BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF023F05

Length=780
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004241917.1|  PREDICTED: 60S ribosomal protein L15               350   1e-118   Solanum lycopersicum
ref|XP_004242022.1|  PREDICTED: 60S ribosomal protein L15               349   3e-118   Solanum lycopersicum
ref|XP_004236901.1|  PREDICTED: 60S ribosomal protein L15-like          348   7e-118   Solanum lycopersicum
ref|XP_009606590.1|  PREDICTED: 60S ribosomal protein L15               347   2e-117   Nicotiana tomentosiformis
ref|XP_009796395.1|  PREDICTED: 60S ribosomal protein L15-like          347   2e-117   Nicotiana sylvestris
gb|EYU24942.1|  hypothetical protein MIMGU_mgv1a013374mg                344   4e-116   Erythranthe guttata [common monkey flower]
gb|EYU43197.1|  hypothetical protein MIMGU_mgv1a012815mg                344   7e-116   Erythranthe guttata [common monkey flower]
ref|XP_011069801.1|  PREDICTED: 60S ribosomal protein L15               342   1e-115   Sesamum indicum [beniseed]
ref|XP_011076388.1|  PREDICTED: 60S ribosomal protein L15-like          341   3e-115   Sesamum indicum [beniseed]
ref|XP_006477158.1|  PREDICTED: 60S ribosomal protein L15-like          340   5e-115   Citrus sinensis [apfelsine]
sp|O82528.1|RL15_PETHY  RecName: Full=60S ribosomal protein L15         340   6e-115   Petunia x hybrida [garden petunia]
ref|XP_009607935.1|  PREDICTED: 60S ribosomal protein L15-like          339   2e-114   Nicotiana tomentosiformis
ref|XP_009764605.1|  PREDICTED: 60S ribosomal protein L15-like          339   2e-114   Nicotiana sylvestris
ref|XP_011017435.1|  PREDICTED: 60S ribosomal protein L15-like          340   2e-114   Populus euphratica
ref|XP_009768655.1|  PREDICTED: 60S ribosomal protein L15-like          339   2e-114   Nicotiana sylvestris
ref|XP_011076387.1|  PREDICTED: 60S ribosomal protein L15-like          338   5e-114   Sesamum indicum [beniseed]
ref|XP_006490145.1|  PREDICTED: 60S ribosomal protein L15-like          338   5e-114   Citrus sinensis [apfelsine]
gb|EPS66678.1|  hypothetical protein M569_08101                         338   5e-114   Genlisea aurea
ref|XP_011080625.1|  PREDICTED: 60S ribosomal protein L15-like          338   5e-114   Sesamum indicum [beniseed]
ref|XP_002301250.1|  60S ribosomal protein L15                          338   5e-114   Populus trichocarpa [western balsam poplar]
ref|XP_009618098.1|  PREDICTED: 60S ribosomal protein L15-like          338   7e-114   Nicotiana tomentosiformis
ref|XP_006421625.1|  hypothetical protein CICLE_v10005611mg             340   7e-114   
ref|XP_002304285.2|  60S ribosomal protein L15                          337   1e-113   Populus trichocarpa [western balsam poplar]
ref|XP_007209614.1|  hypothetical protein PRUPE_ppa011603mg             337   1e-113   Prunus persica
ref|XP_008369443.1|  PREDICTED: 60S ribosomal protein L15-1             338   2e-113   
ref|XP_009334550.1|  PREDICTED: 60S ribosomal protein L15-1             337   3e-113   Pyrus x bretschneideri [bai li]
ref|XP_010667037.1|  PREDICTED: 60S ribosomal protein L15-1             336   4e-113   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006369001.1|  60S ribosomal protein L15                          336   4e-113   Populus trichocarpa [western balsam poplar]
ref|XP_011031909.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    336   4e-113   Populus euphratica
ref|XP_010933636.1|  PREDICTED: 60S ribosomal protein L15-1             335   1e-112   Elaeis guineensis
gb|KHG00889.1|  60S ribosomal L15                                       335   1e-112   Gossypium arboreum [tree cotton]
ref|XP_002510977.1|  ribosomal protein L15, putative                    334   1e-112   Ricinus communis
ref|XP_006440278.1|  hypothetical protein CICLE_v10024403mg             335   1e-112   
ref|XP_007157273.1|  hypothetical protein PHAVU_002G057000g             334   1e-112   Phaseolus vulgaris [French bean]
ref|XP_010686789.1|  PREDICTED: 60S ribosomal protein L15               334   1e-112   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008775187.1|  PREDICTED: 60S ribosomal protein L15               334   2e-112   Phoenix dactylifera
gb|EPS59253.1|  hypothetical protein M569_15555                         334   2e-112   Genlisea aurea
gb|KDP39891.1|  hypothetical protein JCGZ_03422                         334   2e-112   Jatropha curcas
gb|KHG22797.1|  60S ribosomal L15-1 -like protein                       334   2e-112   Gossypium arboreum [tree cotton]
ref|XP_010919627.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    333   4e-112   Elaeis guineensis
ref|XP_007038342.1|  Ribosomal protein L23/L15e family protein          333   5e-112   
ref|XP_008798983.1|  PREDICTED: 60S ribosomal protein L15-like          333   7e-112   Phoenix dactylifera
ref|XP_010933963.1|  PREDICTED: 60S ribosomal protein L15-like          333   7e-112   Elaeis guineensis
ref|XP_011001078.1|  PREDICTED: 60S ribosomal protein L15-like          332   8e-112   Populus euphratica
ref|XP_004146916.1|  PREDICTED: 60S ribosomal protein L15-like is...    332   8e-112   Cucumis sativus [cucumbers]
gb|KDP22442.1|  hypothetical protein JCGZ_26273                         332   1e-111   Jatropha curcas
ref|XP_008437057.1|  PREDICTED: 60S ribosomal protein L15-2 isofo...    332   2e-111   Cucumis melo [Oriental melon]
ref|XP_010934657.1|  PREDICTED: 60S ribosomal protein L15-1-like        332   2e-111   Elaeis guineensis
ref|XP_002530661.1|  ribosomal protein L15, putative                    331   3e-111   Ricinus communis
ref|XP_010264371.1|  PREDICTED: 60S ribosomal protein L15-like          331   3e-111   Nelumbo nucifera [Indian lotus]
ref|XP_008796124.1|  PREDICTED: 60S ribosomal protein L15-2             330   5e-111   Phoenix dactylifera
ref|XP_002277836.1|  PREDICTED: 60S ribosomal protein L15-1             330   5e-111   Vitis vinifera
ref|XP_004152395.1|  PREDICTED: 60S ribosomal protein L15-like is...    330   6e-111   
emb|CAN68893.1|  hypothetical protein VITISV_004609                     330   9e-111   Vitis vinifera
gb|AGL08210.1|  60S ribosomal protein L15                               330   1e-110   Arachis hypogaea [goober]
ref|XP_010529971.1|  PREDICTED: 60S ribosomal protein L15-1             329   1e-110   Tarenaya hassleriana [spider flower]
ref|XP_010258850.1|  PREDICTED: 60S ribosomal protein L15               329   1e-110   Nelumbo nucifera [Indian lotus]
ref|XP_008452210.1|  PREDICTED: 60S ribosomal protein L15-2-like        329   1e-110   Cucumis melo [Oriental melon]
ref|XP_010053499.1|  PREDICTED: 60S ribosomal protein L15-2             329   2e-110   Eucalyptus grandis [rose gum]
ref|XP_007155679.1|  hypothetical protein PHAVU_003G222000g             329   2e-110   Phaseolus vulgaris [French bean]
ref|XP_010107162.1|  60S ribosomal protein L15                          329   2e-110   Morus notabilis
gb|ACV50439.1|  ribosomal protein L15                                   328   3e-110   Jatropha curcas
ref|XP_003635402.1|  PREDICTED: 60S ribosomal protein L15-1             328   3e-110   Vitis vinifera
ref|XP_002268465.1|  PREDICTED: 60S ribosomal protein L15-1-like        328   3e-110   Vitis vinifera
ref|XP_009406701.1|  PREDICTED: 60S ribosomal protein L15-1-like        328   3e-110   Musa acuminata subsp. malaccensis [pisang utan]
pdb|3J61|N  Chain N, Localization Of The Large Subunit Ribosomal ...    328   5e-110   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009399011.1|  PREDICTED: 60S ribosomal protein L15-1-like        328   6e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008437056.1|  PREDICTED: 60S ribosomal protein L15-2 isofo...    328   6e-110   
ref|XP_010062398.1|  PREDICTED: 60S ribosomal protein L15-1             328   7e-110   Eucalyptus grandis [rose gum]
ref|NP_001050612.1|  Os03g0598800                                       328   7e-110   
ref|XP_009418976.1|  PREDICTED: 60S ribosomal protein L15-1             327   8e-110   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG16565.1|  60S ribosomal L15-1 -like protein                       327   9e-110   Gossypium arboreum [tree cotton]
ref|XP_006650289.1|  PREDICTED: 60S ribosomal protein L15-like          327   1e-109   Oryza brachyantha
ref|XP_006838929.1|  hypothetical protein AMTR_s00002p00270230          327   1e-109   Amborella trichopoda
gb|KJB51842.1|  hypothetical protein B456_008G234000                    327   1e-109   Gossypium raimondii
ref|XP_006837338.1|  hypothetical protein AMTR_s00111p00086580          327   1e-109   Amborella trichopoda
ref|NP_001235890.1|  uncharacterized protein LOC100305473               327   2e-109   Glycine max [soybeans]
gb|ADA67930.1|  putative 60S ribosomal protein L15                      327   2e-109   Wolffia arrhiza
ref|XP_009398340.1|  PREDICTED: 60S ribosomal protein L15-1-like        327   2e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010539086.1|  PREDICTED: 60S ribosomal protein L15-1-like        326   2e-109   Tarenaya hassleriana [spider flower]
ref|XP_010104882.1|  60S ribosomal protein L15                          328   2e-109   
ref|XP_010538411.1|  PREDICTED: 60S ribosomal protein L15-1-like        326   3e-109   Tarenaya hassleriana [spider flower]
gb|KHG20796.1|  60S ribosomal L15-1 -like protein                       326   3e-109   Gossypium arboreum [tree cotton]
ref|XP_009352987.1|  PREDICTED: 60S ribosomal protein L15-like          326   3e-109   Pyrus x bretschneideri [bai li]
gb|KHN44085.1|  60S ribosomal protein L15                               326   3e-109   Glycine soja [wild soybean]
gb|ACU24496.1|  unknown                                                 326   3e-109   Glycine max [soybeans]
ref|XP_010540825.1|  PREDICTED: 60S ribosomal protein L15-1-like        325   4e-109   Tarenaya hassleriana [spider flower]
ref|XP_009408522.1|  PREDICTED: 60S ribosomal protein L15-1-like        325   4e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003549922.1|  PREDICTED: 60S ribosomal protein L15-1-like        325   5e-109   
emb|CBI16601.3|  unnamed protein product                                325   6e-109   Vitis vinifera
ref|XP_006655163.1|  PREDICTED: 60S ribosomal protein L15-like          325   6e-109   
gb|ACF88005.1|  unknown                                                 325   6e-109   Zea mays [maize]
ref|XP_007039793.1|  Ribosomal protein L23/L15e family protein is...    325   8e-109   Theobroma cacao [chocolate]
ref|NP_001150716.1|  60S ribosomal protein L15                          325   1e-108   
ref|XP_002460708.1|  hypothetical protein SORBIDRAFT_02g033530          324   2e-108   Sorghum bicolor [broomcorn]
ref|NP_001236804.1|  uncharacterized protein LOC100306052               324   2e-108   
ref|NP_001148602.1|  60S ribosomal protein L15                          324   2e-108   Zea mays [maize]
gb|ACF87670.1|  unknown                                                 323   4e-108   Zea mays [maize]
ref|NP_001148378.1|  60S ribosomal protein L15                          323   5e-108   
ref|XP_007039791.1|  Ribosomal protein L23/L15e family protein is...    323   5e-108   
ref|NP_001150386.1|  60S ribosomal protein L15                          323   5e-108   
gb|EEE63068.1|  hypothetical protein OsJ_17876                          329   5e-108   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006837287.1|  hypothetical protein AMTR_s00111p00023340          323   6e-108   
ref|XP_002461521.1|  hypothetical protein SORBIDRAFT_02g004020          322   7e-108   Sorghum bicolor [broomcorn]
ref|XP_008241281.1|  PREDICTED: 60S ribosomal protein L15-like          322   9e-108   Prunus mume [ume]
gb|EEC78893.1|  hypothetical protein OsI_19264                          328   1e-107   Oryza sativa Indica Group [Indian rice]
ref|XP_004491939.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    320   8e-107   Cicer arietinum [garbanzo]
gb|AFK46983.1|  unknown                                                 320   8e-107   Lotus japonicus
gb|ACJ84067.1|  unknown                                                 320   9e-107   Medicago truncatula
sp|O65050.1|RL15A_PICMA  RecName: Full=60S ribosomal protein L15-1      320   9e-107   Picea mariana [black spruce]
gb|AFK49215.1|  unknown                                                 320   1e-106   Medicago truncatula
ref|XP_004299420.1|  PREDICTED: 60S ribosomal protein L15-1             320   1e-106   Fragaria vesca subsp. vesca
ref|XP_007202591.1|  hypothetical protein PRUPE_ppa011597mg             319   1e-106   Prunus persica
sp|O65082.1|RL15B_PICMA  RecName: Full=60S ribosomal protein L15-2      319   2e-106   Picea mariana [black spruce]
ref|XP_008360544.1|  PREDICTED: 60S ribosomal protein L15               319   2e-106   
ref|XP_003593619.1|  Ribosomal protein L15                              320   3e-106   Medicago truncatula
dbj|BAJ95856.1|  predicted protein                                      318   3e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004955579.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    318   3e-106   Setaria italica
ref|XP_003573847.1|  PREDICTED: 60S ribosomal protein L15-2             318   4e-106   Brachypodium distachyon [annual false brome]
ref|XP_004957717.1|  PREDICTED: 60S ribosomal protein L15-1-like        317   9e-106   Setaria italica
ref|XP_004491938.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    317   1e-105   
ref|XP_006282719.1|  hypothetical protein CARUB_v10005752mg             317   1e-105   Capsella rubella
ref|NP_193470.1|  60S ribosomal protein L15-2                           317   1e-105   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193405.1|  60S ribosomal protein L15-1                           317   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002868106.1|  60S ribosomal protein L15                          317   2e-105   
ref|XP_010434676.1|  PREDICTED: 60S ribosomal protein L15-1-like        316   2e-105   Camelina sativa [gold-of-pleasure]
ref|XP_009108318.1|  PREDICTED: 60S ribosomal protein L15-1-like        316   2e-105   Brassica rapa
gb|AAK67641.1|  ribosomal protein L15                                   316   3e-105   Homo sapiens [man]
gb|KFK32179.1|  hypothetical protein AALP_AA6G207900                    316   3e-105   Arabis alpina [alpine rockcress]
emb|CDX90499.1|  BnaA03g42820D                                          318   3e-105   
ref|XP_009136839.1|  PREDICTED: 60S ribosomal protein L15-1             315   4e-105   Brassica rapa
emb|CDY53647.1|  BnaA08g30370D                                          317   4e-105   Brassica napus [oilseed rape]
dbj|BAD22764.1|  ribosomal protein                                      315   4e-105   Bromus inermis [awnless brome grass]
ref|XP_009145572.1|  PREDICTED: 60S ribosomal protein L15-1             315   5e-105   Brassica rapa
ref|XP_001764493.1|  predicted protein                                  315   5e-105   
emb|CDY60707.1|  BnaC07g50070D                                          318   5e-105   Brassica napus [oilseed rape]
emb|CDY54747.1|  BnaAnng13420D                                          317   6e-105   Brassica napus [oilseed rape]
gb|AFK37409.1|  unknown                                                 315   7e-105   Lotus japonicus
ref|XP_009136806.1|  PREDICTED: 60S ribosomal protein L15-1-like        314   1e-104   Brassica rapa
ref|XP_004512167.1|  PREDICTED: 60S ribosomal protein L15-1-like        314   2e-104   Cicer arietinum [garbanzo]
ref|XP_003563105.1|  PREDICTED: 60S ribosomal protein L15-2             314   2e-104   Brachypodium distachyon [annual false brome]
ref|XP_001753036.1|  predicted protein                                  314   2e-104   
ref|XP_002879569.1|  60S ribosomal protein L15                          313   2e-104   Arabidopsis lyrata subsp. lyrata
emb|CDY50842.1|  BnaC08g47880D                                          315   3e-104   Brassica napus [oilseed rape]
emb|CDY40505.1|  BnaC01g20070D                                          317   3e-104   Brassica napus [oilseed rape]
emb|CAB10520.1|  ribosomal protein                                      314   3e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001771165.1|  predicted protein                                  313   3e-104   
emb|CDP10996.1|  unnamed protein product                                311   7e-104   Coffea canephora [robusta coffee]
gb|KDO49937.1|  hypothetical protein CISIN_1g028757mg                   311   2e-103   Citrus sinensis [apfelsine]
ref|XP_001757563.1|  predicted protein                                  311   3e-103   
emb|CDP11952.1|  unnamed protein product                                307   3e-102   Coffea canephora [robusta coffee]
ref|XP_002961462.1|  hypothetical protein SELMODRAFT_270259             305   4e-101   Selaginella moellendorffii
