CLSKGL AP+GSV+VG K FI++AR  RK LGGGMRQ G + AA +V  +
Sbjct  205  IAKYADSVMFCLSKGLCAPIGSVVVGTKDFIEKARKYRKMLGGGMRQAGFIAAAGIVALE  264

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            +   +L+ DH  A+ LAEGL  I G+ +D+ +V+TNIV  DI K   T + E   +L E 
Sbjct  265  KMTKRLQEDHDNARFLAEGLKNIPGINLDLETVQTNIVMTDISKTGMTGK-EFALKLKEQ  323

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            G+LI       +RFV H+ IS  D++  L  +++ V
Sbjct  324  GILINGGNDFAVRFVTHYYISKKDIEKTLDAIEKIV  359



>ref|WP_038559128.1| threonine aldolase [Terribacillus aidingensis]
 gb|AIF65984.1| threonine aldolase [Terribacillus aidingensis]
Length=343

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 96/152 (63%), Gaps = 2/152 (1%)
 Frame = -3

Query  683  SRLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVG  504
            ++  Q  D+V VCLSKGLGAPVGSV+ G K FID+AR  RK LGGGMRQ G+L A  LV 
Sbjct  184  AKYAQLTDTVQVCLSKGLGAPVGSVLAGSKVFIDKARKWRKRLGGGMRQAGILAAPGLVA  243

Query  503  FQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
             +ENV +L  DH+ AK LA+GL +I G+E+ M  VETNIV  D+ +    T     + L 
Sbjct  244  LRENVERLADDHENAKLLADGLAEIDGIEI-MNKVETNIVLADV-QGTGVTADAYVQLLK  301

Query  323  EHGVLILPEGPKRIRFVIHHQISDTDVQYALS  228
            E  VL    GP  +RFV H+ +    ++ AL+
Sbjct  302  EQQVLANAFGPYSVRFVTHYDVGKGAIKKALA  333



>ref|WP_042834178.1| threonine aldolase [Thermoanaerobacter sp. YS13]
 gb|KHO61352.1| L-threonine aldolase [Thermoanaerobacter sp. YS13]
Length=345

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 99/157 (63%), Gaps = 1/157 (1%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
             + + ADSV  CLSKGL AP+GSV+VG K FI++AR  RK LGGGMRQ G + AA +V  
Sbjct  187  EIAKYADSVMFCLSKGLCAPIGSVVVGTKDFIEKARKYRKMLGGGMRQAGFIAAAGIVAL  246

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
            ++   +L+ DH  A+ LAEGL  I G+ +D+ +V+TNIV  DI      T  EL  +L E
Sbjct  247  EKMTKRLQEDHDNARFLAEGLKDIPGINLDLETVQTNIVMTDI-SGTGMTGKELSLKLKE  305

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            +G+LI       +RFV H+ IS  D++  L  +++ V
Sbjct  306  YGILINGGNDFAVRFVTHYYISKKDIEKTLDAIEKIV  342



>gb|EMS57977.1| L-allo-threonine aldolase [Triticum urartu]
Length=302

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
            RLV+AADSVSV L+KG+GAPVGSVIVG K+FI +A I+RKTLGGG+RQ+G+LCAAA V  
Sbjct  193  RLVRAADSVSVGLAKGIGAPVGSVIVGSKAFIHKATILRKTLGGGIRQVGILCAAAEVAV  252

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIV  384
            ++ VGKL  DH+KAK LA+GL KI    VD+ASVETN+V
Sbjct  253  RDTVGKLADDHRKAKVLADGLKKIEQFTVDLASVETNLV  291



>ref|WP_008216429.1| threonine aldolase [Vibrionales bacterium SWAT-3]
 gb|EDK30742.1| L-allo-threonine aldolase [Vibrionales bacterium SWAT-3]
Length=336

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 102/158 (65%), Gaps = 4/158 (3%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
             + Q  DS+++CLSKGLGAP+GS+++G K +I +AR +RK +GGGMRQ G+L AA  +  
Sbjct  182  EIAQYFDSMTICLSKGLGAPIGSLLLGSKEYIAKARRLRKMVGGGMRQAGILAAAGKMAL  241

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             ENV +L+ DH+ AK LA GL+K+ G  V+   V+TNIVF  + +  +     +   L+E
Sbjct  242  TENVTQLKADHENAKNLAIGLSKLEGFSVNPDFVQTNIVFAKLDESVDIN--RIAGELSE  299

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVT  207
             G+ + P  P  +RFV H  IS  D+   L+ +Q+A+T
Sbjct  300  QGITMTPGNP--VRFVTHRDISAEDISRFLNELQKALT  335



>gb|AIE92478.1| threonine aldolase (ltaE) [uncultured marine group II/III euryarchaeote 
AD1000_23_G03]
Length=346

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 96/152 (63%), Gaps = 4/152 (3%)
 Frame = -3