gb|KDO49939.1|  hypothetical protein CISIN_1g028757mg                   303   1e-100   Citrus sinensis [apfelsine]
gb|EMS52882.1|  60S ribosomal protein L15                               306   2e-100   Triticum urartu
ref|XP_002971348.1|  hypothetical protein SELMODRAFT_270900             303   2e-100   Selaginella moellendorffii
ref|XP_011031911.1|  PREDICTED: 60S ribosomal protein L15 isoform X3    302   3e-100   Populus euphratica
ref|XP_010539199.1|  PREDICTED: 60S ribosomal protein L15-1-like        301   1e-99    Tarenaya hassleriana [spider flower]
ref|XP_010919628.1|  PREDICTED: 60S ribosomal protein L15 isoform X2    298   1e-98    
ref|XP_004955578.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    299   2e-98    
ref|XP_008234416.1|  PREDICTED: 60S ribosomal protein L15-like          297   8e-98    Prunus mume [ume]
ref|XP_004152396.1|  PREDICTED: 60S ribosomal protein L15-like is...    295   2e-97    
ref|XP_010516773.1|  PREDICTED: 60S ribosomal protein L15-2-like        296   3e-97    
gb|AAT85124.1|  putative 60s ribosomal protein L15                      294   6e-97    Oryza sativa Japonica Group [Japonica rice]
emb|CBI25842.3|  unnamed protein product                                294   7e-97    Vitis vinifera
ref|XP_002946380.1|  component of cytosolic 80S ribosome and 60S ...    294   8e-97    Volvox carteri f. nagariensis
emb|CBI38664.3|  unnamed protein product                                293   9e-97    Vitis vinifera
tpg|DAA62721.1|  TPA: hypothetical protein ZEAMMB73_667917              291   7e-96    
ref|XP_001701780.1|  ribosomal protein L15, component of cytosoli...    291   1e-95    Chlamydomonas reinhardtii
gb|KJB39740.1|  hypothetical protein B456_007G028600                    291   1e-95    Gossypium raimondii
ref|XP_005845356.1|  hypothetical protein CHLNCDRAFT_32281              291   1e-95    Chlorella variabilis
ref|XP_005646118.1|  ribosomal protein L15e                             290   6e-95    Coccomyxa subellipsoidea C-169
gb|EMT29287.1|  60S ribosomal protein L15                               291   9e-95    
gb|AFK40278.1|  unknown                                                 288   2e-94    Lotus japonicus
ref|XP_011401241.1|  60S ribosomal protein L15                          292   1e-92    Auxenochlorella protothecoides
emb|CDX76573.1|  BnaA08g08270D                                          281   8e-92    
emb|CDY59531.1|  BnaCnng35130D                                          280   1e-91    Brassica napus [oilseed rape]
emb|CDY09632.1|  BnaC07g34290D                                          280   1e-91    Brassica napus [oilseed rape]
gb|KCW90850.1|  hypothetical protein EUGRSUZ_A02903                     277   2e-90    Eucalyptus grandis [rose gum]
gb|AAF67144.1|AF230646_1  large subunit ribosomal protein L15           278   3e-90    Syntrichia ruralis
emb|CEG01197.1|  Ribosomal protein L15e, conserved site                 278   3e-90    Ostreococcus tauri
ref|XP_003056552.1|  predicted protein                                  277   4e-90    Micromonas pusilla CCMP1545
gb|EMT18644.1|  60S ribosomal protein L15                               274   3e-89    
ref|XP_001416062.1|  Ribosomal protein L15, component of cytosoli...    274   5e-89    Ostreococcus lucimarinus CCE9901
gb|KDD73446.1|  ribosomal L15                                           271   1e-87    Helicosporidium sp. ATCC 50920
ref|XP_005717822.1|  60S ribosomal protein L15                          265   3e-85    Chondrus crispus [carageen]
ref|XP_004348091.1|  ribosomal protein L15                              265   3e-85    Capsaspora owczarzaki ATCC 30864
gb|ACU45020.1|  60s ribosomal protein L15                               264   7e-85    Pfiesteria piscicida
gb|KIY95038.1|  60S ribosomal protein L15-1                             259   3e-83    Monoraphidium neglectum
ref|XP_005703122.1|  60S ribosomal protein L15e isoform 2               258   8e-83    Galdieria sulphuraria
ref|XP_503229.1|  60S ribosomal protein L15                             258   2e-82    Yarrowia lipolytica CLIB122
ref|XP_762879.1|  60S ribosomal protein L15                             255   1e-81    Theileria parva strain Muguga
ref|XP_005534852.1|  60S ribosomal protein L15                          255   2e-81    Cyanidioschyzon merolae strain 10D
ref|XP_003382517.1|  PREDICTED: 60S ribosomal protein L15-like          255   2e-81    Amphimedon queenslandica
ref|XP_003884098.1|  hypothetical protein NCLIV_045010                  255   2e-81    Neospora caninum Liverpool
ref|XP_007511637.1|  60S ribosomal protein L15                          254   3e-81    Bathycoccus prasinos
gb|EPE06282.1|  60s ribosomal protein l15                               254   3e-81    Ophiostoma piceae UAMH 11346
ref|XP_002366469.1|  ribosomal protein L15, putative                    254   4e-81    Toxoplasma gondii ME49
ref|XP_009691154.1|  60S ribosomal protein L15                          254   4e-81    Theileria orientalis strain Shintoku
ref|XP_006822011.1|  PREDICTED: 60S ribosomal protein L15-like is...    254   6e-81    Saccoglossus kowalevskii
gb|ERS96332.1|  60S ribosomal protein L15                               253   1e-80    Sporothrix schenckii ATCC 58251
ref|XP_006690758.1|  ribosomal protein L15-like protein                 253   2e-80    Chaetomium thermophilum var. thermophilum DSM 1495
gb|EFX04788.1|  60S ribosomal protein l15                               252   3e-80    Grosmannia clavigera kw1407
gb|ESW97334.1|  60S ribosomal protein L15-B                             252   4e-80    Ogataea parapolymorpha DL-1
ref|XP_001624083.1|  predicted protein                                  251   5e-80    Nematostella vectensis
gb|ACR24948.1|  ribosomal protein L15                                   251   1e-79    Lepidochitona cinerea
gb|KIV95599.1|  60S ribosomal protein L15                               251   1e-79    Exophiala mesophila
gb|KIN02516.1|  hypothetical protein OIDMADRAFT_18358                   250   1e-79    Oidiodendron maius Zn
emb|CEJ94099.1|  Putative Ribosomal protein L15                         250   1e-79    Torrubiella hemipterigena
gb|KEF63356.1|  60S ribosomal protein L15                               250   1e-79    Exophiala aquamarina CBS 119918
ref|XP_008713401.1|  60S ribosomal protein L15                          250   1e-79    Cyphellophora europaea CBS 101466
gb|KIX01331.1|  60S ribosomal protein L15                               250   2e-79    Rhinocladiella mackenziei CBS 650.93
ref|XP_002545593.1|  60S ribosomal protein L15-B                        250   2e-79    Candida tropicalis MYA-3404
gb|EQL00837.1|  Ribosomal protein L15e                                  249   3e-79    Ophiocordyceps sinensis CO18
ref|XP_004221219.1|  60S ribosomal protein L15-1                        249   4e-79    Plasmodium cynomolgi strain B
gb|EOA94531.1|  60S ribosomal protein L15                               249   4e-79    Anas platyrhynchos [duck]
gb|KGQ83010.1|  60S ribosomal protein L15-A                             249   5e-79    Candida albicans P37005
gb|KEQ99844.1|  hypothetical protein AUEXF2481DRAFT_25720               251   5e-79    Aureobasidium subglaciale EXF-2481
ref|XP_009159952.1|  60S ribosomal protein L15                          249   6e-79    Exophiala dermatitidis NIH/UT8656
ref|XP_001615040.1|  60S ribosomal protein L15-1                        248   7e-79    Plasmodium vivax
ref|XP_957199.1|  60S ribosomal protein L15                             248   7e-79    Neurospora crassa OR74A
ref|XP_717445.1|  likely cytosolic ribosomal protein L15                248   8e-79    
ref|XP_007373844.1|  hypothetical protein SPAPADRAFT_59682              248   8e-79    Spathaspora passalidarum NRRL Y-27907
ref|XP_008725811.1|  60S ribosomal protein L15                          248   8e-79    Cladophialophora carrionii CBS 160.54
ref|XP_002162844.1|  PREDICTED: 60S ribosomal protein L15-like          248   8e-79    Hydra vulgaris
ref|XP_001525424.1|  60S ribosomal protein L15-B                        248   8e-79    Lodderomyces elongisporus NRRL YB-4239
gb|KIE03942.1|  Ribosomal protein L15e                                  248   9e-79    Metarhizium majus ARSEF 297
ref|XP_004377436.1|  PREDICTED: 60S ribosomal protein L15 isoform 1     248   1e-78    
ref|XP_001541513.1|  60S ribosomal protein L15                          248   1e-78    Histoplasma capsulatum NAm1
ref|XP_008816354.1|  ribosomal L15                                      248   1e-78    Plasmodium inui San Antonio 1
ref|XP_002808654.1|  60S ribosomal protein L15, putative                248   1e-78    Plasmodium falciparum 3D7
ref|XP_002598589.1|  hypothetical protein BRAFLDRAFT_113717             248   1e-78    Branchiostoma floridae
gb|KIW41910.1|  60S ribosomal protein L15                               250   1e-78    Exophiala oligosperma
gb|KEQ59346.1|  60S ribosomal protein L15                               248   2e-78    Aureobasidium melanogenum CBS 110374
ref|XP_003869213.1|  Rpl15a ribosomal protein                           248   2e-78    Candida orthopsilosis Co 90-125
ref|XP_003415776.1|  PREDICTED: 60S ribosomal protein L15               248   2e-78    Loxodonta africana [African bush elephant]
ref|XP_004198963.1|  Piso0_002360                                       247   2e-78    
ref|XP_005029295.1|  PREDICTED: 60S ribosomal protein L15               247   2e-78    
ref|XP_002258209.1|  ribosomal protein l15                              247   2e-78    Plasmodium knowlesi strain H
ref|XP_007812013.1|  60S ribosomal protein L15                          247   2e-78    Metarhizium acridum CQMa 102
gb|EMS24660.1|  60S ribosomal protein l15                               247   2e-78    Rhodotorula toruloides NP11
ref|XP_007788991.1|  putative 60s ribosomal protein l15 protein         247   3e-78    
gb|EPQ66314.1|  Protein component of the large (60S) ribosomal su...    247   3e-78    Blumeria graminis f. sp. tritici 96224
gb|KID77747.1|  Ribosomal protein L15e                                  247   3e-78    Metarhizium brunneum ARSEF 3297
gb|KIX93106.1|  60S ribosomal protein L15                               247   3e-78    Fonsecaea multimorphosa CBS 102226
emb|CCE42581.1|  hypothetical protein CPAR2_202240                      247   3e-78    Candida parapsilosis
ref|XP_003233932.1|  60S ribosomal protein L15                          247   3e-78    Trichophyton rubrum CBS 118892
ref|XP_010986099.1|  PREDICTED: 60S ribosomal protein L15               247   3e-78    
gb|ETW38445.1|  hypothetical protein PFTANZ_00876                       247   3e-78    Plasmodium falciparum Tanzania (2000708)
gb|KIW07591.1|  60S ribosomal protein L15                               247   3e-78    Verruconis gallopava
ref|XP_007421748.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    247   3e-78    Python bivittatus
ref|XP_007804051.1|  60S ribosomal protein L15                          247   3e-78    Endocarpon pusillum Z07020
ref|XP_009226880.1|  60S ribosomal protein L15                          247   4e-78    Gaeumannomyces tritici R3-111a-1
ref|XP_007505229.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    247   4e-78    Monodelphis domestica
ref|XP_003657786.1|  60S ribosomal protein L15                          246   4e-78    Thielavia terrestris NRRL 8126
ref|XP_007068583.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    246   4e-78    
gb|EEQ87750.1|  60S ribosomal protein L15                               246   4e-78    
ref|XP_007759046.1|  60S ribosomal protein L15                          246   4e-78    Cladophialophora yegresii CBS 114405
ref|XP_009502210.1|  PREDICTED: 60S ribosomal protein L15               246   4e-78    Phalacrocorax carbo [common cormorant]
ref|XP_003666937.1|  hypothetical protein MYCTH_2312102                 246   5e-78    Thermothelomyces thermophila ATCC 42464
ref|NP_001292094.1|  60S ribosomal protein L15                          246   5e-78    Gallus gallus [bantam]
ref|XP_002623870.1|  60S ribosomal protein L15                          246   5e-78    
gb|KFO70740.1|  60S ribosomal protein L15                               246   5e-78    Cuculus canorus
gb|KIW20891.1|  60S ribosomal protein L15                               246   5e-78    Exophiala spinifera
ref|XP_002797110.1|  60S ribosomal protein L15                          246   5e-78    Paracoccidioides lutzii Pb01
ref|XP_007925894.1|  hypothetical protein MYCFIDRAFT_58365              246   6e-78    Pseudocercospora fijiensis CIRAD86
emb|CAH91644.1|  hypothetical protein                                   246   6e-78    Pongo abelii [orang utan]
gb|KHN95867.1|  Ribosomal protein L15e                                  246   6e-78    Metarhizium album ARSEF 1941
tpg|DAA16199.1|  TPA: ribosomal protein L15-like                        246   6e-78    Bos taurus [bovine]
gb|ENH84342.1|  60s ribosomal protein l15                               246   6e-78    
ref|NP_001080766.1|  ribosomal protein L15                              246   7e-78    Xenopus laevis [clawed frog]
ref|XP_003226267.1|  PREDICTED: 60S ribosomal protein L15               246   8e-78    Anolis carolinensis [Carolina anole]
ref|XP_007872719.1|  ribosomal L15                                      246   8e-78    Pneumocystis murina B123
ref|XP_004339224.1|  ribosomal L15, putative                            245   8e-78    Acanthamoeba castellanii str. Neff
gb|AAN52373.1|  ribosomal protein L15                                   246   9e-78    Branchiostoma belcheri
ref|XP_001909718.1|  hypothetical protein                               246   9e-78    Podospora anserina S mat+
ref|NP_001266930.1|  60S ribosomal protein L15                          246   1e-77    Pan troglodytes
ref|NP_079862.1|  60S ribosomal protein L15                             246   1e-77    Mus musculus [mouse]
gb|AAV38477.1|  ribosomal protein L15                                   246   1e-77    synthetic construct
gb|KIW77490.1|  60S ribosomal protein L15                               246   1e-77    Fonsecaea pedrosoi CBS 271.37
gb|KEY67005.1|  hypothetical protein S7711_05126                        246   1e-77    
tpg|DAA32565.1|  TPA: ribosomal protein L15-like                        246   1e-77    
ref|XP_006986589.1|  PREDICTED: 60S ribosomal protein L15-like          246   1e-77    
ref|XP_002759698.1|  PREDICTED: 60S ribosomal protein L15               245   1e-77    
ref|XP_007737355.1|  60S ribosomal protein L15                          245   1e-77    
emb|CCF41498.1|  60S ribosomal protein L15                              245   1e-77    
ref|XP_003350788.1|  60S ribosomal protein L15                          245   1e-77    
ref|XP_001545571.1|  60S ribosomal protein L15                          245   1e-77    
ref|XP_455872.1|  60S ribosomal protein L15                             245   1e-77    
sp|Q7T3N1.3|RL15_MYLPI  RecName: Full=60S ribosomal protein L15         245   1e-77    
gb|AAS59857.1|  ribosomal protein L15                                   245   1e-77    
emb|CEP61029.1|  LALA0S02e05138g1_1                                     245   1e-77    
ref|XP_001245521.1|  60S ribosomal protein L15                          245   1e-77    
ref|XP_004832605.1|  60S ribosomal protein L15, putative                245   1e-77    
ref|NP_001003447.1|  60S ribosomal protein L15                          245   1e-77    
ref|XP_009937095.1|  PREDICTED: 60S ribosomal protein L15               245   1e-77    
ref|XP_006965992.1|  60s ribosomal protein L152/L15B                    245   1e-77    
gb|KFR14077.1|  60S ribosomal protein L15                               245   1e-77    
ref|XP_008831372.1|  PREDICTED: 60S ribosomal protein L15               245   1e-77    
ref|XP_007671745.1|  hypothetical protein BAUCODRAFT_566278             245   1e-77    
gb|EWM27504.1|  Ribosomal protein L15e                                  245   1e-77    
gb|KFY50714.1|  hypothetical protein V496_09238                         246   1e-77    
ref|XP_007835687.1|  60S ribosomal protein L15                          245   2e-77    
ref|XP_011227834.1|  PREDICTED: 60S ribosomal protein L15               245   2e-77    
emb|CDO96181.1|  unnamed protein product                                245   2e-77    
ref|XP_008596519.1|  60S ribosomal protein L15                          245   2e-77    
ref|XP_002583622.1|  60S ribosomal protein L15                          245   2e-77    
ref|XP_008080630.1|  Ribosomal proteins S24e, L23 and L15e              245   2e-77    
ref|XP_007724541.1|  60S ribosomal protein L15                          245   2e-77    
gb|ETE59074.1|  60S ribosomal protein L15                               245   2e-77    
emb|CCX31468.1|  Similar to 60S ribosomal protein L15; acc. no. Q...    244   2e-77    
gb|AAX36167.1|  ribosomal protein L15                                   245   2e-77    
ref|XP_002553867.1|  60S ribosomal protein L15                          244   2e-77    
emb|CCQ18640.1|  60S ribosomal protein L15                              244   2e-77    
emb|CAJ82575.1|  ribosomal protein L15                                  244   2e-77    
ref|XP_001225510.1|  60S ribosomal protein L15                          244   2e-77    
gb|EHK15888.1|  hypothetical protein TRIVIDRAFT_217112                  244   3e-77    
gb|KFM13801.1|  60S ribosomal protein L15                               244   3e-77    
ref|XP_003936085.1|  PREDICTED: 60S ribosomal protein L15               244   3e-77    
ref|XP_009887238.1|  PREDICTED: 60S ribosomal protein L15               244   3e-77    
ref|XP_005040971.1|  PREDICTED: 60S ribosomal protein L15               244   3e-77    
ref|XP_007344080.1|  60S ribosomal protein L15                          244   3e-77    
gb|AAG44837.1|  60S ribosomal protein L15                               244   3e-77    
ref|XP_001644954.1|  hypothetical protein Kpol_1025p16                  244   3e-77    
gb|ESZ93952.1|  60S ribosomal protein L15                               244   3e-77    
ref|XP_007741637.1|  60S ribosomal protein L15                          244   3e-77    
gb|KGL96424.1|  60S ribosomal protein L15                               244   3e-77    
gb|KFO06064.1|  60S ribosomal protein L15                               244   3e-77    
ref|XP_011414691.1|  PREDICTED: 60S ribosomal protein L15-like          244   3e-77    
ref|XP_006021253.1|  PREDICTED: 60S ribosomal protein L15               244   3e-77    
gb|AAH14837.1|  Ribosomal protein L15                                   244   3e-77    
dbj|BAE31437.1|  unnamed protein product                                244   3e-77    
ref|XP_002616462.1|  conserved hypothetical protein                     244   3e-77    
gb|ADO28804.1|  60S ribosomal protein l15                               244   3e-77    
ref|XP_007595397.1|  ribosomal L15                                      244   3e-77    
ref|XP_001386507.1|  60S ribosomal protein L15                          244   3e-77    
ref|XP_001212942.1|  60S ribosomal protein L15                          244   3e-77    
ref|XP_004634243.1|  PREDICTED: 60S ribosomal protein L15               244   4e-77    
ref|XP_003709740.1|  60S ribosomal protein L15                          244   4e-77    
gb|KFA61144.1|  hypothetical protein S40285_02203                       244   4e-77    
ref|XP_461011.1|  60S ribosomal protein L15                             244   4e-77    
gb|EUD70551.1|  ribosomal L15                                           244   4e-77    
ref|XP_003686547.1|  60S ribosomal protein L15                          244   4e-77    
gb|EFQ32205.1|  ribosomal L15                                           244   5e-77    
sp|Q7T3N7.3|RL15_CYPCA  RecName: Full=60S ribosomal protein L15         244   5e-77    
gb|ELR05722.1|  60S ribosomal protein L15                               244   5e-77    
dbj|BAO40104.1|  60S ribosomal protein L15-B                            244   5e-77    
ref|NP_001187212.1|  60S ribosomal protein L15                          244   6e-77    
ref|XP_003281126.1|  PREDICTED: 60S ribosomal protein L15-like is...    244   6e-77    
dbj|BAB79461.1|  ribosomal protein L15                                  244   6e-77    
ref|XP_006635829.1|  PREDICTED: 60S ribosomal protein L15-like          244   6e-77    
gb|KHJ35835.1|  putative 60s ribosomal protein l15                      243   6e-77    
gb|ERE87094.1|  60S ribosomal protein L15-like protein                  243   6e-77    
gb|AAX43023.1|  ribosomal protein L15                                   243   6e-77    
ref|XP_001484435.1|  60S ribosomal protein L15-A                        243   7e-77    
gb|KFY89477.1|  hypothetical protein V500_05675                         243   7e-77    
sp|Q7T3P0.3|RL15_HYPNO  RecName: Full=60S ribosomal protein L15         243   7e-77    
ref|XP_003856171.1|  60S ribosomal protein L15                          243   8e-77    
gb|AAX08723.1|  ribosomal protein L15                                   243   9e-77    
ref|XP_007589065.1|  putative 60s ribosomal protein l15 protein         243   9e-77    
ref|XP_003647297.1|  hypothetical protein Ecym_6084                     243   9e-77    
gb|KIV77401.1|  60S ribosomal protein L15                               252   1e-76    
ref|XP_003837801.1|  hypothetical protein LEMA_P121210.1                244   1e-76    
dbj|BAB27107.1|  unnamed protein product                                243   1e-76    
ref|XP_003455275.1|  PREDICTED: 60S ribosomal protein L15-like is...    243   1e-76    
gb|EKG10086.1|  Ribosomal protein L15e                                  243   1e-76    
gb|KIW51029.1|  60S ribosomal protein L15                               243   1e-76    
gb|KGK38943.1|  hypothetical protein JL09_g1954                         243   1e-76    
emb|CDM26463.1|  60S ribosomal protein L15                              243   1e-76    
ref|NP_985761.1|  60S ribosomal protein L15                             243   1e-76    
ref|XP_001265199.1|  60S ribosomal protein L15                          243   1e-76    
ref|NP_001232361.1|  putative 60S ribosomal protein L10                 243   2e-76    
ref|XP_008630208.1|  PREDICTED: 60S ribosomal protein L15               243   2e-76    
gb|KEZ43818.1|  hypothetical protein SAPIO_CDS3973                      242   2e-76    
ref|XP_007762548.1|  ribosomal protein L15e                             242   2e-76    
ref|XP_008020295.1|  hypothetical protein SETTUDRAFT_40911              242   2e-76    
ref|XP_006670037.1|  60S ribosomal protein L15                          242   2e-76    
sp|P61368.2|RL15_HYDVU  RecName: Full=60S ribosomal protein L15         242   2e-76    
ref|XP_004199814.1|  Piso0_002360                                       242   2e-76    
ref|XP_006686733.1|  hypothetical protein CANTEDRAFT_114246             242   2e-76    
ref|XP_007378639.1|  60S ribosomal protein L15                          242   2e-76    
ref|XP_010136517.1|  PREDICTED: 60S ribosomal protein L15               242   2e-76    
ref|XP_007296945.1|  60S ribosomal protein L15                          242   2e-76    
emb|CAG00252.1|  unnamed protein product                                242   3e-76    
ref|XP_007915208.1|  putative 60s ribosomal protein l15 protein         242   3e-76    
sp|P61369.2|RL15_SILAS  RecName: Full=60S ribosomal protein L15         242   3e-76    
emb|CCD34791.1|  hypothetical protein BofuT4_P098500.1                  245   3e-76    
ref|NP_001011478.1|  ribosomal protein L15                              242   3e-76    
gb|KIW64984.1|  60S ribosomal protein L15                               253   3e-76    
gb|EJT43462.1|  RPL15B-like protein                                     242   3e-76    
ref|XP_003969112.1|  PREDICTED: 60S ribosomal protein L15-like          242   3e-76    
gb|EME46361.1|  hypothetical protein DOTSEDRAFT_70383                   242   3e-76    
dbj|GAM89956.1|  hypothetical protein ANO11243_079960                   242   3e-76    
ref|XP_008936743.1|  PREDICTED: 60S ribosomal protein L15               242   3e-76    
gb|EJT43834.1|  hypothetical protein SKUD_204406                        242   3e-76    
gb|KIH94692.1|  large subunit ribosomal protein L15e                    241   3e-76    
sp|Q7T2N4.3|RL15_SILME  RecName: Full=60S ribosomal protein L15         242   3e-76    
gb|EMF14509.1|  ribosomal protein L15e                                  242   3e-76    
gb|EDL26238.1|  mCG16398                                                242   3e-76    
gb|KFH46732.1|  60S ribosomal protein-like protein                      241   4e-76    
gb|EFZ14326.1|  hypothetical protein SINV_15101                         242   4e-76    
emb|CEI91883.1|  Putative Ribosomal protein L15                         241   4e-76    
sp|Q7T3N4.3|RL15_MEGAM  RecName: Full=60S ribosomal protein L15         241   4e-76    
gb|KIK28524.1|  hypothetical protein PISMIDRAFT_673552                  241   4e-76    
ref|XP_001388776.1|  60S ribosomal protein L15                          241   4e-76    
gb|KFY44566.1|  hypothetical protein V494_01413                         250   5e-76    
sp|P61367.2|RL15_EPICO  RecName: Full=60S ribosomal protein L15         241   5e-76    
emb|CCK68268.1|  hypothetical protein KNAG_0A06060                      241   5e-76    
gb|KIM66174.1|  hypothetical protein SCLCIDRAFT_1211398                 241   5e-76    
gb|AJS80338.1|  Rpl15bp                                                 241   5e-76    
ref|XP_002771940.1|  60S ribosomal protein L15, putative                241   6e-76    
ref|XP_008626096.1|  ribosomal L15                                      241   6e-76    
ref|XP_658049.1|  RL15_ASPNG 60S RIBOSOMAL PROTEIN L15                  241   6e-76    
gb|KFZ12787.1|  hypothetical protein V502_06922                         250   6e-76    
ref|XP_003296271.1|  60S ribosomal protein L15                          242   6e-76    
ref|XP_006005298.1|  PREDICTED: 60S ribosomal protein L15               241   6e-76    
emb|CDQ81142.1|  unnamed protein product                                241   6e-76    
gb|KIO08255.1|  hypothetical protein M404DRAFT_997181                   241   6e-76    
gb|ETB56610.1|  hypothetical protein YYC_05449                          241   7e-76    
gb|AAA36583.1|  ribosomal protein L10                                   241   7e-76    
ref|XP_006810809.1|  PREDICTED: 60S ribosomal protein L15-like          241   7e-76    
gb|EIE79210.1|  60S ribosomal protein L15                               241   7e-76    
ref|XP_011123288.1|  hypothetical protein AOL_s00081g168                241   8e-76    
ref|XP_003678734.1|  60S ribosomal protein L15                          241   8e-76    
gb|EPS27962.1|  hypothetical protein PDE_02907                          241   8e-76    
gb|AAP35254.1|  ribosomal protein L15                                   241   8e-76    
ref|XP_004588348.1|  PREDICTED: 60S ribosomal protein L15               241   9e-76    
gb|KFY33682.1|  hypothetical protein V495_08272                         249   1e-75    
gb|EHN00844.1|  Rpl15bp                                                 241   1e-75    
gb|KFX94172.1|  hypothetical protein O988_06437                         249   1e-75    
gb|KFH71724.1|  60S ribosomal protein L15                               240   1e-75    
dbj|GAA24916.1|  K7_Rpl15ap                                             240   1e-75    
ref|XP_010871756.1|  PREDICTED: 60S ribosomal protein L15               240   1e-75    
gb|EQL32630.1|  hypothetical protein BDFG_05175                         251   1e-75    
gb|ACO09170.1|  60S ribosomal protein L15                               240   1e-75    
ref|XP_003957065.1|  hypothetical protein KAFR_0D02820                  240   1e-75    
dbj|BAF98663.1|  ribosomal protein L15                                  240   1e-75    
gb|EYE94488.1|  60S ribosomal protein L15                               240   1e-75    
gb|EHN01315.1|  Rpl15bp                                                 240   1e-75    
gb|KEY77864.1|  60S ribosomal protein L15                               240   1e-75    
ref|XP_008293876.1|  PREDICTED: 60S ribosomal protein L15               240   1e-75    
ref|NP_013840.1|  ribosomal 60S subunit protein L15B                    240   1e-75    
gb|EIF48674.1|  60s ribosomal protein l15-b                             240   1e-75    
gb|EGA57755.1|  Rpl15ap                                                 240   1e-75    
ref|XP_003054429.1|  60S ribosomal protein L15                          240   1e-75    
gb|AAX48848.1|  L15                                                     239   2e-75    
emb|CCA20982.1|  60S ribosomal protein L151 putative                    240   2e-75    
ref|XP_004561077.1|  PREDICTED: 60S ribosomal protein L15-like          240   2e-75    
ref|XP_004991174.1|  ribosomal protein L15                              240   2e-75    
sp|Q7T3N6.3|RL15_HYPMO  RecName: Full=60S ribosomal protein L15         240   2e-75    
gb|AJS78588.1|  Rpl15bp                                                 240   2e-75    
ref|XP_003488628.1|  PREDICTED: 60S ribosomal protein L15-like          240   2e-75    
ref|XP_004939469.1|  PREDICTED: 60S ribosomal protein L15 isoform X5    239   2e-75    
gb|EWG89405.1|  Rpl15bp                                                 239   2e-75    
gb|EWG84044.1|  Rpl15bp                                                 239   2e-75    
ref|XP_001820015.1|  60S ribosomal protein L15                          239   2e-75    
ref|XP_007068587.1|  PREDICTED: 60S ribosomal protein L15 isoform X5    239   2e-75    
gb|ACH70977.1|  ribosomal protein L15                                   239   2e-75    
gb|KDB17596.1|  60S ribosomal protein L15                               249   2e-75    
ref|XP_002561234.1|  Pc16g09160                                         239   2e-75    
gb|KFY08345.1|  hypothetical protein V492_06315                         248   2e-75    
ref|XP_444915.1|  60S ribosomal protein L15                             239   3e-75    
gb|KIK92970.1|  hypothetical protein PAXRUDRAFT_829457                  239   3e-75    
emb|CEG70134.1|  Putative Ribosomal protein L15                         239   3e-75    
sp|Q7T3N2.3|RL15_MONAL  RecName: Full=60S ribosomal protein L15         239   3e-75    
gb|ACD65166.1|  putative 60S ribosomal protein RPL15                    239   3e-75    
ref|XP_007238747.1|  PREDICTED: 60S ribosomal protein L15               239   3e-75    
emb|CDQ78484.1|  unnamed protein product                                239   3e-75    
gb|EGA77362.1|  Rpl15bp                                                 239   3e-75    
ref|XP_009263009.1|  hypothetical protein FPSE_11617                    239   3e-75    
ref|XP_002491583.1|  60S ribosomal protein L15                          239   3e-75    
ref|XP_011104444.1|  rpl15ap                                            239   3e-75    
emb|CEP13977.1|  hypothetical protein                                   239   4e-75    
emb|CCE30070.1|  probable ribosomal protein L15.e.B, cytosolic          248   4e-75    
ref|XP_003795995.1|  PREDICTED: 60S ribosomal protein L15-like is...    239   4e-75    
ref|XP_007414800.1|  hypothetical protein MELLADRAFT_91790              239   4e-75    
gb|KIL94800.1|  60s ribosomal protein l15                               239   4e-75    
gb|AJS76851.1|  Rpl15bp                                                 239   4e-75    
ref|XP_625397.1|  60S ribosomal protein L15                             239   4e-75    
ref|NP_001134566.1|  60S ribosomal protein L15                          239   5e-75    
ref|XP_001712430.1|  rpl15                                              239   5e-75    
ref|XP_007470051.1|  PREDICTED: 60S ribosomal protein L15-like          239   5e-75    
ref|NP_013129.1|  ribosomal 60S subunit protein L15A                    239   5e-75    
gb|AJS94717.1|  Rpl15bp                                                 239   5e-75    
ref|XP_002484013.1|  60S ribosomal protein L15                          238   6e-75    
gb|KIW22669.1|  60S ribosomal protein L15                               248   6e-75    
ref|XP_002150249.1|  60S ribosomal protein L15                          238   6e-75    
ref|XP_004074144.1|  PREDICTED: 60S ribosomal protein L15               238   6e-75    
ref|XP_009844620.1|  60S ribosomal protein                              238   6e-75    
ref|XP_001828739.2|  60S ribosomal protein L15                          239   6e-75    
gb|EMT61608.1|  60S ribosomal protein L15                               238   6e-75    
gb|AJS95152.1|  Rpl15bp                                                 238   7e-75    
gb|KIY71642.1|  ribosomal protein L15e                                  238   7e-75    
ref|XP_007864396.1|  60S ribosomal protein L15                          238   7e-75    
ref|XP_004179266.1|  hypothetical protein TBLA_0B09300                  238   8e-75    
gb|EMG48668.1|  Ribosomal protein L15                                   238   9e-75    
ref|XP_001443893.1|  hypothetical protein                               238   9e-75    
ref|XP_011054650.1|  PREDICTED: 60S ribosomal protein L15               238   9e-75    
ref|XP_001430095.1|  hypothetical protein                               238   9e-75    
ref|XP_005804544.1|  PREDICTED: 60S ribosomal protein L15-like          238   9e-75    
ref|XP_005105827.1|  PREDICTED: 60S ribosomal protein L15-like is...    238   9e-75    