Query  683  SRLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVG  504
            +R+V+  DS+S+CLSKGLGAPVGSV+VG   FI RA   RK  GGGMRQ G++ A  L  
Sbjct  194  ARMVRDYDSISICLSKGLGAPVGSVLVGSSEFIARAHRWRKMFGGGMRQAGIIAAGGLYA  253

Query  503  FQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
             + ++ +L  DH +A+ LAE +N + G  VD+ SV+TN+V+ D          ++   LA
Sbjct  254  LENHLERLAEDHARARRLAEAVNAMEGFTVDLDSVQTNMVYVD----GELGAQQIMAGLA  309

Query  323  EHGVLILPEGPKRIRFVIHHQISDTDVQYALS  228
            EHG+ +L  GP  +R VIH  I+D D+   ++
Sbjct  310  EHGIDVLDVGPTAVRAVIHLHITDEDIDRTIA  341



>gb|ETK74180.1| hypothetical protein L915_18981 [Phytophthora parasitica]
 gb|ETL27610.1| hypothetical protein L916_18879 [Phytophthora parasitica]
 gb|ETP03709.1| hypothetical protein F441_19383 [Phytophthora parasitica CJ01A1]
Length=352

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 105/156 (67%), Gaps = 4/156 (3%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            LV+ ADSVS+CLSKGLGAPVGS++ G + FI  AR +RK+LGGGMRQ G++ +A L   +
Sbjct  194  LVRGADSVSLCLSKGLGAPVGSILAGSEEFIHHARRLRKSLGGGMRQAGIIASAGLYALE  253

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRL-AE  321
                +LE DH  A+ LA G++ I G+E+D ++V+TNIVF  + K+A      L ++L +E
Sbjct  254  NQFDRLEEDHVNAQALAHGISSIPGVEIDPSTVDTNIVFFTLTKDAKLDAATLVQKLGSE  313

Query  320  HGVLI--LPEGPKRIRFVIHHQISDTDVQYALSRVQ  219
             GVL+    +G  R+R V +  IS  DV+Y +S V+
Sbjct  314  KGVLVGAYADG-NRVRAVTNLHISAEDVEYTVSSVR  348



>ref|WP_042470320.1| threonine aldolase [Vibrio maritimus]
 dbj|GAL17387.1| low-specificity L-threonine aldolase [Vibrio maritimus]
Length=316

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 98/151 (65%), Gaps = 4/151 (3%)
 Frame = -3

Query  662  DSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGK  483
            DS+++CLSKGL AP+GS+++G KSFI+RAR +RK +GGGMRQ G+L AA  +   E V +
Sbjct  170  DSMTICLSKGLSAPIGSLLLGSKSFIERARRLRKMVGGGMRQAGILAAAGKLALTEQVAQ  229

Query  482  LEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLIL  303
            L  DH  AK LAEGLN ++G  V+   V+TNIVF  + +  +     + ++LA+ G+ I 
Sbjct  230  LATDHANAKKLAEGLNAVAGFSVNADFVQTNIVFAKLDESVDIN--RIAEQLAQDGITIS  287

Query  302  PEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            P  P  +RFV H  +S  D+   L +++  V
Sbjct  288  PSNP--VRFVTHKDVSSNDIDVLLEKLKTLV  316



>ref|WP_012957344.1| threonine aldolase [Bacillus pseudofirmus]
 gb|ADC49978.1| putative threonine aldolase [Bacillus pseudofirmus OF4]
Length=338

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 98/153 (64%), Gaps = 2/153 (1%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
              Q  D+V VCLSKGLGAP+GS+I GPK FI  AR  RK LGGG+RQ+G + A  L+   
Sbjct  186  FTQYTDTVQVCLSKGLGAPIGSIIAGPKEFITSARKWRKRLGGGLRQVGTIAAPGLIALS  245

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            E V +L  DH  AK LAEG+  ++GLEV + +V+TNIV  D+  +  T+  E  ++L++ 
Sbjct  246  EMVDRLSEDHHHAKILAEGIGSVNGLEV-VNTVDTNIVLVDVSGKKLTSN-EFIEKLSDA  303

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  219
            GV  +  GP  +RF  H+ +S  +++ AL+ + 
Sbjct  304  GVKAVSFGPSVVRFTTHYDVSKQEIEEALTFIN  336



>ref|WP_013296780.1| threonine aldolase [Thermoanaerobacterium thermosaccharolyticum]
 gb|ADL67801.1| Threonine aldolase [Thermoanaerobacterium thermosaccharolyticum 
DSM 571]
Length=345

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 97/156 (62%), Gaps = 1/156 (1%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            + + ADSV  CLSKGL APVGS++ G K FI +AR  RK LGGG+RQ G+L AA +V  +
Sbjct  188  IARYADSVMFCLSKGLCAPVGSIVTGSKEFIKKARKYRKMLGGGLRQAGILAAAGIVALE  247

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            +   +L  DH+ A+ LAEGLN I G++VDM++V+TNIV  DI      T  +L  +L ++
Sbjct  248  KMTKRLSEDHENARLLAEGLNSIKGIKVDMSTVQTNIVMSDI-SATGLTGAQLSSKLLDY  306

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            G+ +   G   +RFV H+ I   D+   L  +   V
Sbjct  307  GIKVNGAGDYNVRFVTHYYIKKDDINKVLHAINTIV  342



>ref|WP_019839219.1| threonine aldolase [Aeromonas sp. MDS8]
Length=339

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 95/140 (68%), Gaps = 5/140 (4%)
 Frame = -3

Query  662  DSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGK  483
            DS+S+CLSKGLGAPVGS++VG ++FI RAR +RK LGGGMRQ G+L  A L   +++V +
Sbjct  191  DSISICLSKGLGAPVGSLLVGSRAFIARARRLRKMLGGGMRQAGILAQAGLFALEQHVAR  250

Query  482  LEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLIL  303
            L  DH++A+ LAEGL  + G+ +D+A V+TN+VF  + KE +   +   K   E G+L  
Sbjct  251  LADDHRRARRLAEGLAALPGITLDLAQVQTNMVFLQLAKEQSGPLLAFMK---ERGILF-  306

Query  302  PEGPKRIRFVIHHQISDTDV  243
              G   +R V H QI+D D+
Sbjct  307  -SGYGEMRLVTHLQITDDDI  325



>ref|WP_017781663.1| threonine aldolase [Aeromonas hydrophila]
Length=339

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 95/140 (68%), Gaps = 5/140 (4%)
 Frame = -3

Query  662  DSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGK  483
            DS+S+CLSKGLGAPVGS++VG ++FI RAR +RK LGGGMRQ G+L  A L   +++V +
Sbjct  191  DSISICLSKGLGAPVGSLLVGSRAFIARARRLRKMLGGGMRQAGILAQAGLFALEQHVAR  250

Query  482  LEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLIL  303
            L  DH++A+ LAEGL  + G+ +D+A V+TN+VF  + KE +   +   K   E G+L  
Sbjct  251  LADDHRRARRLAEGLAALPGITLDLAQVQTNMVFLQLAKEQSGPLLAFMK---ERGILF-  306

Query  302  PEGPKRIRFVIHHQISDTDV  243
              G   +R V H QI+D D+
Sbjct  307  -SGYGEMRLVTHLQITDDDI  325



>ref|WP_010634262.1| MULTISPECIES: L-allo-threonine aldolase [Aeromonas]
 gb|AHV35517.1| threonine aldolase [Aeromonas hydrophila YL17]
Length=339

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 95/140 (68%), Gaps = 5/140 (4%)
 Frame = -3

Query  662  DSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGK  483
            DS+S+CLSKGLGAPVGS++VG ++FI RAR +RK LGGGMRQ G+L  A L   +++V +
Sbjct  191  DSISICLSKGLGAPVGSLLVGSRAFIARARRLRKMLGGGMRQAGILAQAGLFALEQHVAR  250

Query  482  LEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLIL  303
            L  DH++A+ LAEGL  + G+ +D+A V+TN+VF  + KE +   +   K   E G+L  
Sbjct  251  LADDHRRARRLAEGLAALPGITLDLAQVQTNMVFLQLAKEQSGPLLAFMK---ERGILF-  306

Query  302  PEGPKRIRFVIHHQISDTDV  243
              G   +R V H QI+D D+
Sbjct  307  -SGYGEMRLVTHLQITDDDI  325



>ref|WP_022601443.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo]
 emb|CCN68404.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
SFn118]
Length=334

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 98/156 (63%), Gaps = 4/156 (3%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            + Q  DS+++CLSKGL AP+GS+++G K+ I+RAR +RK LGG MRQ+G+L AA  +   
Sbjct  183  IAQHFDSMTICLSKGLSAPIGSLLLGDKALIERARRIRKMLGGAMRQVGILAAAGKIALT  242

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            E V +L+ DHK AK LAEGL  I G  V    V+TNIVF  + +  +     L  +LAE 
Sbjct  243  EQVEQLKADHKHAKQLAEGLATIPGFSVKPELVQTNIVFAKVDETIDVD--SLTNKLAEQ  300

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            G++I P  P  IRFV H  +S  DV   +  ++R +
Sbjct  301  GIIINPRSP--IRFVTHKDVSSDDVNTLVDTIKRLI  334



>ref|WP_017786172.1| threonine aldolase [Aeromonas hydrophila]
Length=339

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 95/140 (68%), Gaps = 5/140 (4%)
 Frame = -3

Query  662  DSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGK  483
            DS+S+CLSKGLGAPVGS++VG ++FI RAR +RK LGGGMRQ G+L  A L   +++V +
Sbjct  191  DSISICLSKGLGAPVGSLLVGSRAFIARARRLRKMLGGGMRQAGILAQAGLFALEQHVAR  250