>ref|XP_004241917.1| PREDICTED: 60S ribosomal protein L15 [Solanum lycopersicum]
 ref|XP_006355022.1| PREDICTED: 60S ribosomal protein L15-like [Solanum tuberosum]
 ref|XP_006356521.1| PREDICTED: 60S ribosomal protein L15 [Solanum tuberosum]
Length=204

 Score =   350 bits (897),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 192/197 (97%), Positives = 194/197 (98%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRV+RGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVKRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHL
Sbjct  121  INEDSTYKYFEVILVDQAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>ref|XP_004242022.1| PREDICTED: 60S ribosomal protein L15 [Solanum lycopersicum]
 ref|XP_006363900.1| PREDICTED: 60S ribosomal protein L15-like [Solanum tuberosum]
Length=204

 Score =   349 bits (895),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 190/197 (96%), Positives = 195/197 (99%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRV+RGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVIL+D+AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHL
Sbjct  121  INEDSTYKYFEVILIDSAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>ref|XP_004236901.1| PREDICTED: 60S ribosomal protein L15-like [Solanum lycopersicum]
Length=204

 Score =   348 bits (892),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 191/197 (97%), Positives = 193/197 (98%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRV+RGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVKRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AHA IRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHL
Sbjct  121  INEDSTYKYFEVILVDQAHAGIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>ref|XP_009606590.1| PREDICTED: 60S ribosomal protein L15 [Nicotiana tomentosiformis]
 ref|XP_009601449.1| PREDICTED: 60S ribosomal protein L15 [Nicotiana tomentosiformis]
 ref|XP_009780055.1| PREDICTED: 60S ribosomal protein L15 [Nicotiana sylvestris]
Length=204

 Score =   347 bits (889),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 191/197 (97%), Positives = 195/197 (99%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDQAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>ref|XP_009796395.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana sylvestris]
Length=204

 Score =   347 bits (889),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 191/197 (97%), Positives = 195/197 (99%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDQAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>gb|EYU24942.1| hypothetical protein MIMGU_mgv1a013374mg [Erythranthe guttata]
Length=222

 Score =   344 bits (883),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = -1

Query  777  SSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKA  598
            ++ T MGAYTYVSELW+KKQSDVMRFLLRVRCWEYRQLP++VRVT PTRPDKARRLGYKA
Sbjct  14   AAATVMGAYTYVSELWKKKQSDVMRFLLRVRCWEYRQLPAVVRVTHPTRPDKARRLGYKA  73

Query  597  KQgyvvyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV  418
            KQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GLRV
Sbjct  74   KQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLAGLRV  133

Query  417  LNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLR  238
            LNSYWINEDSTYKYFEVIL+D AH  +RNDPRINW+CNPVHKHRELRGLTSAGKKYRGLR
Sbjct  134  LNSYWINEDSTYKYFEVILIDPAHTTVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLR  193

Query  237  GRGHLHHKARPSRRATWKRNQT  172
            GRGHLHHKARPSRRATWKRNQT
Sbjct  194  GRGHLHHKARPSRRATWKRNQT  215



>gb|EYU43197.1| hypothetical protein MIMGU_mgv1a012815mg [Erythranthe guttata]
Length=239

 Score =   344 bits (882),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = -1

Query  777  SSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKA  598
            ++ T MGAYTYVSELW+KKQSDVMRFLLRVRCWEYRQLP++VRVT PTRPDKARRLGYKA
Sbjct  31   AAATVMGAYTYVSELWKKKQSDVMRFLLRVRCWEYRQLPAVVRVTHPTRPDKARRLGYKA  90

Query  597  KQgyvvyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV  418
            KQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GLRV
Sbjct  91   KQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLAGLRV  150

Query  417  LNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLR  238
            LNSYWINEDSTYKYFEVILVD AH  +RNDPRINW+CNPVHKHRELRGLTSAGKKYRGLR
Sbjct  151  LNSYWINEDSTYKYFEVILVDPAHTTVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLR  210

Query  237  GRGHLHHKARPSRRATWKRNQT  172
            GRGHLHHKARPSRRATWKRNQT
Sbjct  211  GRGHLHHKARPSRRATWKRNQT  232



>ref|XP_011069801.1| PREDICTED: 60S ribosomal protein L15 [Sesamum indicum]
Length=204

 Score =   342 bits (878),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 186/197 (94%), Positives = 194/197 (98%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAYTYVSELW+KKQSDVMRFLLRVRCWEYRQLP++VRVT PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWKKKQSDVMRFLLRVRCWEYRQLPAVVRVTHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVIL+D AHA +RNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYFEVILIDPAHATVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>ref|XP_011076388.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
 ref|XP_011076389.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
Length=204

 Score =   341 bits (875),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 186/197 (94%), Positives = 194/197 (98%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAYTYVSELW+KKQSDVMRFLLRVRCWEYRQLP++VRVT PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWKKKQSDVMRFLLRVRCWEYRQLPAVVRVTHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKY+EVIL+D AHA +RNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYYEVILIDPAHATVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>ref|XP_006477158.1| PREDICTED: 60S ribosomal protein L15-like [Citrus sinensis]
 gb|KDO61391.1| hypothetical protein CISIN_1g028730mg [Citrus sinensis]
Length=204

 Score =   340 bits (873),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 190/197 (96%), Positives = 192/197 (97%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAYT+VSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTFVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRN T
Sbjct  181  HHKARPSRRATWKRNNT  197



>sp|O82528.1|RL15_PETHY RecName: Full=60S ribosomal protein L15 [Petunia x hybrida]
 gb|AAD13389.1| ribosomal protein L15 [Petunia x hybrida]
Length=204

 Score =   340 bits (873),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 189/197 (96%), Positives = 193/197 (98%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRTKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHL
Sbjct  121  INEDSTYKYFEVILVDQAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            H+KA PSRRA WKRNQT
Sbjct  181  HNKAPPSRRANWKRNQT  197



>ref|XP_009607935.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana tomentosiformis]
Length=204

 Score =   339 bits (870),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 187/197 (95%), Positives = 193/197 (98%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKY+EVILVD AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDAAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRR TWKRNQT
Sbjct  181  YHKNRPSRRGTWKRNQT  197



>ref|XP_009764605.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana sylvestris]
Length=204

 Score =   339 bits (870),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 186/197 (94%), Positives = 193/197 (98%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVIL+D AHAA+RNDPRINW+CNPVHKHRELRGLTSAGKK RGL+G+GHL
Sbjct  121  INEDSTYKYFEVILIDAAHAAVRNDPRINWICNPVHKHRELRGLTSAGKKNRGLQGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRRATWKRNQT
Sbjct  181  HHKQRPSRRATWKRNQT  197



>ref|XP_011017435.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
Length=228

 Score =   340 bits (872),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 189/202 (94%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = -1

Query  777  SSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKA  598
            S  T MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKA
Sbjct  20   SRATTMGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKA  79

Query  597  KQgyvvyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV  418
            KQGYVVYR+RVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+V
Sbjct  80   KQGYVVYRIRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKV  139

Query  417  LNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLR  238
            LNSYWINEDSTYKYFEVILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLR
Sbjct  140  LNSYWINEDSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLR  199

Query  237  GRGHLHHKARPSRRATWKRNQT  172
            GRGHLHHKARPSRRATWKRNQT
Sbjct  200  GRGHLHHKARPSRRATWKRNQT  221



>ref|XP_009768655.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana sylvestris]
Length=204

 Score =   339 bits (869),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 187/197 (95%), Positives = 192/197 (97%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLAGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDAAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRR TWKRNQT
Sbjct  181  YHKNRPSRRGTWKRNQT  197



>ref|XP_011076387.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
Length=204

 Score =   338 bits (867),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 185/197 (94%), Positives = 193/197 (98%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAYTYVSELW+KKQSDVMRFLLRVRCWEYRQLP++VRVT  TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWKKKQSDVMRFLLRVRCWEYRQLPAVVRVTHSTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKY+EVILVD AHA +RNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDPAHATVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>ref|XP_006490145.1| PREDICTED: 60S ribosomal protein L15-like [Citrus sinensis]
 gb|KDO49938.1| hypothetical protein CISIN_1g028757mg [Citrus sinensis]
Length=204

 Score =   338 bits (867),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 188/197 (95%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>gb|EPS66678.1| hypothetical protein M569_08101, partial [Genlisea aurea]
Length=203

 Score =   338 bits (867),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 184/196 (94%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -1

Query  759  GAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvv  580
            GAYTY SELWRKKQSDVMRF+LR+RCWEYRQLP++VR+TRPTRPDKA RLGYKAKQGYV+
Sbjct  1    GAYTYCSELWRKKQSDVMRFVLRIRCWEYRQLPAVVRITRPTRPDKAHRLGYKAKQGYVI  60

Query  579  yrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWI  400
            YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+
Sbjct  61   YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWV  120

Query  399  NEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLH  220
            NEDSTYKYFEVILVD AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLH
Sbjct  121  NEDSTYKYFEVILVDPAHAAIRNDPRINWVCNPVHKHRELRGLTSAGKKYRGLRGKGHLH  180

Query  219  HKARPSRRATWKRNQT  172
            HKARPSRRATWKRNQT
Sbjct  181  HKARPSRRATWKRNQT  196



>ref|XP_011080625.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
Length=204

 Score =   338 bits (867),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 185/197 (94%), Positives = 192/197 (97%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAYTYVSELW+KKQSDVMRFLLRVRCWEYRQLP++VRVT  TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWKKKQSDVMRFLLRVRCWEYRQLPAVVRVTHSTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVIL+D AH  IRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYFEVILIDPAHTTIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>ref|XP_002301250.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_006375250.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_011033124.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
 gb|EEE80523.1| 60S ribosomal protein L15 [Populus trichocarpa]
 gb|ERP53047.1| 60S ribosomal protein L15 [Populus trichocarpa]
Length=204

 Score =   338 bits (867),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 188/197 (95%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYR+RVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRIRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHL
Sbjct  121  INEDSTYKYFEVILVDAAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>ref|XP_009618098.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana tomentosiformis]
Length=204

 Score =   338 bits (866),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 185/197 (94%), Positives = 193/197 (98%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKY+EVIL+D AHAA+RNDPRINW+CNPVHKHRELRGLTSAGKK RGL+G+GHL
Sbjct  121  INEDSTYKYYEVILIDAAHAAVRNDPRINWICNPVHKHRELRGLTSAGKKNRGLQGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRRATWKRNQT
Sbjct  181  HHKQRPSRRATWKRNQT  197



>ref|XP_006421625.1| hypothetical protein CICLE_v10005611mg [Citrus clementina]
 gb|ESR34865.1| hypothetical protein CICLE_v10005611mg [Citrus clementina]
Length=273

 Score =   340 bits (873),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 188/198 (95%), Positives = 191/198 (96%), Gaps = 0/198 (0%)
 Frame = -1

Query  765  AMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgy  586
             MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGY
Sbjct  69   TMGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGY  128

Query  585  vvyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSY  406
            VVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSY
Sbjct  129  VVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSY  188

Query  405  WINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGH  226
            WINEDSTYKYFEVILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GH
Sbjct  189  WINEDSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGH  248

Query  225  LHHKARPSRRATWKRNQT  172
            LHHKARPSRRATWKRNQT
Sbjct  249  LHHKARPSRRATWKRNQT  266



>ref|XP_002304285.2| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_006376227.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_011031910.1| PREDICTED: 60S ribosomal protein L15 isoform X2 [Populus euphratica]
 gb|ABK93503.1| unknown [Populus trichocarpa]
 gb|ERP54024.1| 60S ribosomal protein L15 [Populus trichocarpa]
 gb|EEE79264.2| 60S ribosomal protein L15 [Populus trichocarpa]
Length=204

 Score =   337 bits (865),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 189/197 (96%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRA WKRN T
Sbjct  181  HHKARPSRRANWKRNNT  197



>ref|XP_007209614.1| hypothetical protein PRUPE_ppa011603mg [Prunus persica]
 ref|XP_008238447.1| PREDICTED: 60S ribosomal protein L15 [Prunus mume]
 gb|EMJ10813.1| hypothetical protein PRUPE_ppa011603mg [Prunus persica]
Length=204

 Score =   337 bits (864),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 188/197 (95%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSE+WRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSEIWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            +HKARPSRRATWKRN T
Sbjct  181  YHKARPSRRATWKRNTT  197



>ref|XP_008369443.1| PREDICTED: 60S ribosomal protein L15-1 [Malus domestica]
 ref|XP_008363794.1| PREDICTED: 60S ribosomal protein L15-1 [Malus domestica]
Length=236

 Score =   338 bits (866),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 186/201 (93%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  774  SGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAK  595
            S  AMGAY YVSE+WRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAK
Sbjct  29   SEPAMGAYKYVSEIWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAK  88

Query  594  QgyvvyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVL  415
            QGYVVYRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVL
Sbjct  89   QGYVVYRVRVRRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVL  148

Query  414  NSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG  235
            NSYW+NEDSTYKYFEVI+VD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG
Sbjct  149  NSYWLNEDSTYKYFEVIMVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG  208

Query  234  RGHLHHKARPSRRATWKRNQT  172
            +GHL+HK RPSRRATWKRN T
Sbjct  209  KGHLYHKNRPSRRATWKRNTT  229



>ref|XP_009334550.1| PREDICTED: 60S ribosomal protein L15-1 [Pyrus x bretschneideri]
 ref|XP_009334556.1| PREDICTED: 60S ribosomal protein L15-1 [Pyrus x bretschneideri]
Length=235

 Score =   337 bits (865),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 186/201 (93%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  774  SGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAK  595
            S  AMGAY YVSE+WRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAK
Sbjct  28   SDPAMGAYKYVSEIWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAK  87

Query  594  QgyvvyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVL  415
            QGYVVYRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVL
Sbjct  88   QGYVVYRVRVRRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVL  147

Query  414  NSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG  235
            NSYW+NEDSTYKYFEVI+VD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG
Sbjct  148  NSYWLNEDSTYKYFEVIMVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG  207

Query  234  RGHLHHKARPSRRATWKRNQT  172
            +GHL+HK RPSRRATWKRN T
Sbjct  208  KGHLYHKNRPSRRATWKRNTT  228



>ref|XP_010667037.1| PREDICTED: 60S ribosomal protein L15-1 [Beta vulgaris subsp. 
vulgaris]
Length=204

 Score =   336 bits (861),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 185/197 (94%), Positives = 193/197 (98%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWR+KQSDVMRF+LRVRCWEYRQLPSIVRVT PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVLRVRCWEYRQLPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFEVILVDTAH A+RN+PRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHL
Sbjct  121  LNEDSTYKYFEVILVDTAHNAVRNNPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWKRNQT
Sbjct  181  NHKNRPSRRATWKRNQT  197



>ref|XP_006369001.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_011001458.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
 gb|ABK93954.1| unknown [Populus trichocarpa]
 gb|ERP65570.1| 60S ribosomal protein L15 [Populus trichocarpa]
Length=204

 Score =   336 bits (861),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 188/197 (95%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYR+RVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRIRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRA WKRN T
Sbjct  181  HHKARPSRRANWKRNNT  197



>ref|XP_011031909.1| PREDICTED: 60S ribosomal protein L15 isoform X1 [Populus euphratica]
Length=206

 Score =   336 bits (861),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 188/197 (95%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            +GAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYV
Sbjct  3    IGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  62

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  63   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  122

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL
Sbjct  123  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  182

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRA WKRN T
Sbjct  183  HHKARPSRRANWKRNNT  199



>ref|XP_010933636.1| PREDICTED: 60S ribosomal protein L15-1 [Elaeis guineensis]
Length=204

 Score =   335 bits (858),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 185/197 (94%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLP+IVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPAIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINW+CN VHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDAAHNAIRNDPRINWICNGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>gb|KHG00889.1| 60S ribosomal L15 [Gossypium arboreum]
 gb|KJB40093.1| hypothetical protein B456_007G046500 [Gossypium raimondii]
Length=204

 Score =   335 bits (858),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 186/197 (94%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVDTAH AIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDTAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRA WKRN T
Sbjct  181  HHKARPSRRANWKRNNT  197



>ref|XP_002510977.1| ribosomal protein L15, putative [Ricinus communis]
 gb|EEF51579.1| ribosomal protein L15, putative [Ricinus communis]
Length=204

 Score =   334 bits (857),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 185/197 (94%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARR+GYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRMGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRN T
Sbjct  181  HHKARPSRRATWKRNNT  197



>ref|XP_006440278.1| hypothetical protein CICLE_v10024403mg [Citrus clementina]
 gb|ESR53518.1| hypothetical protein CICLE_v10024403mg [Citrus clementina]
Length=230

 Score =   335 bits (860),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -1

Query  756  AYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvy  577
            AYT+VSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYVVY
Sbjct  29   AYTFVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVY  88

Query  576  rvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWIN  397
            RVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWIN
Sbjct  89   RVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWIN  148

Query  396  EDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHH  217
            EDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG+GHLHH
Sbjct  149  EDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHH  208

Query  216  KARPSRRATWKRNQT  172
            KARPSRRATWKRN T
Sbjct  209  KARPSRRATWKRNNT  223



>ref|XP_007157273.1| hypothetical protein PHAVU_002G057000g [Phaseolus vulgaris]
 gb|ESW29267.1| hypothetical protein PHAVU_002G057000g [Phaseolus vulgaris]
Length=204

 Score =   334 bits (857),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 186/197 (94%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFEV+LVD AHAAIRNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL
Sbjct  121  VNEDSTYKYFEVVLVDVAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            +HKARPSRRATWKRN T
Sbjct  181  YHKARPSRRATWKRNNT  197



>ref|XP_010686789.1| PREDICTED: 60S ribosomal protein L15 [Beta vulgaris subsp. vulgaris]
Length=204