Query  482  LEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLIL  303
            L  DH++A+ LAEGL  + G+ +D+A V+TN+VF  + KE +   +   K   E G+L  
Sbjct  251  LADDHRRARRLAEGLAALPGITLDLAQVQTNMVFLQLAKEQSGPLLAFMK---ERGILF-  306

Query  302  PEGPKRIRFVIHHQISDTDV  243
              G   +R V H QI+D D+
Sbjct  307  -SGYGEMRLVTHLQITDDDI  325



>ref|WP_034132280.1| threonine aldolase [Peptococcaceae bacterium BICA1-8]
Length=339

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 99/152 (65%), Gaps = 1/152 (1%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            LVQ  DSV  CL+KGL AP+GS++VG + FI RA   +K LGGG RQIG++ AA +V  +
Sbjct  186  LVQGVDSVQFCLTKGLAAPMGSLLVGSQEFISRAAKWKKMLGGGFRQIGIMAAAGIVALE  245

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
              + +LE DH +AK LA GL+++  L V    +ETNIV  +I+ E  T + E   +LAE+
Sbjct  246  TMIDRLEEDHVRAKKLAHGLSELPYLSVCSDEIETNIVIVEIISELITMK-EFLAKLAEN  304

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRV  222
            G++    GP ++RFV H +I+D D+   + R+
Sbjct  305  GIMAKDIGPTKVRFVTHKEINDDDINLVIERL  336



>ref|WP_017765885.1| threonine aldolase [Aeromonas hydrophila]
Length=339

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 95/140 (68%), Gaps = 5/140 (4%)
 Frame = -3

Query  662  DSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGK  483
            DS+S+CLSKGLGAPVGS++VG ++FI RAR +RK LGGGMRQ G+L  A L   +++V +
Sbjct  191  DSISICLSKGLGAPVGSLLVGSRAFIARARRLRKMLGGGMRQAGILAQAGLFALEQHVAR  250

Query  482  LEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLIL  303
            L  DH++A+ LAEGL  + G+ +D+A V+TN+VF  + KE +   +   K   E G+L  
Sbjct  251  LADDHRRARRLAEGLAALPGITLDLAQVQTNMVFLQLAKEQSGPLLAFMK---ERGILF-  306

Query  302  PEGPKRIRFVIHHQISDTDV  243
              G   +R V H QI+D D+
Sbjct  307  -SGYGEMRLVTHLQITDDDI  325



>ref|WP_005299873.1| threonine aldolase [Aeromonas hydrophila]
 gb|EKB29106.1| L-allo-threonine aldolase [Aeromonas hydrophila SSU]
Length=339

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 95/140 (68%), Gaps = 5/140 (4%)
 Frame = -3

Query  662  DSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGK  483
            DS+S+CLSKGLGAPVGS++VG ++FI RAR +RK LGGGMRQ G+L  A L   +++V +
Sbjct  191  DSISICLSKGLGAPVGSLLVGSRAFIARARRLRKMLGGGMRQAGILAQAGLFALEQHVAR  250

Query  482  LEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLIL  303
            L  DH++A+ LAEGL  + G+ +D+A V+TN+VF  + KE +   +   K   E G+L  
Sbjct  251  LADDHRRARRLAEGLAALPGITLDLAQVQTNMVFLQLAKEQSGPLLAFMK---ERGILF-  306

Query  302  PEGPKRIRFVIHHQISDTDV  243
              G   +R V H QI+D D+
Sbjct  307  -SGYGEMRLVTHLQITDDDI  325



>ref|WP_025229058.1| threonine aldolase [Fimbriimonas ginsengisoli]
 gb|AIE87020.1| serine hydroxymethyltransferase [Fimbriimonas ginsengisoli Gsoil 
348]
Length=349

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 97/151 (64%), Gaps = 4/151 (3%)
 Frame = -3

Query  683  SRLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVG  504
            S + +  DSV+ CLSKGL +PVGS++ G   FID+AR+ RK LGGGMRQ G+L A  +V 
Sbjct  195  SEIAKHFDSVNFCLSKGLRSPVGSLLCGKAEFIDKARVWRKRLGGGMRQAGILAACGIVS  254

Query  503  FQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLA  324
               NV +L  DH++AK +A+ + ++ G+ V +  VETN+V  D   EA   E++   +LA
Sbjct  255  LNSNVDRLADDHRRAKEIAQAVCELPGMSVKLEEVETNMVMVD--TEAPAPEIQ--GKLA  310

Query  323  EHGVLILPEGPKRIRFVIHHQISDTDVQYAL  231
            E GVL LP GP R+R V+H  I D   + A+
Sbjct  311  EKGVLCLPTGPNRLRLVLHADIDDAKTEKAI  341



>ref|WP_042050919.1| L-allo-threonine aldolase [Aeromonas dhakensis]
Length=339

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 95/140 (68%), Gaps = 5/140 (4%)
 Frame = -3