 Score =   334 bits (857),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 183/197 (93%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELWR+KQSDVMRF  RVRCWEYRQLPSIVRVT PTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYMQELWRRKQSDVMRFTQRVRCWEYRQLPSIVRVTHPTRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVMNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVDTAH AIRNDPR+NW+CNPVHKHRELRGLTSAGKKYRGLRGRGHL
Sbjct  121  INEDSTYKYFEVILVDTAHNAIRNDPRVNWICNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            +HKARPSRRATWKRNQT
Sbjct  181  NHKARPSRRATWKRNQT  197



>ref|XP_008775187.1| PREDICTED: 60S ribosomal protein L15 [Phoenix dactylifera]
Length=204

 Score =   334 bits (857),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 184/197 (93%), Positives = 192/197 (97%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKY+EVILVD AH+AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  VNEDSTYKYYEVILVDAAHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>gb|EPS59253.1| hypothetical protein M569_15555, partial [Genlisea aurea]
Length=203

 Score =   334 bits (857),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 180/196 (92%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -1

Query  759  GAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvv  580
            GAYTY SELWRKKQSDVMRF+LR+RCWEYRQLP++VR+TRPTRPDKA RLGYKAKQGYV+
Sbjct  1    GAYTYCSELWRKKQSDVMRFVLRIRCWEYRQLPAVVRITRPTRPDKAHRLGYKAKQGYVI  60

Query  579  yrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWI  400
            YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+
Sbjct  61   YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWV  120

Query  399  NEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLH  220
            NEDSTYKY+EVIL+D AHA +RNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLH
Sbjct  121  NEDSTYKYYEVILIDPAHAVVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLH  180

Query  219  HKARPSRRATWKRNQT  172
            HKARPSRRATWKRNQT
Sbjct  181  HKARPSRRATWKRNQT  196



>gb|KDP39891.1| hypothetical protein JCGZ_03422 [Jatropha curcas]
Length=204

 Score =   334 bits (857),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 187/197 (95%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINWLC+PVHKHRELRGLTSAGKKYRGLRGRGHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCDPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRRATWKRN T
Sbjct  181  HHKNRPSRRATWKRNNT  197



>gb|KHG22797.1| 60S ribosomal L15-1 -like protein [Gossypium arboreum]
 gb|KJB07871.1| hypothetical protein B456_001G049600 [Gossypium raimondii]
Length=204

 Score =   334 bits (856),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 186/197 (94%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDPAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRN T
Sbjct  181  HHKARPSRRATWKRNNT  197



>ref|XP_010919627.1| PREDICTED: 60S ribosomal protein L15 isoform X1 [Elaeis guineensis]
Length=204

 Score =   333 bits (855),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 185/197 (94%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDAAHNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>ref|XP_007038342.1| Ribosomal protein L23/L15e family protein [Theobroma cacao]
 gb|EOY22843.1| Ribosomal protein L23/L15e family protein [Theobroma cacao]
Length=204

 Score =   333 bits (854),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 186/197 (94%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHL
Sbjct  121  INEDSTYKYFEVILVDPAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRA WKRN T
Sbjct  181  HHKARPSRRANWKRNNT  197



>ref|XP_008798983.1| PREDICTED: 60S ribosomal protein L15-like [Phoenix dactylifera]
 ref|XP_008810110.1| PREDICTED: 60S ribosomal protein L15-like [Phoenix dactylifera]
Length=204

 Score =   333 bits (853),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 184/197 (93%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH A+RNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDAAHNAVRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>ref|XP_010933963.1| PREDICTED: 60S ribosomal protein L15-like [Elaeis guineensis]
Length=204

 Score =   333 bits (853),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 183/197 (93%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YR+RVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFEVILVD AH AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  VNEDSTYKYFEVILVDAAHNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>ref|XP_011001078.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
Length=204

 Score =   332 bits (852),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 187/197 (95%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVKHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPV KHRELRGLTSAGKKYRGLRGRGHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVQKHRELRGLTSAGKKYRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRA WKRN T
Sbjct  181  HHKARPSRRANWKRNNT  197



>ref|XP_004146916.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 ref|XP_004146917.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
 ref|XP_004167164.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 ref|XP_004167165.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
 gb|KGN53150.1| hypothetical protein Csa_4G022860 [Cucumis sativus]
 gb|KGN56283.1| hypothetical protein Csa_3G112770 [Cucumis sativus]
 gb|KGN56284.1| hypothetical protein Csa_3G112780 [Cucumis sativus]
Length=204

 Score =   332 bits (852),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 184/197 (93%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKY+EVILVD AH A+RNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDVAHNAVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRN T
Sbjct  181  HHKARPSRRATWKRNNT  197



>gb|KDP22442.1| hypothetical protein JCGZ_26273 [Jatropha curcas]
Length=204

 Score =   332 bits (851),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 185/197 (94%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRGRGHL
Sbjct  121  INEDSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRA WKRN T
Sbjct  181  HHKARPSRRANWKRNNT  197



>ref|XP_008437057.1| PREDICTED: 60S ribosomal protein L15-2 isoform X2 [Cucumis melo]
 ref|XP_008453903.1| PREDICTED: 60S ribosomal protein L15-2 [Cucumis melo]
Length=204

 Score =   332 bits (850),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 185/197 (94%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKY+EVILVD AH AIRNDPRI W+CNPVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDVAHNAIRNDPRIKWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRN T
Sbjct  181  HHKARPSRRATWKRNNT  197



>ref|XP_010934657.1| PREDICTED: 60S ribosomal protein L15-1-like [Elaeis guineensis]
Length=204

 Score =   332 bits (850),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 181/197 (92%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL R+RCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRIRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGI+YGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIIYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKY+EVILVD AH+AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  VNEDSTYKYYEVILVDAAHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>ref|XP_002530661.1| ribosomal protein L15, putative [Ricinus communis]
 gb|EEF31730.1| ribosomal protein L15, putative [Ricinus communis]
Length=204

 Score =   331 bits (849),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 184/197 (93%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARR+GYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRMGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINWLC PVHKHRELRGLTS+GKKYRGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCKPVHKHRELRGLTSSGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRR TWKRN T
Sbjct  181  HHKNRPSRRGTWKRNNT  197



>ref|XP_010264371.1| PREDICTED: 60S ribosomal protein L15-like [Nelumbo nucifera]
Length=204

 Score =   331 bits (848),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 181/197 (92%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGI+YGKPTNQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIMYGKPTNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKY+E+ILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGL G+GHL
Sbjct  121  INEDSTYKYYEIILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLHGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRN T
Sbjct  181  HHKARPSRRATWKRNNT  197



>ref|XP_008796124.1| PREDICTED: 60S ribosomal protein L15-2 [Phoenix dactylifera]
Length=204

 Score =   330 bits (847),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 183/197 (93%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLP+IVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPAIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH  IRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDAAHNTIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>ref|XP_002277836.1| PREDICTED: 60S ribosomal protein L15-1 [Vitis vinifera]
Length=204

 Score =   330 bits (847),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 183/197 (93%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYMYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKY+E+ILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GH 
Sbjct  121  INEDSTYKYYEIILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHR  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRN T
Sbjct  181  HHKARPSRRATWKRNNT  197



>ref|XP_004152395.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 ref|XP_004158132.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 gb|KGN50265.1| hypothetical protein Csa_5G162630 [Cucumis sativus]
Length=204

 Score =   330 bits (847),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 184/197 (93%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKY+EVILVD AH A+RNDPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDVAHNAVRNDPRINWICNPVHKRRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRN T
Sbjct  181  HHKARPSRRATWKRNNT  197



>emb|CAN68893.1| hypothetical protein VITISV_004609 [Vitis vinifera]
Length=204

 Score =   330 bits (845),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 182/197 (92%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIV  TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVXATRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRS+AEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSIAEERAGRKLGGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKY+EVILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRN T
Sbjct  181  HHKARPSRRATWKRNNT  197



>gb|AGL08210.1| 60S ribosomal protein L15 [Arachis hypogaea]
 gb|AGL08221.1| 60S ribosomal protein L15 [Arachis hypogaea]
Length=204

 Score =   330 bits (845),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 182/197 (92%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEE+AGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEEKAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFE+I+VD AH AIRNDPRINWLCNPVHKHRELRGLTSAGK  RGLRG+GHL
Sbjct  121  VNEDSTYKYFEIIMVDVAHTAIRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWKRN T
Sbjct  181  YHKNRPSRRATWKRNNT  197



>ref|XP_010529971.1| PREDICTED: 60S ribosomal protein L15-1 [Tarenaya hassleriana]
 ref|XP_010529975.1| PREDICTED: 60S ribosomal protein L15-1 [Tarenaya hassleriana]
Length=204

 Score =   329 bits (844),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 182/197 (92%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKY+EVILVDTAH+AIRNDPR+NW+CNPVHKHRELRGLTS GKK RGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDTAHSAIRNDPRVNWICNPVHKHRELRGLTSEGKKNRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWKRN T
Sbjct  181  YHKNRPSRRATWKRNNT  197



>ref|XP_010258850.1| PREDICTED: 60S ribosomal protein L15 [Nelumbo nucifera]
Length=204

 Score =   329 bits (844),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 180/197 (91%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGI+YGKPTNQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIMYGKPTNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKY+E+ILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGL G+GHL
Sbjct  121  INEDSTYKYYEIILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLHGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRA WKRN T
Sbjct  181  HHKARPSRRANWKRNNT  197



>ref|XP_008452210.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo]
 ref|XP_008452211.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo]
 ref|XP_008452213.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo]
Length=204

 Score =   329 bits (844),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 184/197 (93%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKY+EVILVD AH AIRNDPRI W+C PVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDVAHNAIRNDPRIKWICKPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRN T
Sbjct  181  HHKARPSRRATWKRNNT  197



>ref|XP_010053499.1| PREDICTED: 60S ribosomal protein L15-2 [Eucalyptus grandis]
 gb|KCW77807.1| hypothetical protein EUGRSUZ_D02096 [Eucalyptus grandis]
Length=204

 Score =   329 bits (844),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 184/197 (93%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH  IR DPRI+WLCNPVHKHRELRGLTSAGKKYRGLRG+GH 
Sbjct  121  INEDSTYKYFEVILVDVAHTTIRRDPRISWLCNPVHKHRELRGLTSAGKKYRGLRGKGHT  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRN +
Sbjct  181  HHKARPSRRATWKRNNS  197



>ref|XP_007155679.1| hypothetical protein PHAVU_003G222000g [Phaseolus vulgaris]
 gb|ESW27673.1| hypothetical protein PHAVU_003G222000g [Phaseolus vulgaris]
Length=204

 Score =   329 bits (844),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 182/197 (92%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSV+EERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVSEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFEV+LVD AH+A+RNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL
Sbjct  121  VNEDSTYKYFEVVLVDVAHSAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWKRN T
Sbjct  181  YHKNRPSRRATWKRNNT  197



>ref|XP_010107162.1| 60S ribosomal protein L15 [Morus notabilis]
 gb|EXC13927.1| 60S ribosomal protein L15 [Morus notabilis]
Length=204

 Score =   329 bits (843),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 181/197 (92%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSE+WRKKQSD+MRF+ RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYQYVSEIWRKKQSDLMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFE+ILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GH 
Sbjct  121  INEDSTYKYFEIILVDPAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHT  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRN T
Sbjct  181  HHKARPSRRATWKRNNT  197



>gb|ACV50439.1| ribosomal protein L15 [Jatropha curcas]
Length=204

 Score =   328 bits (842),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 184/197 (93%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFE ILVDTAH AIRNDPRINW+C PVHKHRELRGLT AGKKYRGLRGRGHL
Sbjct  121  INEDSTYKYFEDILVDTAHNAIRNDPRINWICKPVHKHRELRGLTFAGKKYRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRA WKRN T
Sbjct  181  HHKARPSRRANWKRNNT  197



>ref|XP_003635402.1| PREDICTED: 60S ribosomal protein L15-1 [Vitis vinifera]
Length=204

 Score =   328 bits (842),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 182/197 (92%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKY+E+ILVD AH  IRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GH 
Sbjct  121  INEDSTYKYYEIILVDAAHNTIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHR  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRN T
Sbjct  181  HHKARPSRRATWKRNNT  197



>ref|XP_002268465.1| PREDICTED: 60S ribosomal protein L15-1-like [Vitis vinifera]
Length=204

 Score =   328 bits (842),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 182/197 (92%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIV  TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVCATRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRS+AEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSIAEERAGRKLGGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKY+EVILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRN T
Sbjct  181  HHKARPSRRATWKRNNT  197



>ref|XP_009406701.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   328 bits (842),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKY+E+IL+D AH+AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  VNEDSTYKYYEIILIDPAHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>pdb|3J61|N Chain N, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
Length=200

 Score =   328 bits (840),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFE+ILVD AH+AIRNDPRINWLC PVHKHRELRGLTSAGKKYRGLRG+GH 
Sbjct  121  VNEDSTYKYFEIILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHT  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>ref|XP_009399011.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   328 bits (840),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 181/197 (92%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKY+EVIL+D AH AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  VNEDSTYKYYEVILIDPAHNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>ref|XP_008437056.1| PREDICTED: 60S ribosomal protein L15-2 isoform X1 [Cucumis melo]
Length=214

 Score =   328 bits (841),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 185/202 (92%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -1

Query  777  SSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKA  598
            SS     AY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKA
Sbjct  6    SSSFFFRAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKA  65

Query  597  KQgyvvyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV  418
            KQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV
Sbjct  66   KQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV  125

Query  417  LNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLR  238
            LNSYWINEDSTYKY+EVILVD AH AIRNDPRI W+CNPVHKHRELRGLTSAGKKYRGLR
Sbjct  126  LNSYWINEDSTYKYYEVILVDVAHNAIRNDPRIKWICNPVHKHRELRGLTSAGKKYRGLR  185

Query  237  GRGHLHHKARPSRRATWKRNQT  172
            G+GHLHHKARPSRRATWKRN T
Sbjct  186  GKGHLHHKARPSRRATWKRNNT  207



>ref|XP_010062398.1| PREDICTED: 60S ribosomal protein L15-1 [Eucalyptus grandis]
 gb|KCW90851.1| hypothetical protein EUGRSUZ_A02903 [Eucalyptus grandis]
Length=204

 Score =   328 bits (840),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 182/197 (92%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFEVILVD AH  IR DPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GH 
Sbjct  121  LNEDSTYKYFEVILVDAAHNTIRKDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHS  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRN +
Sbjct  181  HHKARPSRRATWKRNNS  197



>ref|NP_001050612.1| Os03g0598800 [Oryza sativa Japonica Group]
 ref|NP_001174316.1| Os05g0274700 [Oryza sativa Japonica Group]
 gb|AAN08216.1| ribosomal protein L15 [Oryza sativa Japonica Group]
 gb|AAO59978.1| ribosomal protein L15 [Oryza sativa Japonica Group]
 gb|ABF97468.1| 60S ribosomal protein L15, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12526.1| Os03g0598800 [Oryza sativa Japonica Group]
 gb|EAY90899.1| hypothetical protein OsI_12513 [Oryza sativa Indica Group]
 gb|EAZ27702.1| hypothetical protein OsJ_11650 [Oryza sativa Japonica Group]
 dbj|BAG87626.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00645.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH93044.1| Os05g0274700 [Oryza sativa Japonica Group]
Length=204

 Score =   328 bits (840),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFE+ILVD AH+AIRNDPRINWLC PVHKHRELRGLTSAGKKYRGLRG+GH 
Sbjct  121  VNEDSTYKYFEIILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHT  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>ref|XP_009418976.1| PREDICTED: 60S ribosomal protein L15-1 [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   327 bits (839),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVVNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKY+E+IL+D AH+AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  VNEDSTYKYYEIILIDPAHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>gb|KHG16565.1| 60S ribosomal L15-1 -like protein [Gossypium arboreum]
Length=204

 Score =   327 bits (839),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 183/197 (93%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRRATWKRN T
Sbjct  181  HHKNRPSRRATWKRNNT  197



>ref|XP_006650289.1| PREDICTED: 60S ribosomal protein L15-like [Oryza brachyantha]
Length=204

 Score =   327 bits (839),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+SELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYISELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFE+ILVD AH+AIRNDPRINWLC PVHKHRELRGLTSAGKKYRGLRG+GH 
Sbjct  121  VNEDSTYKYFEIILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHT  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>ref|XP_006838929.1| hypothetical protein AMTR_s00002p00270230 [Amborella trichopoda]
 gb|ERN01498.1| hypothetical protein AMTR_s00002p00270230 [Amborella trichopoda]
Length=204

 Score =   327 bits (838),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSE+WRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSEMWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKY+E+ILVD AH AIRNDPRINW+  PVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INQDSTYKYYEIILVDAAHNAIRNDPRINWITKPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRN T
Sbjct  181  HHKARPSRRATWKRNNT  197



>gb|KJB51842.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
 gb|KJB51843.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
 gb|KJB51844.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
 gb|KJB51846.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
Length=204

 Score =   327 bits (838),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 182/197 (92%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSI+RV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIIRVNHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRRATWKRN T
Sbjct  181  HHKNRPSRRATWKRNNT  197



>ref|XP_006837338.1| hypothetical protein AMTR_s00111p00086580 [Amborella trichopoda]
 gb|ERN00192.1| hypothetical protein AMTR_s00111p00086580 [Amborella trichopoda]
Length=204

 Score =   327 bits (838),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSE+WRKKQSDVMRFL RVRCWEYRQLPSIVR TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSEMWRKKQSDVMRFLQRVRCWEYRQLPSIVRCTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKY+EVILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INQDSTYKYYEVILVDAAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWKRN T
Sbjct  181  YHKNRPSRRATWKRNNT  197



>ref|NP_001235890.1| uncharacterized protein LOC100305473 [Glycine max]
 ref|XP_003538942.1| PREDICTED: 60S ribosomal protein L15-1-like [Glycine max]
 gb|ACU13151.1| unknown [Glycine max]
 gb|KHN34919.1| 60S ribosomal protein L15 [Glycine soja]
 gb|KHN42683.1| 60S ribosomal protein L15 [Glycine soja]
Length=204

 Score =   327 bits (837),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 183/197 (93%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TR TRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFEVILVD AHAAIRNDPRINWL NPVHKHRELRGLTSAGK  RGLRGRGHL
Sbjct  121  VNEDSTYKYFEVILVDVAHAAIRNDPRINWLANPVHKHRELRGLTSAGKSNRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            +HKARPSRRATWKRN T
Sbjct  181  YHKARPSRRATWKRNNT  197



>gb|ADA67930.1| putative 60S ribosomal protein L15 [Wolffia arrhiza]
Length=204

 Score =   327 bits (837),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 180/197 (91%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQ+P+IVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQMPAIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKY+EVILVD A  AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  VNEDSTYKYYEVILVDGALNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>ref|XP_009398340.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   327 bits (837),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGFKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKY+E+IL+D AH AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  VNEDSTYKYYEIILIDPAHGAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>ref|XP_010539086.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
Length=204

 Score =   326 bits (836),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 180/197 (91%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRVTRPTRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYR+RV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRIRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKY+EVILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDPAHKAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
             HK RPSRRATWKRN T
Sbjct  181  FHKNRPSRRATWKRNNT  197



>ref|XP_010104882.1| 60S ribosomal protein L15 [Morus notabilis]
 gb|EXC02118.1| 60S ribosomal protein L15 [Morus notabilis]
Length=241

 Score =   328 bits (840),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 183/197 (93%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            +GAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPD+ARRLGYKAKQGYV
Sbjct  38   LGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDRARRLGYKAKQGYV  97

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  98   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  157

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
             NEDSTYKYFEVILVD AH AIRNDPRINWL  PVHKHRELRGLTSAGKKYRGLRG+GH 
Sbjct  158  TNEDSTYKYFEVILVDVAHNAIRNDPRINWLSKPVHKHRELRGLTSAGKKYRGLRGKGHT  217

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRN T
Sbjct  218  HHKARPSRRATWKRNNT  234



>ref|XP_010538411.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
Length=204

 Score =   326 bits (836),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRVTRPTRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYR+RV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRIRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKY+EVILVD AH A+RNDPR+NW+CNPVHKHRELRGLTS GKK RGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDPAHKAVRNDPRMNWICNPVHKHRELRGLTSEGKKNRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWKRN T
Sbjct  181  YHKNRPSRRATWKRNNT  197



>gb|KHG20796.1| 60S ribosomal L15-1 -like protein [Gossypium arboreum]
 gb|KJB39739.1| hypothetical protein B456_007G028600 [Gossypium raimondii]
Length=204

 Score =   326 bits (836),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 182/197 (92%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ P+IVRV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPAIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRRATWKRN T
Sbjct  181  HHKNRPSRRATWKRNNT  197



>ref|XP_009352987.1| PREDICTED: 60S ribosomal protein L15-like [Pyrus x bretschneideri]
Length=204

 Score =   326 bits (835),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 181/197 (92%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MG Y Y SE+WRKKQSD+MRF+ RVRCWEYRQ PSIVRVTRPTRPDKAR LGYKAKQGYV
Sbjct  1    MGFYKYQSEIWRKKQSDLMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARCLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRRLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            +HKARPSRRATWKRN T
Sbjct  181  YHKARPSRRATWKRNTT  197



>gb|KHN44085.1| 60S ribosomal protein L15 [Glycine soja]
Length=204

 Score =   326 bits (835),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 181/197 (92%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TR TRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFEVILVD AH+A+RNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL
Sbjct  121  VNEDSTYKYFEVILVDVAHSAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWKRN T
Sbjct  181  YHKNRPSRRATWKRNNT  197



>gb|ACU24496.1| unknown [Glycine max]
Length=204

 Score =   326 bits (835),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 181/197 (92%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TR TRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFEVILVD AH+A+RNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL
Sbjct  121  VNEDSTYKYFEVILVDVAHSAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWKRN T
Sbjct  181  YHKNRPSRRATWKRNNT  197



>ref|XP_010540825.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
 ref|XP_010542214.1| PREDICTED: 60S ribosomal protein L15-1 [Tarenaya hassleriana]
Length=204

 Score =   325 bits (834),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRVTRPTRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYR+RV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRIRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKY+EVILVD AH A+RNDPR+NW+CNPVHKHRELRGLTS GKK RGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDVAHKAVRNDPRMNWICNPVHKHRELRGLTSEGKKNRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWKRN +
Sbjct  181  YHKNRPSRRATWKRNNS  197



>ref|XP_009408522.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   325 bits (834),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPD+ARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDRARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKY+E+IL+D +H+AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  VNEDSTYKYYEIILLDPSHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  181  HHKARPSRRATWKRNQT  197



>ref|XP_003549922.1| PREDICTED: 60S ribosomal protein L15-1-like [Glycine max]
 gb|KHN09835.1| 60S ribosomal protein L15 [Glycine soja]
Length=204

 Score =   325 bits (834),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 181/197 (92%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TR TRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFEVILVD AH A+RNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL
Sbjct  121  VNEDSTYKYFEVILVDVAHTAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWKRN T
Sbjct  181  YHKNRPSRRATWKRNNT  197



>emb|CBI16601.3| unnamed protein product [Vitis vinifera]
Length=206

 Score =   325 bits (834),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  756  AYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvy  577
            AY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV+Y
Sbjct  5    AYMYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVIY  64

Query  576  rvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWIN  397
            RVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWIN
Sbjct  65   RVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWIN  124

Query  396  EDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHH  217
            EDSTYKY+E+ILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GH HH
Sbjct  125  EDSTYKYYEIILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHRHH  184

Query  216  KARPSRRATWKRNQT  172
            KARPSRRATWKRN T
Sbjct  185  KARPSRRATWKRNNT  199



>ref|XP_006655163.1| PREDICTED: 60S ribosomal protein L15-like [Oryza brachyantha]
Length=213

 Score =   325 bits (834),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = -1

Query  765  AMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgy  586
             +GAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGY
Sbjct  9    GVGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGY  68

Query  585  vvyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSY  406
            VVYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSY
Sbjct  69   VVYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSY  128

Query  405  WINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGH  226
            W+NEDSTYKYFE+ILVD AH+AIRNDPRINWLC PVHKHRELRGLTSAGKKYRGLRG+GH
Sbjct  129  WVNEDSTYKYFEIILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGH  188

Query  225  LHHKARPSRRATWKRNQT  172
             HHKARPSRRATWKRNQT
Sbjct  189  THHKARPSRRATWKRNQT  206



>gb|ACF88005.1| unknown [Zea mays]
 tpg|DAA62722.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   325 bits (833),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRV+RGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFE+ILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  121  VNEDSTYKYFEIILVDVAHTAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHT  180

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRRATWKRNQT
Sbjct  181  HHKNRPSRRATWKRNQT  197



>ref|XP_007039793.1| Ribosomal protein L23/L15e family protein isoform 3 [Theobroma 
cacao]
 gb|EOY24294.1| Ribosomal protein L23/L15e family protein isoform 3 [Theobroma 
cacao]
Length=204

 Score =   325 bits (833),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 182/197 (92%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWKRN T
Sbjct  181  YHKNRPSRRATWKRNNT  197



>ref|NP_001150716.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACF85905.1| unknown [Zea mays]
 gb|ACG40111.1| 60S ribosomal protein L15 [Zea mays]
 tpg|DAA62720.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   325 bits (832),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFE+ILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  121  VNEDSTYKYFEIILVDVAHTAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHT  180

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRRATWKRNQT
Sbjct  181  HHKNRPSRRATWKRNQT  197



>ref|XP_002460708.1| hypothetical protein SORBIDRAFT_02g033530 [Sorghum bicolor]
 gb|ACG25131.1| 60S ribosomal protein L15 [Zea mays]
 gb|EER97229.1| hypothetical protein SORBIDRAFT_02g033530 [Sorghum bicolor]
 tpg|DAA40842.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   324 bits (830),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFE+ILVD AH  IRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  121  VNEDSTYKYFEIILVDVAHTTIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHT  180

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRRATWKRNQT
Sbjct  181  HHKNRPSRRATWKRNQT  197



>ref|NP_001236804.1| uncharacterized protein LOC100306052 [Glycine max]
 gb|ACU14044.1| unknown [Glycine max]
Length=204

 Score =   324 bits (830),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 180/195 (92%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TR TRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFEVILVD AH+A+RNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL
Sbjct  121  VNEDSTYKYFEVILVDVAHSAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHL  180

Query  222  HHKARPSRRATWKRN  178
            +HK RPSRRATWKRN
Sbjct  181  YHKNRPSRRATWKRN  195



>ref|NP_001148602.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACF83256.1| unknown [Zea mays]
 gb|ACG32179.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACG38194.1| 60S ribosomal protein L15 [Zea mays]
 tpg|DAA59713.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   324 bits (830),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRV+RGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFE+ILVD AH AI+ DPRINWLCNPVHKHRELRGLTSAGKKYRGLRG+GH 
Sbjct  121  VNEDSTYKYFEIILVDVAHKAIKTDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHT  180

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRRATWKRNQT
Sbjct  181  HHKNRPSRRATWKRNQT  197



>gb|ACF87670.1| unknown [Zea mays]
Length=204

 Score =   323 bits (828),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKP +QG+TQL+FQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLRFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFE+ILVD AH  IRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  121  VNEDSTYKYFEIILVDVAHTTIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHT  180

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRRATWKRNQT
Sbjct  181  HHKNRPSRRATWKRNQT  197



>ref|NP_001148378.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACG31200.1| 60S ribosomal protein L15 [Zea mays]
Length=204

 Score =   323 bits (828),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWR+KQSDVMRF+ R+RCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRMRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFE+ILVD AH  IRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  121  VNEDSTYKYFEIILVDVAHTTIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHT  180

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRRATWKRNQT
Sbjct  181  HHKNRPSRRATWKRNQT  197



>ref|XP_007039791.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007039792.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24292.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24293.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
Length=206

 Score =   323 bits (828),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 181/197 (92%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            +GAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYV
Sbjct  3    VGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  62

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  63   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  122

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHL
Sbjct  123  INEDSTYKYFEVILVDVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHL  182

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWKRN T
Sbjct  183  YHKNRPSRRATWKRNNT  199



>ref|NP_001150386.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACG38875.1| 60S ribosomal protein L15 [Zea mays]
Length=204

 Score =   323 bits (827),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRV+RGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFE+ILVD AH AIR DPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  121  VNEDSTYKYFEIILVDVAHTAIRKDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHT  180

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRRATWKRNQT
Sbjct  181  HHKNRPSRRATWKRNQT  197



>gb|EEE63068.1| hypothetical protein OsJ_17876 [Oryza sativa Japonica Group]
Length=377

 Score =   329 bits (843),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  FSSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYK  601
            F      GAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYK
Sbjct  168  FLEPQVTGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYK  227

Query  600  AKQgyvvyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLR  421
            AKQGYVVYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLR
Sbjct  228  AKQGYVVYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLR  287

Query  420  VLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGL  241
            VLNSYW+NEDSTYKYFE+ILVD AH+AIRNDPRINWLC PVHKHRELRGLTSAGKKYRGL
Sbjct  288  VLNSYWVNEDSTYKYFEIILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGL  347

Query  240  RGRGHLHHKARPSRRATWKRNQT  172
            RG+GH HHKARPSRRATWKRNQT
Sbjct  348  RGKGHTHHKARPSRRATWKRNQT  370



>ref|XP_006837287.1| hypothetical protein AMTR_s00111p00023340 [Amborella trichopoda]
 gb|ERN00141.1| hypothetical protein AMTR_s00111p00023340 [Amborella trichopoda]
Length=233

 Score =   323 bits (829),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 189/199 (95%), Gaps = 0/199 (0%)
 Frame = -1

Query  768  TAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQg  589
            T  GAY YVSE+WRKKQSDVMRFL RVRCWEYRQLPSIVR TRPTRPDKARRLGYKAKQG
Sbjct  28   TFYGAYKYVSEMWRKKQSDVMRFLQRVRCWEYRQLPSIVRCTRPTRPDKARRLGYKAKQG  87

Query  588  yvvyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNS  409
            YV+YRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNS
Sbjct  88   YVIYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNS  147

Query  408  YWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRG  229
            YWIN+DSTYKY+EVILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+G
Sbjct  148  YWINQDSTYKYYEVILVDAAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKG  207

Query  228  HLHHKARPSRRATWKRNQT  172
            HL+HK RPSRRATWKRN T
Sbjct  208  HLYHKNRPSRRATWKRNNT  226



>ref|XP_002461521.1| hypothetical protein SORBIDRAFT_02g004020 [Sorghum bicolor]
 gb|EER98042.1| hypothetical protein SORBIDRAFT_02g004020 [Sorghum bicolor]
Length=204

 Score =   322 bits (826),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFE+ILVD AH AI+ DPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  121  VNEDSTYKYFEIILVDVAHTAIKTDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHT  180

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRRATWKRNQT
Sbjct  181  HHKNRPSRRATWKRNQT  197



>ref|XP_008241281.1| PREDICTED: 60S ribosomal protein L15-like [Prunus mume]
Length=204

 Score =   322 bits (826),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MG Y Y SE+WRKKQSD+MRF+ RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGGYKYQSEIWRKKQSDLMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYR+RVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRIRVRRGGRKRPVAKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRRLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKK RGL G+GHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKCRGLGGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            +HKARPSRRATWKRN T
Sbjct  181  YHKARPSRRATWKRNNT  197



>gb|EEC78893.1| hypothetical protein OsI_19264 [Oryza sativa Indica Group]
Length=377

 Score =   328 bits (841),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  FSSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYK  601
            F      GAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYK
Sbjct  168  FLEPQVTGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYK  227

Query  600  AKQgyvvyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLR  421
            AKQGYVVYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLR
Sbjct  228  AKQGYVVYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLR  287

Query  420  VLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGL  241
            VLNSYW+NEDSTYKYFE+ILVD AH+AIRNDPRINWLC PVHKHRELRGLTSAGKKYRGL
Sbjct  288  VLNSYWVNEDSTYKYFEIILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGL  347

Query  240  RGRGHLHHKARPSRRATWKRNQT  172
            RG+GH HHKARPSRRATWKRNQT
Sbjct  348  RGKGHTHHKARPSRRATWKRNQT  370



>ref|XP_004491939.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X2 [Cicer 
arietinum]
Length=204

 Score =   320 bits (819),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDST+KYFEVILVD AH AIRNDPRINWL NPVHKHRELRGLTSAGK+ RGLRG+GH 
Sbjct  121  VNEDSTFKYFEVILVDVAHTAIRNDPRINWLVNPVHKHRELRGLTSAGKENRGLRGKGHR  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWKRN T
Sbjct  181  YHKNRPSRRATWKRNNT  197



>gb|AFK46983.1| unknown [Lotus japonicus]
Length=204

 Score =   320 bits (819),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKY+E+ILVD AH AIRNDPRINWLCNPVHKHREL G TSAGK  RGL G+GH 
Sbjct  121  VNEDSTYKYYEIILVDVAHTAIRNDPRINWLCNPVHKHRELTGKTSAGKHNRGLVGKGHR  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWK+N +
Sbjct  181  HHKARPSRRATWKKNNS  197



>gb|ACJ84067.1| unknown [Medicago truncatula]
Length=204

 Score =   320 bits (819),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDST+KYFEVILVD AH+AIRNDPRINWL NPVHKHRELRGLTSAGK+ RGL G+GH 
Sbjct  121  VNEDSTFKYFEVILVDVAHSAIRNDPRINWLTNPVHKHRELRGLTSAGKENRGLSGKGHR  180

Query  222  HHKARPSRRATWKRNQT  172
            +HKARPSRRA WKRN T
Sbjct  181  YHKARPSRRANWKRNNT  197



>sp|O65050.1|RL15A_PICMA RecName: Full=60S ribosomal protein L15-1 [Picea mariana]
 gb|AAC32112.1| probable 60S ribosomal protein L15 [Picea mariana]
 gb|ABK22257.1| unknown [Picea sitchensis]
Length=204

 Score =   320 bits (819),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELW+KKQSDVMRFL RVRCWE+RQLP IVRVTRP+RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIEELWKKKQSDVMRFLQRVRCWEFRQLPGIVRVTRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQRS RSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRSLRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKY+E+ILVD AH+AIR DPRINW+CN VHKHRELRGLTSAGKKYRGLRGRGHL
Sbjct  121  INQDSTYKYYEIILVDQAHSAIRKDPRINWICNAVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            +HKARPS+RATWKRN T
Sbjct  181  YHKARPSKRATWKRNNT  197