Query  662  DSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGK  483
            DS+S+CLSKGLGAPVGS++VG ++FI RAR +RK LGGGMRQ G+L  A L   +++V +
Sbjct  191  DSISICLSKGLGAPVGSLLVGSRAFIARARRLRKMLGGGMRQAGILAQAGLFALEQHVAR  250

Query  482  LEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLIL  303
            L  DH++A+ LAEGL  + G+ +D+A V+TN+VF  + KE +   +   K   E G+L  
Sbjct  251  LADDHRRARRLAEGLAALPGITLDLAQVQTNMVFLQLAKEQSGPLLAFMK---ERGILF-  306

Query  302  PEGPKRIRFVIHHQISDTDV  243
              G   +R V H QI+D D+
Sbjct  307  -SGYGEMRLVTHLQITDDDI  325



>ref|WP_034131989.1| threonine aldolase [Peptococcaceae bacterium BICA1-8]
Length=345

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 96/149 (64%), Gaps = 1/149 (1%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            LV+ ADSV  CLSKGLGAPVGS++VG KSFI+RAR  RK LGGG+RQ G+L AA +   +
Sbjct  189  LVKNADSVMFCLSKGLGAPVGSMLVGNKSFIERARKYRKMLGGGLRQAGILAAAGIYALE  248

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
              V +LE DH +AK LA  LN++ G+ + + SV+TNIV  +I   A     +  K L   
Sbjct  249  NLVERLEEDHTQAKKLALALNELPGITIAVDSVQTNIVMVEI-DNAKINVQDCVKLLKNQ  307

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYAL  231
            G+L+     +R+RFV H  ++  D+ Y +
Sbjct  308  GILVNSVDERRLRFVTHRDVTPQDIDYTI  336



>ref|WP_004740139.1| threonine aldolase [Vibrio splendidus]
 gb|EGU42310.1| Threonine aldolase [Vibrio splendidus ATCC 33789]
Length=336

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 102/158 (65%), Gaps = 4/158 (3%)
 Frame = -3

Query  680  RLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGF  501
             + Q  DS+++CLSKGLGAP+GS+++G K +I +AR +RK +GGGMRQ G+L AA  +  
Sbjct  182  EIAQYFDSMTICLSKGLGAPIGSLLLGSKEYIAKARRLRKMVGGGMRQAGILAAAGKMAL  241

Query  500  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  321
             ENV +L+ DH+ AK LA GL+K+ G  V+   V+TNIVF  + +  +     +   L+E
Sbjct  242  TENVAQLKLDHENAKNLAIGLSKLEGFSVNPDFVQTNIVFAKLDESVDIN--RIAGELSE  299

Query  320  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVT  207
             G+ + P  P  +RFV H  IS  D+   L+ +Q+A+T
Sbjct  300  QGITMTPGNP--VRFVTHRDISAEDISRFLNELQKALT  335



>ref|WP_017109562.1| threonine aldolase [Vibrio tasmaniensis]
Length=334

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 100/156 (64%), Gaps = 4/156 (3%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            + Q  DS+++CLSKGLGAP+GS+++G K +I +AR +RK +GGGMRQ G+L AA  +   
Sbjct  183  IAQHFDSMTICLSKGLGAPIGSLLLGSKEYIAKARRLRKMVGGGMRQAGILAAAGKMALT  242

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            ENV +L+ DH  AK LA GLNK+ G  V+   ++TNIVF  + +  +     + + L E 
Sbjct  243  ENVAQLKADHDNAKNLAIGLNKLEGFSVNPDFIQTNIVFAKLDESVDIN--RIARELGEQ  300

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            G+ + P  P  +RFV H  IS  D+   L+ +++A+
Sbjct  301  GITMSPGNP--VRFVTHRDISTEDIARFLTELEKAL  334



>gb|ETM34049.1| hypothetical protein L914_18796 [Phytophthora parasitica]
Length=352

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 104/156 (67%), Gaps = 4/156 (3%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            L + ADSVS+CLSKGLGAPVGS++ G + FI  AR +RK+LGGGMRQ G++ +A L   +
Sbjct  194  LARGADSVSLCLSKGLGAPVGSILAGSEEFIHHARRLRKSLGGGMRQAGIIASAGLYALE  253

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRL-AE  321
                +LE DH  A+ LA G++ I G+E+D ++V+TNIVF  + K+A      L ++L +E
Sbjct  254  NQFDRLEEDHVNAQALAHGISSIPGVEIDPSTVDTNIVFFTLTKDAKLDATTLVQKLGSE  313

Query  320  HGVLI--LPEGPKRIRFVIHHQISDTDVQYALSRVQ  219
             GVL+    +G  R+R V +  IS  DV+Y +S V+
Sbjct  314  KGVLVGAYADG-NRVRAVTNLHISAEDVEYTISSVR  348