>gb|AFK49215.1| unknown [Medicago truncatula]
 gb|KEH35101.1| 60S ribosomal protein L15-1 [Medicago truncatula]
Length=204

 Score =   320 bits (819),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDST+KYFEVILVD AH+AIRNDPRINWL NPVHKHRELRGLTSAGK+ RGL G+GH 
Sbjct  121  VNEDSTFKYFEVILVDVAHSAIRNDPRINWLTNPVHKHRELRGLTSAGKENRGLSGKGHR  180

Query  222  HHKARPSRRATWKRNQT  172
            +HKARPSRRA WKRN T
Sbjct  181  YHKARPSRRANWKRNNT  197



>ref|XP_004299420.1| PREDICTED: 60S ribosomal protein L15-1 [Fragaria vesca subsp. 
vesca]
Length=204

 Score =   320 bits (819),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVM F+ RVRCW+YRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMGFVQRVRCWDYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVAKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH+ I+ DPRINW+ NPVHKHRELRGLTSAGKKYRGLRG+GH 
Sbjct  121  INEDSTYKYFEVILVDVAHSVIKKDPRINWIVNPVHKHRELRGLTSAGKKYRGLRGKGHR  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWKRN T
Sbjct  181  YHKNRPSRRATWKRNNT  197



>ref|XP_007202591.1| hypothetical protein PRUPE_ppa011597mg [Prunus persica]
 ref|XP_008244846.1| PREDICTED: 60S ribosomal protein L15-1-like [Prunus mume]
 gb|EMJ03790.1| hypothetical protein PRUPE_ppa011597mg [Prunus persica]
Length=204

 Score =   319 bits (818),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MG Y Y +ELWRKKQSDVMRF+ RVRCWEYRQ PSIVRVTRPTRPDKAR LGYKAKQGYV
Sbjct  1    MGFYKYPTELWRKKQSDVMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARLLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRV+RGGRKRPV KGIVYGKPTNQGVTQLKFQRS RSVAEERAGRKL GLRVLNSYW
Sbjct  61   VYRVRVKRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSLRSVAEERAGRKLAGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKK RGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKCRGLRGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            +HKARPSRRATWKRN T
Sbjct  181  YHKARPSRRATWKRNTT  197



>sp|O65082.1|RL15B_PICMA RecName: Full=60S ribosomal protein L15-2 [Picea mariana]
 gb|AAC32144.1| probable 60S ribosomal protein L15 [Picea mariana]
 gb|ABK25889.1| unknown [Picea sitchensis]
Length=204

 Score =   319 bits (817),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELW+KKQSDVMRFL RVRCWEYRQLP IVR+T PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIEELWKKKQSDVMRFLQRVRCWEYRQLPGIVRITHPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQRS RSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRSLRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKY+EV+LVD AH  IRNDPRINW+CN VHKHRELRGLTSAGKKYRGLRGRGHL
Sbjct  121  INQDSTYKYYEVVLVDQAHTVIRNDPRINWICNAVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            +HKARPS+RATWKRN T
Sbjct  181  YHKARPSKRATWKRNNT  197



>ref|XP_008360544.1| PREDICTED: 60S ribosomal protein L15 [Malus domestica]
Length=204

 Score =   319 bits (817),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MG Y Y SE+WRKKQSD+MRF+ RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGFYKYQSEIWRKKQSDLMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRRLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTY YFEVILVD AH AIRND RIN LCNPVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  121  INEDSTYXYFEVILVDVAHNAIRNDARINXLCNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  222  HHKARPSRRATWKRN  178
            +HKARPSRRATWKRN
Sbjct  181  YHKARPSRRATWKRN  195



>ref|XP_003593619.1| Ribosomal protein L15 [Medicago truncatula]
 gb|AES63870.1| 60S ribosomal protein L15-1 [Medicago truncatula]
Length=252

 Score =   320 bits (821),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+SELWRKKQSDVMRF+ RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  49   MGAYKYISELWRKKQSDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYKAKQGYV  108

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  109  VYRVRVRRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  168

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDST+KYFEVILVD AH+AIRNDPRINWL NPVHKHRELRGLTSAGK+ RGL G+GH 
Sbjct  169  VNEDSTFKYFEVILVDVAHSAIRNDPRINWLTNPVHKHRELRGLTSAGKENRGLSGKGHR  228

Query  222  HHKARPSRRATWKRNQT  172
            +HKARPSRRA WKRN T
Sbjct  229  YHKARPSRRANWKRNNT  245



>dbj|BAJ95856.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=204

 Score =   318 bits (816),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY +VSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPD+ARRLG+KAKQGYV
Sbjct  1    MGAYKFVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYR+RVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFEVILVD AH+A+RNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  121  VNEDSTYKYFEVILVDVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHR  180

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRRATWKRNQT
Sbjct  181  HHKNRPSRRATWKRNQT  197



>ref|XP_004955579.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X2 [Setaria 
italica]
Length=204

 Score =   318 bits (816),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKP +QGVTQLKFQR+KRSVAEERAGRK+GGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGVTQLKFQRNKRSVAEERAGRKIGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFE+ILVD AHAAIRNDPRINWLC  VHKHRELRGLTSAGKKYRGLRG+G  
Sbjct  121  VNEDSTYKYFEIILVDVAHAAIRNDPRINWLCKDVHKHRELRGLTSAGKKYRGLRGKGSS  180

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRRATWKRNQT
Sbjct  181  HHKNRPSRRATWKRNQT  197



>ref|XP_003573847.1| PREDICTED: 60S ribosomal protein L15-2 [Brachypodium distachyon]
Length=204

 Score =   318 bits (815),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY +VSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPD+ARRLG+KAKQGYV
Sbjct  1    MGAYKFVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYR+RVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFEVILVD AH A+RNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG+G  
Sbjct  121  VNEDSTYKYFEVILVDVAHNAVRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGQR  180

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRRATWKRNQT
Sbjct  181  HHKNRPSRRATWKRNQT  197



>ref|XP_004957717.1| PREDICTED: 60S ribosomal protein L15-1-like [Setaria italica]
Length=204

 Score =   317 bits (812),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRK+GGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKIGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFEVILVD AH AIRNDPRINWLC  VHKHRELRGLTSAGKKYRGLRG+G  
Sbjct  121  VNEDSTYKYFEVILVDVAHTAIRNDPRINWLCKDVHKHRELRGLTSAGKKYRGLRGKGSA  180

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRRATWKRNQT
Sbjct  181  HHKNRPSRRATWKRNQT  197



>ref|XP_004491938.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X1 [Cicer 
arietinum]
Length=216

 Score =   317 bits (813),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 179/202 (89%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -1

Query  777  SSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKA  598
            S     GAY YVSELWRKKQSDVMRF+ RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKA
Sbjct  8    SFSLVTGAYKYVSELWRKKQSDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYKA  67

Query  597  KQgyvvyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV  418
            KQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV
Sbjct  68   KQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV  127

Query  417  LNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLR  238
            LNSYW+NEDST+KYFEVILVD AH AIRNDPRINWL NPVHKHRELRGLTSAGK+ RGLR
Sbjct  128  LNSYWVNEDSTFKYFEVILVDVAHTAIRNDPRINWLVNPVHKHRELRGLTSAGKENRGLR  187

Query  237  GRGHLHHKARPSRRATWKRNQT  172
            G+GH +HK RPSRRATWKRN T
Sbjct  188  GKGHRYHKNRPSRRATWKRNNT  209



>ref|XP_006282719.1| hypothetical protein CARUB_v10005752mg [Capsella rubella]
 gb|EOA15617.1| hypothetical protein CARUB_v10005752mg [Capsella rubella]
Length=204

 Score =   317 bits (811),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHN  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWK+N +
Sbjct  181  NHKNRPSRRATWKKNNS  197



>ref|NP_193470.1| 60S ribosomal protein L15-2 [Arabidopsis thaliana]
 ref|XP_006282721.1| hypothetical protein CARUB_v10005754mg [Capsella rubella]
 sp|Q8VYF1.1|RL152_ARATH RecName: Full=60S ribosomal protein L15-2 [Arabidopsis thaliana]
 gb|AAL59940.1| putative 60S ribosomal protein L15-like protein [Arabidopsis 
thaliana]
 gb|AAM64649.1| 60S ribosomal protein L15 homolog [Arabidopsis thaliana]
 gb|AAM67498.1| putative 60S ribosomal protein L15-like protein [Arabidopsis 
thaliana]
 dbj|BAE98399.1| 60S ribosomal protein L15 homolog [Arabidopsis thaliana]
 gb|AEE83883.1| 60S ribosomal protein L15-2 [Arabidopsis thaliana]
 gb|EOA15619.1| hypothetical protein CARUB_v10005754mg [Capsella rubella]
Length=204

 Score =   317 bits (811),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHN  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWK+N +
Sbjct  181  NHKNRPSRRATWKKNNS  197



>ref|NP_193405.1| 60S ribosomal protein L15-1 [Arabidopsis thaliana]
 ref|XP_002868071.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006391552.1| hypothetical protein EUTSA_v10019144mg [Eutrema salsugineum]
 ref|XP_006414312.1| hypothetical protein EUTSA_v10026269mg [Eutrema salsugineum]
 ref|XP_010440111.1| PREDICTED: 60S ribosomal protein L15-1 [Camelina sativa]
 ref|XP_010449726.1| PREDICTED: 60S ribosomal protein L15-1 [Camelina sativa]
 sp|O23515.1|RL151_ARATH RecName: Full=60S ribosomal protein L15-1 [Arabidopsis thaliana]
 gb|AAK44167.1|AF370352_1 putative ribosomal protein [Arabidopsis thaliana]
 emb|CAB10447.1| ribosomal protein [Arabidopsis thaliana]
 emb|CAB78714.1| ribosomal protein [Arabidopsis thaliana]
 gb|AAL24229.1| AT4g16720/dl4385c [Arabidopsis thaliana]
 gb|AAL91619.1| AT4g16720/dl4385c [Arabidopsis thaliana]
 gb|AAM64387.1| ribosomal protein [Arabidopsis thaliana]
 gb|AAM91731.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAN28757.1| At4g16720/dl4385c [Arabidopsis thaliana]
 gb|EFH44330.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 gb|AEE83791.1| 60S ribosomal protein L15-1 [Arabidopsis thaliana]
 gb|ESQ28838.1| hypothetical protein EUTSA_v10019144mg [Eutrema salsugineum]
 gb|ESQ55765.1| hypothetical protein EUTSA_v10026269mg [Eutrema salsugineum]
 gb|KFK23089.1| hypothetical protein AALP_AAs51321U000100 [Arabis alpina]
Length=204

 Score =   317 bits (811),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHN  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWK+N +
Sbjct  181  NHKNRPSRRATWKKNNS  197



>ref|XP_002868106.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_010434780.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
 ref|XP_010440015.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
 ref|XP_010449626.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
 gb|EFH44365.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
Length=204

 Score =   317 bits (811),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHN  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWK+N +
Sbjct  181  NHKNRPSRRATWKKNNS  197



>ref|XP_010434676.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
Length=204

 Score =   316 bits (810),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHN  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWK+N +
Sbjct  181  NHKNRPSRRATWKKNNS  197



>ref|XP_009108318.1| PREDICTED: 60S ribosomal protein L15-1-like [Brassica rapa]
Length=204

 Score =   316 bits (810),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKY+E+ILVD AH AIRNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  121  LNEDSTYKYYEIILVDPAHNAIRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHN  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWK+N +
Sbjct  181  NHKNRPSRRATWKKNNS  197



>gb|AAK67641.1| ribosomal protein L15 [Homo sapiens]
Length=204

 Score =   316 bits (809),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY +VSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPD+ARRLG+KAKQGYV
Sbjct  1    MGAYKFVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YR+RVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NED TYKYFEVILVD AH+A+RNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  121  VNEDFTYKYFEVILVDVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHR  180

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRRATWKRNQT
Sbjct  181  HHKNRPSRRATWKRNQT  197



>gb|KFK32179.1| hypothetical protein AALP_AA6G207900 [Arabis alpina]
Length=204

 Score =   316 bits (809),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHN  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWK+N +
Sbjct  181  NHKNRPSRRATWKKNNS  197



>emb|CDX90499.1| BnaA03g42820D [Brassica napus]
Length=275

 Score =   318 bits (816),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 187/199 (94%), Gaps = 0/199 (0%)
 Frame = -1

Query  768  TAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQg  589
            + MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG
Sbjct  70   SKMGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQG  129

Query  588  yvvyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNS  409
            +VVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NS
Sbjct  130  FVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNS  189

Query  408  YWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRG  229
            YW+NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+G
Sbjct  190  YWLNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKG  249

Query  228  HLHHKARPSRRATWKRNQT  172
            H +HK RPSRRATWK+N +
Sbjct  250  HRNHKNRPSRRATWKKNNS  268



>ref|XP_009136839.1| PREDICTED: 60S ribosomal protein L15-1 [Brassica rapa]
 gb|ABD65137.1| 60S ribosomal protein L15 [Brassica oleracea]
Length=204

 Score =   315 bits (808),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHR  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWK+N +
Sbjct  181  NHKNRPSRRATWKKNNS  197



>emb|CDY53647.1| BnaA08g30370D [Brassica napus]
Length=237

 Score =   317 bits (811),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 187/199 (94%), Gaps = 0/199 (0%)
 Frame = -1

Query  768  TAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQg  589
            + MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG
Sbjct  32   SKMGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQG  91

Query  588  yvvyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNS  409
            +VVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NS
Sbjct  92   FVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNS  151

Query  408  YWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRG  229
            YW+NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+G
Sbjct  152  YWLNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKG  211

Query  228  HLHHKARPSRRATWKRNQT  172
            H +HK RPSRRATWK+N +
Sbjct  212  HNNHKNRPSRRATWKKNNS  230



>dbj|BAD22764.1| ribosomal protein [Bromus inermis]
Length=204

 Score =   315 bits (808),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY ++SE+WR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPD+ARRLG+KAKQGYV
Sbjct  1    MGAYKFLSEIWRRKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYR+RVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFEVILVD AH A+RNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  121  VNEDSTYKYFEVILVDVAHNAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHR  180

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRRATWKRNQT
Sbjct  181  HHKNRPSRRATWKRNQT  197



>ref|XP_009145572.1| PREDICTED: 60S ribosomal protein L15-1 [Brassica rapa]
 ref|XP_009123031.1| PREDICTED: 60S ribosomal protein L15-1 [Brassica rapa]
Length=204

 Score =   315 bits (808),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHN  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWK+N +
Sbjct  181  NHKNRPSRRATWKKNNS  197



>ref|XP_001764493.1| predicted protein [Physcomitrella patens]
 gb|EDQ70760.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   315 bits (808),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELWRKKQSDV+RFLLRVRCWEYRQLP IVRVTRP+RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIEELWRKKQSDVLRFLLRVRCWEYRQLPGIVRVTRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVAKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKYFE+ILVD  HA IR DPRINW+ NPVHKHRELRGLTSAGKKYRGLRGRGHL
Sbjct  121  INQDSTYKYFEIILVDPQHAVIRKDPRINWIVNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            + KARPS RATWKRN T
Sbjct  181  YTKARPSIRATWKRNNT  197



>emb|CDY60707.1| BnaC07g50070D [Brassica napus]
Length=274

 Score =   318 bits (814),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  FSSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYK  601
                + MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYK
Sbjct  65   LCGSSKMGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYK  124

Query  600  AKQgyvvyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLR  421
            AKQG+VVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLR
Sbjct  125  AKQGFVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLR  184

Query  420  VLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGL  241
            V+NSYW+NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGL
Sbjct  185  VVNSYWLNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGL  244

Query  240  RGRGHLHHKARPSRRATWKRNQT  172
            RG+GH +HK RPSRRATWK+N +
Sbjct  245  RGKGHRNHKNRPSRRATWKKNNS  267



>emb|CDY54747.1| BnaAnng13420D [Brassica napus]
Length=239

 Score =   317 bits (811),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 187/199 (94%), Gaps = 0/199 (0%)
 Frame = -1

Query  768  TAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQg  589
            + MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG
Sbjct  34   SKMGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQG  93

Query  588  yvvyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNS  409
            +VVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NS
Sbjct  94   FVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNS  153

Query  408  YWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRG  229
            YW+NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+G
Sbjct  154  YWLNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKG  213

Query  228  HLHHKARPSRRATWKRNQT  172
            H +HK RPSRRATWK+N +
Sbjct  214  HNNHKNRPSRRATWKKNNS  232



>gb|AFK37409.1| unknown [Lotus japonicus]
Length=204

 Score =   315 bits (807),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFE+ILV  AH AIRNDPRINWLC PVH HRELRG TSAGK  R LRGRGH 
Sbjct  121  VNEDSTYKYFEIILVGIAHTAIRNDPRINWLCKPVHNHRELRGNTSAGKSNRCLRGRGHR  180

Query  222  HHKARPSRRATWKRNQT  172
            +HKARPSRRATW+RN +
Sbjct  181  YHKARPSRRATWRRNNS  197



>ref|XP_009136806.1| PREDICTED: 60S ribosomal protein L15-1-like [Brassica rapa]
Length=204

 Score =   314 bits (805),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPD+ARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDRARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHR  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWK+N +
Sbjct  181  NHKNRPSRRATWKKNNS  197



>ref|XP_004512167.1| PREDICTED: 60S ribosomal protein L15-1-like [Cicer arietinum]
Length=204