>ref|WP_014394185.1| threonine aldolase [Corallococcus coralloides]
 gb|AFE09262.1| L-allo-threonine aldolase [Corallococcus coralloides DSM 2259]
Length=341

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 99/153 (65%), Gaps = 4/153 (3%)
 Frame = -3

Query  662  DSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGK  483
            DS SVC SKGLGAPVGS + G K  I  AR +RK LGGGMRQ G+L AAAL   + +V +
Sbjct  193  DSTSVCFSKGLGAPVGSALAGKKDVIREARRLRKRLGGGMRQAGILAAAALYALEHHVER  252

Query  482  LEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLIL  303
            L  DH  A+ LAEGL ++ G++VD+A VETN+VF D+++ A     E    L + GVL  
Sbjct  253  LAEDHANARRLAEGLAQVPGVKVDLARVETNMVFADLVRPA----AEASALLLKQGVLAN  308

Query  302  PEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  204
            P GP  IR V H  +S  D+  AL+R+++A  G
Sbjct  309  PTGPHSIRLVCHLDVSTADIDDALARIRKAFAG  341



>ref|WP_017067124.1| threonine aldolase [Vibrio crassostreae]
Length=334

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 100/156 (64%), Gaps = 4/156 (3%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            + Q  DS+++CLSKGLGAP+GS+++G K +I +AR +RK +GGGMRQ G+L AA  +   
Sbjct  183  IAQHFDSMTICLSKGLGAPIGSLLLGSKEYIAKARRLRKMVGGGMRQAGILAAAGKMALT  242

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            ENV +L+ DH  AK LA GLNK+ G  V+   ++TNIVF  + +  +     + + L E 
Sbjct  243  ENVAQLKADHDNAKNLAIGLNKLEGFSVNPDFIQTNIVFAKLDESVDIN--RIARELGEQ  300

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            G+ + P  P  +RFV H  IS  D+   L+ +++A+
Sbjct  301  GITMSPGNP--VRFVTHRDISTEDIARFLTELEKAL  334



>ref|XP_008897472.1| hypothetical protein PPTG_05622 [Phytophthora parasitica INRA-310]
 gb|ETI33810.1| hypothetical protein F443_19562 [Phytophthora parasitica P1569]
 gb|ETL80845.1| hypothetical protein L917_18706 [Phytophthora parasitica]
 gb|ETN17976.1| hypothetical protein PPTG_05622 [Phytophthora parasitica INRA-310]
 gb|ETO62636.1| hypothetical protein F444_19514 [Phytophthora parasitica P1976]
 gb|ETP31858.1| hypothetical protein F442_19334 [Phytophthora parasitica P10297]
Length=352

 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 104/156 (67%), Gaps = 4/156 (3%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            L + ADSVS+CLSKGLGAPVGS++ G + FI  AR +RK+LGGGMRQ G++ +A L   +
Sbjct  194  LARGADSVSLCLSKGLGAPVGSILAGSEEFIHHARRLRKSLGGGMRQAGIIASAGLYALE  253

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRL-AE  321
                +LE DH  A+ LA G++ I G+E+D ++V+TNIVF  + K+A      L ++L +E
Sbjct  254  NQFDRLEEDHVNAQALAHGISSIPGVEIDPSTVDTNIVFFTLTKDAKLDATTLVQKLGSE  313

Query  320  HGVLI--LPEGPKRIRFVIHHQISDTDVQYALSRVQ  219
             GVL+    +G  R+R V +  IS  DV+Y +S V+
Sbjct  314  KGVLVGAYADG-NRVRAVTNLHISAEDVEYTVSSVR  348



>ref|WP_022597498.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo]
 emb|CCN33850.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
AM115]
 emb|CCN65534.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
Pon4]
 emb|CCN43026.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
FTn2]
 emb|CCN75218.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
SO65]
Length=334

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 98/156 (63%), Gaps = 4/156 (3%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            + Q  DS+++CLSKGL AP+GS+++G K+ I++AR +RK LGG MRQ+G+L AA  +   
Sbjct  183  IAQHFDSMTICLSKGLSAPIGSLLLGDKALIEKARRIRKMLGGAMRQVGILAAAGKIALT  242

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            E V +L+ DHK AK LAEGL  I G  V    V+TNIVF  + +  +     L  +LAE 
Sbjct  243  EQVEQLKADHKHAKQLAEGLATIPGFSVKPELVQTNIVFAKVDETIDVD--SLTNKLAEQ  300

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            G++I P  P  IRFV H  +S  DV   +  ++R +
Sbjct  301  GIIINPRSP--IRFVTHKDVSSDDVNTLIDTIKRLI  334



>ref|WP_042008166.1| L-allo-threonine aldolase [Aeromonas dhakensis]
Length=339

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 95/140 (68%), Gaps = 5/140 (4%)
 Frame = -3

Query  662  DSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGK  483
            DS+S+CLSKGLGAPVGS++VG ++FI RAR +RK LGGGMRQ G+L  A L   +++V +
Sbjct  191  DSISICLSKGLGAPVGSLLVGSRAFIARARRLRKMLGGGMRQAGILAQAGLFALEQHVTR  250

Query  482  LEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLIL  303
            L  DH++A+ LAEGL  + G+ +D+A V+TN+VF  + KE +   +   K   E G+L  
Sbjct  251  LADDHRRARRLAEGLAALPGITLDLAQVQTNMVFLQLAKEQSGPLLAFMK---ERGILF-  306

Query  302  PEGPKRIRFVIHHQISDTDV  243
              G   +R V H QI+D D+
Sbjct  307  -SGYGEMRLVTHLQITDDDI  325



>ref|WP_015310760.1| threonine aldolase [Thermoanaerobacterium thermosaccharolyticum]
 gb|AGB17948.1| threonine aldolase [Thermoanaerobacterium thermosaccharolyticum 
M0795]
Length=345

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 97/156 (62%), Gaps = 1/156 (1%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            + + ADSV  CLSKGL APVGS++ G K FI +A+  RK LGGG+RQ G+L AA +V  +
Sbjct  188  IARYADSVMFCLSKGLCAPVGSIVTGSKEFIKKAKKYRKMLGGGLRQAGILAAAGIVALE  247

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            +   +L  DH+ A+ LAEGLN I G++VDM++V+TNIV  DI      T  +L  +L ++
Sbjct  248  KMTKRLSEDHENARLLAEGLNNIKGIKVDMSTVQTNIVMSDI-SATGLTGAQLSSKLLDY  306

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            G+ +   G   +RFV H+ I   D+   L  +   V
Sbjct  307  GIKVNGAGDYNVRFVTHYYIKKDDINKVLHAINTIV  342



>ref|WP_013778623.1| threonine aldolase [Tepidanaerobacter acetatoxydans]
 ref|YP_007272437.1| L-allo-threonine aldolase [Tepidanaerobacter acetatoxydans Re1]
 gb|AEE91700.1| Threonine aldolase [Tepidanaerobacter acetatoxydans Re1]
 emb|CCP26461.1| L-allo-threonine aldolase [Tepidanaerobacter acetatoxydans Re1]
Length=344

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 92/153 (60%), Gaps = 1/153 (1%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            +   ADSV  CLSKGL APVGS++VG K FI +AR  RK LGGGMRQ G L AA +V  +
Sbjct  188  IASYADSVMFCLSKGLCAPVGSIVVGSKDFILKARKFRKMLGGGMRQAGFLAAAGIVALE  247

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            +   +L  DH  A+ LAEGLN I G+ +DM +V+TNI+ CDI      +  E   +L E 
Sbjct  248  KMTSRLSEDHNNARILAEGLNNIPGVNIDMETVQTNIILCDI-SGLKMSANEFSAKLYEK  306

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  219
            G+ +       +RFV H+ I+  D+   L  V+
Sbjct  307  GIRVNGGSTATVRFVTHYWITKEDINTVLEAVK  339



>ref|WP_022592526.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo]
 emb|CCN54732.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
MADA3021]
 emb|CCN61704.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
MADA3029]
 emb|CCN49783.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
MADA3020]
Length=334

 Score =   134 bits (338),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 98/156 (63%), Gaps = 4/156 (3%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            + Q  DS+++CLSKGL AP+GS+++G K+ I++AR +RK LGG MRQ+G+L AA  +   
Sbjct  183  IAQHFDSMTICLSKGLSAPIGSLLLGDKALIEKARRIRKMLGGAMRQVGILAAAGKIALT  242

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            E V +L+ DHK AK LAEGL  I G  V    V+TNIVF  + +  +     L  +LAE 
Sbjct  243  EQVEQLKADHKHAKQLAEGLATIPGFSVKPELVQTNIVFAKVDETIDVD--SLTNKLAEQ  300

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            G++I P  P  IRFV H  +S  DV   +  ++R +
Sbjct  301  GIIINPRSP--IRFVTHKDVSSDDVNTLVDTIKRLI  334



>ref|WP_009793967.1| MULTISPECIES: threonine aldolase [Bacillus]
 gb|EAR63985.1| threonine aldolase [Bacillus sp. NRRL B-14911]
 gb|AGX03309.1| threonine aldolase [Bacillus infantis NRRL B-14911]
Length=346

 Score =   134 bits (338),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 96/158 (61%), Gaps = 2/158 (1%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
              + AD+V VCLSKGLGAPVGS++ G + FI  ARI RK LGGGMRQ G++ A  L+   
Sbjct  186  FTRHADTVQVCLSKGLGAPVGSILAGSREFIQSARIWRKRLGGGMRQAGIIAAPGLIALT  245

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            +   +L  DH+ A+ LAEG+  I G+ V +  V+TNI+  D+ KE   +  +  +RL + 
Sbjct  246  QMRHRLHEDHENARKLAEGIQNIKGINV-VNQVDTNIIVADV-KELGLSSEQFVERLEKE  303

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  204
            GV  +  GP  +RF  H  +S +D++ AL  V R   G
Sbjct  304  GVRAVTFGPSSVRFTTHFDVSASDIEKALDAVSRTAAG  341



>ref|WP_022561270.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo]
 ref|YP_008641758.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo]
 emb|CCO60698.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo]
 emb|CCN84480.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
BLFn1]
 emb|CCN86527.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
SFn27]
 emb|CCN97070.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
ENn2]
 emb|CCO41573.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
SFn135]
 emb|CCO54178.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
Wn13]
Length=334

 Score =   134 bits (338),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 98/156 (63%), Gaps = 4/156 (3%)
 Frame = -3

Query  677  LVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQ  498
            + Q  DS+++CLSKGL AP+GS+++G K+ I++AR +RK LGG MRQ+G+L AA  +   
Sbjct  183  IAQHFDSMTICLSKGLSAPIGSLLLGDKALIEKARRIRKMLGGAMRQVGILAAAGKIALT  242

Query  497  ENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEH  318
            E V +L+ DHK AK LAEGL  I G  V    V+TNIVF  + +  +     L  +LAE 
Sbjct  243  EQVEQLKADHKHAKQLAEGLATIPGFSVKPELVQTNIVFAKVDETIDVD--SLTNKLAEQ  300

Query  317  GVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  210
            G++I P  P  IRFV H  +S  DV   +  ++R +
Sbjct  301  GIIINPRSP--IRFVTHKDVSSDDVNTLVDTIKRLI  334



>ref|WP_042071615.1| L-allo-threonine aldolase [Aeromonas enteropelogenes]
Length=338

 Score =   134 bits (338),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 96/141 (68%), Gaps = 5/141 (4%)
 Frame = -3

Query  662  DSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGK  483
            DS+S+CLSKGLGAPVGS++VG ++FI RAR +RK LGGGMRQ G+L  A L   +++V +
Sbjct  191  DSISICLSKGLGAPVGSLLVGEQAFIARARRLRKMLGGGMRQAGILAQAGLFALEQHVHR  250

Query  482  LEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLIL  303
            L  DH++A+ LAEGL  + G+E+D+A V++N+VF   L+  N     L   + E G+L  
Sbjct  251  LADDHRRARRLAEGLAALPGIELDLAQVQSNMVF---LRLKNGESQALLAFMKERGILF-  306

Query  302  PEGPKRIRFVIHHQISDTDVQ  240
              G   +R V H QI+D D++
Sbjct  307  -SGYGELRLVTHLQINDDDIE  326



>ref|WP_029301221.1| L-allo-threonine aldolase [Aeromonas hydrophila]
Length=339

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 95/140 (68%), Gaps = 5/140 (4%)
 Frame = -3

Query  662  DSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGK  483
            DS+S+CLSKGLGAPVGS++VG ++FI RAR +RK LGGGMRQ G+L  A L   +++V +
Sbjct  191  DSISICLSKGLGAPVGSLLVGSRAFIARARRLRKMLGGGMRQAGILAQAGLFALEQHVAR  250

Query  482  LEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLIL  303
            L  DH++A+ LAEGL  + G+ +++A V+TN+VF  + KE +   +   K   E G+L  
Sbjct  251  LADDHRRARRLAEGLAALPGITLELAQVQTNMVFLQLAKEQSGPLLAFMK---ERGILF-  306

Query  302  PEGPKRIRFVIHHQISDTDV  243
              G   +R V H QI+D D+
Sbjct  307  -SGYGEMRLVTHLQITDDDI  325



>ref|WP_015049145.1| threonine aldolase [Simiduia agarivorans]
 gb|AFV00995.1| Low-specificity L-threonine aldolase [Simiduia agarivorans SA1 
= DSM 21679]
Length=337

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 99/153 (65%), Gaps = 5/153 (3%)
 Frame = -3

Query  662  DSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGK  483
            DS++VCLSKGLGAPVGS+++G K+FI RAR +RK LGGGMRQ G+L  A     + NV +
Sbjct  189  DSITVCLSKGLGAPVGSLLLGEKAFIQRARRLRKMLGGGMRQAGILAVAGQYALENNVAR  248

Query  482  LEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEME-LCKRLAEHGVLI  306
            L  DH  A+ LAEGLN++ G   D  +V TNIVF D+   A   +M+ + + LA+  +++
Sbjct  249  LAEDHANARFLAEGLNQLDGFSTDAYAVHTNIVFVDV---APAVDMQAIARELAQQNLIV  305

Query  305  LPEGPKRIRFVIHHQISDTDVQYALSRVQRAVT  207
             P G + +R V H  I+  DV+  L+ + R V 
Sbjct  306  SP-GYQGMRLVTHKDIARADVERLLAILARLVA  337



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1131443780880