 Score =   314 bits (804),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMR L R RCWEYRQ  SIVRVTRPTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRCLQRWRCWEYRQQSSIVRVTRPTRPDKARRLGFKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKY+EVILVD AH AIRNDPR+NW+CNPVHKHRELRGLTSAGK+ RGL+G+GH 
Sbjct  121  MNEDSTYKYYEVILVDVAHTAIRNDPRVNWVCNPVHKHRELRGLTSAGKQNRGLQGKGHR  180

Query  222  HHKARPSRRATWKRNQT  172
            +HKARPSRRATWKRN T
Sbjct  181  YHKARPSRRATWKRNNT  197



>ref|XP_003563105.1| PREDICTED: 60S ribosomal protein L15-2 [Brachypodium distachyon]
Length=204

 Score =   314 bits (804),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY +VSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPD+ARRLG+KAKQGYV
Sbjct  1    MGAYKFVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYR+RVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFEVILVD AH A+RNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+G  
Sbjct  121  VNEDSTYKYFEVILVDVAHNAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGTR  180

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRRATWKRNQT
Sbjct  181  HHKNRPSRRATWKRNQT  197



>ref|XP_001753036.1| predicted protein [Physcomitrella patens]
 ref|XP_001758957.1| predicted protein [Physcomitrella patens]
 ref|XP_001772614.1| predicted protein [Physcomitrella patens]
 gb|EDQ62656.1| predicted protein [Physcomitrella patens]
 gb|EDQ76463.1| predicted protein [Physcomitrella patens]
 gb|EDQ82077.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   314 bits (804),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELWRKKQSDV+RFLLRVRCWEYRQLP IVRVTRP+RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIEELWRKKQSDVLRFLLRVRCWEYRQLPGIVRVTRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVAKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKYFE+ILVD  H  IR DPRINW+ NPVHKHRELRGLTSAGKKYRGLRGRGHL
Sbjct  121  INQDSTYKYFEIILVDPQHTVIRKDPRINWIVNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            + KARPS RATWKRN T
Sbjct  181  YTKARPSIRATWKRNNT  197



>ref|XP_002879569.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55828.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
Length=204

 Score =   313 bits (803),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMR L RVRCW+YRQ PSIVR+TRPTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRHLQRVRCWDYRQQPSIVRLTRPTRPDKARRLGFKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLSGLRVVNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  121  INEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHN  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWK+N T
Sbjct  181  NHKNRPSRRATWKKNNT  197



>emb|CDY50842.1| BnaC08g47880D, partial [Brassica napus]
Length=260

 Score =   315 bits (808),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+V
Sbjct  57   MGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  116

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  117  VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  176

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  177  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHN  236

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPSRRATWK+N +
Sbjct  237  NHKNRPSRRATWKKNNS  253



>emb|CDY40505.1| BnaC01g20070D [Brassica napus]
Length=318

 Score =   317 bits (813),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 187/199 (94%), Gaps = 0/199 (0%)
 Frame = -1

Query  768  TAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQg  589
            + MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG
Sbjct  113  SKMGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQG  172

Query  588  yvvyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNS  409
            +VVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NS
Sbjct  173  FVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNS  232

Query  408  YWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRG  229
            YW+NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+G
Sbjct  233  YWLNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKG  292

Query  228  HLHHKARPSRRATWKRNQT  172
            H +HK RPSRRATWK+N +
Sbjct  293  HNNHKNRPSRRATWKKNNS  311



>emb|CAB10520.1| ribosomal protein [Arabidopsis thaliana]
 emb|CAB78742.1| ribosomal protein [Arabidopsis thaliana]
Length=216

 Score =   314 bits (804),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  FSSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYK  601
             S      AY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+ RPTRPDKARRLGYK
Sbjct  7    ISKTKTKSAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYK  66

Query  600  AKQgyvvyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLR  421
            AKQG+VVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLR
Sbjct  67   AKQGFVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLR  126

Query  420  VLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGL  241
            V+NSYW+NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGL
Sbjct  127  VVNSYWLNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGL  186

Query  240  RGRGHLHHKARPSRRATWKRNQT  172
            RG+GH +HK RPSRRATWK+N +
Sbjct  187  RGKGHNNHKNRPSRRATWKKNNS  209



>ref|XP_001771165.1| predicted protein [Physcomitrella patens]
 gb|EDQ64014.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   313 bits (802),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELWRKKQSDV+RFLLRVRCWEYRQLP IVRVTRP+RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIEELWRKKQSDVLRFLLRVRCWEYRQLPGIVRVTRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVAKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKYFE+IL+D  H  IR DPRINW+ NPVHKHRELRGLTSAGKKYRGLRGRGHL
Sbjct  121  INQDSTYKYFEIILIDPQHTVIRKDPRINWIVNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            + KARPS RATWKRN T
Sbjct  181  YTKARPSIRATWKRNNT  197



>emb|CDP10996.1| unnamed protein product [Coffea canephora]
Length=186

 Score =   311 bits (798),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 176/179 (98%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -1

Query  708  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILVDPA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            HAAIRNDPRINWLC PVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT
Sbjct  121  HAAIRNDPRINWLCQPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  179



>gb|KDO49937.1| hypothetical protein CISIN_1g028757mg [Citrus sinensis]
Length=195

 Score =   311 bits (796),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 182/197 (92%), Gaps = 9/197 (5%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+      
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLK------  114

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
               DSTYKYFEVILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHL
Sbjct  115  ---DSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHL  171

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRNQT
Sbjct  172  HHKARPSRRATWKRNQT  188



>ref|XP_001757563.1| predicted protein [Physcomitrella patens]
 gb|EDQ77620.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   311 bits (796),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELWRKKQSDV+RFLLRVRCWEYRQLP IVRVTRP+RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIEELWRKKQSDVLRFLLRVRCWEYRQLPGIVRVTRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVAKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKYFE+ILVD  H  IR D RINW+ NPVHKHRELRGLTSAGKKYRGLRGRGHL
Sbjct  121  INQDSTYKYFEIILVDPQHTVIRKDSRINWIVNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            + KARPS RATWKRN T
Sbjct  181  YTKARPSIRATWKRNNT  197



>emb|CDP11952.1| unnamed protein product [Coffea canephora]
Length=186

 Score =   307 bits (787),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 173/179 (97%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -1

Query  708  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILVDPA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            HAAIRNDPRI+W+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRNQT
Sbjct  121  HAAIRNDPRIHWICEPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT  179



>ref|XP_002961462.1| hypothetical protein SELMODRAFT_270259 [Selaginella moellendorffii]
 gb|EFJ36722.1| hypothetical protein SELMODRAFT_270259 [Selaginella moellendorffii]
Length=204

 Score =   305 bits (782),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELWRKKQSDVMRFL+RVRCWEYRQLP IVR+ RPTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYIEELWRKKQSDVMRFLMRVRCWEYRQLPGIVRIQRPTRPDKARRLGFKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLG LRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGNLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKYFE+IL+D  H AIR DPRINW+C PVHKHRELRG+TSAG+K+RGLRG+GH 
Sbjct  121  INQDSTYKYFEIILIDPMHTAIRKDPRINWICQPVHKHRELRGITSAGRKHRGLRGKGHR  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPS RATWKRN T
Sbjct  181  NHKNRPSIRATWKRNNT  197



>gb|KDO49939.1| hypothetical protein CISIN_1g028757mg [Citrus sinensis]
Length=186

 Score =   303 bits (776),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -1

Query  708  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEVILVDAA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRNQT
Sbjct  121  HNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT  179



>gb|EMS52882.1| 60S ribosomal protein L15 [Triticum urartu]
Length=268

 Score =   306 bits (783),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/220 (71%), Positives = 177/220 (80%), Gaps = 17/220 (8%)
 Frame = -1

Query  780  FSSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYK  601
            ++  +  GAY +VSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPD+ARRLG+K
Sbjct  42   YTDVSTPGAYKFVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFK  101

Query  600  AKQgyvvyrvrvrrggrkrp-----------------vpkGIVYGKPTNQGVTQLKFQRS  472
            AKQ   +      +  R                    VPKGIVYGKP +QG+TQLKFQR+
Sbjct  102  AKQILFLCDSYTLKYVRIYAGYVVYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRN  161

Query  471  KRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHK  292
            KRSVAEERAGR+LGGLRVLNSYW+NEDSTYKYFEVILVD AH+A+RNDPRINWLC PVHK
Sbjct  162  KRSVAEERAGRRLGGLRVLNSYWVNEDSTYKYFEVILVDVAHSAVRNDPRINWLCKPVHK  221

Query  291  HRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            HRELRGLTSAGKK+RGLRG+GH HHK RPSRRATWKRNQT
Sbjct  222  HRELRGLTSAGKKFRGLRGKGHRHHKNRPSRRATWKRNQT  261



>ref|XP_002971348.1| hypothetical protein SELMODRAFT_270900 [Selaginella moellendorffii]
 gb|EFJ27946.1| hypothetical protein SELMODRAFT_270900 [Selaginella moellendorffii]
Length=204

 Score =   303 bits (777),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELWRKKQSDVMRFL+RVRCWEYRQLP IVR+ RPTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYIEELWRKKQSDVMRFLMRVRCWEYRQLPGIVRIQRPTRPDKARRLGFKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLG LRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGNLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKYFE+IL+D  H AIR DPRINW+C PVHKHRELRG+TSAG+K+RGLRG+GH 
Sbjct  121  INQDSTYKYFEIILIDPMHTAIRKDPRINWICQPVHKHRELRGITSAGRKHRGLRGKGHR  180

Query  222  HHKARPSRRATWKRNQT  172
            +HK RPS R TWKRN T
Sbjct  181  NHKNRPSIRGTWKRNNT  197



>ref|XP_011031911.1| PREDICTED: 60S ribosomal protein L15 isoform X3 [Populus euphratica]
Length=186

 Score =   302 bits (774),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 172/179 (96%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  708  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDVA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRA WKRN T
Sbjct  121  HNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRANWKRNNT  179



>ref|XP_010539199.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
Length=197

 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  726  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  547
            K+QSDVMRFL RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQG VVYRVRVRRGGRK
Sbjct  6    KRQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGIVVYRVRVRRGGRK  65

Query  546  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  367
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GLRVLNSYWINEDSTYKY+EV
Sbjct  66   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLAGLRVLNSYWINEDSTYKYYEV  125

Query  366  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  187
            ILVDTAH+A+RNDPR+NW+CNPVHKHRELRGLTS GKK RGLRG+GHL+HK RPSRRATW
Sbjct  126  ILVDTAHSAVRNDPRMNWICNPVHKHRELRGLTSEGKKNRGLRGKGHLYHKNRPSRRATW  185

Query  186  KRNQT  172
            KRN T
Sbjct  186  KRNNT  190



>ref|XP_010919628.1| PREDICTED: 60S ribosomal protein L15 isoform X2 [Elaeis guineensis]
Length=186

 Score =   298 bits (764),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -1

Query  708  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVD A
Sbjct  61   IVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDAA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRNQT
Sbjct  121  HNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT  179



>ref|XP_004955578.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X1 [Setaria 
italica]
Length=238

 Score =   299 bits (766),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 176/231 (76%), Positives = 187/231 (81%), Gaps = 34/231 (15%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKP +QGVTQLKFQR+KRSVAEERAGRK+GGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGVTQLKFQRNKRSVAEERAGRKIGGLRVLNSYW  120

Query  402  INE----------------------------------DSTYKYFEVILVDTAHAAIRNDP  325
            +NE                                  DSTYKYFE+ILVD AHAAIRNDP
Sbjct  121  VNEVCWILWRNFLLEGSYCSCPIYFVLMPATVHLSTQDSTYKYFEIILVDVAHAAIRNDP  180

Query  324  RINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            RINWLC  VHKHRELRGLTSAGKKYRGLRG+G  HHK RPSRRATWKRNQT
Sbjct  181  RINWLCKDVHKHRELRGLTSAGKKYRGLRGKGSSHHKNRPSRRATWKRNQT  231



>ref|XP_008234416.1| PREDICTED: 60S ribosomal protein L15-like [Prunus mume]
Length=204

 Score =   297 bits (760),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 176/197 (89%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MG Y Y SEL RKKQSDVMR L R+R +EYR  PSIVRVT PT PDKA RLGYKAKQGYV
Sbjct  1    MGYYKYTSELGRKKQSDVMRALQRLRAFEYRHQPSIVRVTHPTCPDKAHRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRV+RGGRKRPV KGIVYGKPTNQGV+QLKFQRSKRSVAEERAGRKL GL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVAKGIVYGKPTNQGVSQLKFQRSKRSVAEERAGRKLAGLKVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHL
Sbjct  121  VNEDSTYKYFEVILVDAAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLCGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRA WK N T
Sbjct  181  HHKARPSRRANWKSNNT  197



>ref|XP_004152396.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
 ref|XP_004158133.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
Length=186

 Score =   295 bits (755),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  708  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILVDVA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H A+RNDPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN T
Sbjct  121  HNAVRNDPRINWICNPVHKRRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT  179



>ref|XP_010516773.1| PREDICTED: 60S ribosomal protein L15-2-like [Camelina sativa]
Length=212

 Score =   296 bits (757),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 181/205 (88%), Gaps = 8/205 (4%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMR L RVRCW YRQ PSIVR+TRPTRPD+ARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRHLQRVRCWNYRQQPSIVRLTRPTRPDEARRLGFKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRS +EERAGRKLGGLR LNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSGSEERAGRKLGGLRDLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKH--------RELRGLTSAGKKYR  247
            INEDSTYKY+E+ILVD AH A+ NDPRINW+CNPVHKH        RELRGLTS GKK +
Sbjct  121  INEDSTYKYYEIILVDLAHNAVSNDPRINWICNPVHKHQLRSSSHNRELRGLTSEGKKNK  180

Query  246  GLRGRGHLHHKARPSRRATWKRNQT  172
            GLRG+GH ++K RPSRRATWK N T
Sbjct  181  GLRGKGHNNNKNRPSRRATWKNNNT  205



>gb|AAT85124.1| putative 60s ribosomal protein L15 [Oryza sativa Japonica Group]
Length=186

 Score =   294 bits (752),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -1

Query  708  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILVD A
Sbjct  61   IVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILVDVA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H+AIRNDPRINWLC PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATWKRNQT
Sbjct  121  HSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATWKRNQT  179



>emb|CBI25842.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   294 bits (752),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  708  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+E+ILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEIILVDAA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H  IRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATWKRN T
Sbjct  121  HNTIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHRHHKARPSRRATWKRNNT  179



>ref|XP_002946380.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ52307.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=204

 Score =   294 bits (753),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YV ELWRKKQSDV+RFLLRVRCWEYRQLPSIVR+TRP+RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVEELWRKKQSDVLRFLLRVRCWEYRQLPSIVRLTRPSRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRG RKRPV KGIVYGKP NQG+TQLK  R+ RSVAEER GRK GGLRVLNSYW
Sbjct  61   VYRVRVRRGNRKRPVHKGIVYGKPVNQGITQLKAARNLRSVAEERVGRKCGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +N+DS YKYFEVILVD AH  IRND RINWLCNPVHKHRELRGLTSAGK YRGLR +GH 
Sbjct  121  VNQDSCYKYFEVILVDPAHTTIRNDARINWLCNPVHKHRELRGLTSAGKHYRGLRAKGHK  180

Query  222  HHKARPSRRATWKRNQT  172
              K RPS+RA+WKR  +
Sbjct  181  ASKTRPSKRASWKRRNS  197



>emb|CBI38664.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   293 bits (751),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  708  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRFL RVRCWEYRQ PSIV  TRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVCATRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRS+AEERAGRKLGGL+VLNSYWINEDSTYKY+EVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSIAEERAGRKLGGLKVLNSYWINEDSTYKYYEVILVDAA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN T
Sbjct  121  HNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT  179



>tpg|DAA62721.1| TPA: hypothetical protein ZEAMMB73_667917 [Zea mays]
Length=186

 Score =   291 bits (745),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  708  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLG+KAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILVD A
Sbjct  61   IVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILVDVA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H AIRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATWKRNQT
Sbjct  121  HTAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRATWKRNQT  179



>ref|XP_001701780.1| ribosomal protein L15, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP06755.1| ribosomal protein L15 [Chlamydomonas reinhardtii]
Length=204

 Score =   291 bits (746),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELWRKKQSDV+RFLLRVRCWEYRQ+PS VR+TRP+RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIEELWRKKQSDVLRFLLRVRCWEYRQMPSCVRLTRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRG RKRPV KGIVYGKP NQG+TQLK  R+ R+VAEERAGRK GGLRVLNSYW
Sbjct  61   VYRVRVRRGNRKRPVHKGIVYGKPVNQGITQLKPARNLRNVAEERAGRKCGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +N+DS YKYFEVI+VD AH AIRND RINWLCNPVHKHRELRGLT+AGK YRGLR +GH 
Sbjct  121  VNQDSCYKYFEVIMVDPAHNAIRNDARINWLCNPVHKHRELRGLTAAGKNYRGLRAKGHK  180

Query  222  HHKARPSRRATWKRNQT  172
              K RPS+RA+WKR  +
Sbjct  181  ASKTRPSKRASWKRRNS  197



>gb|KJB39740.1| hypothetical protein B456_007G028600 [Gossypium raimondii]
Length=186

 Score =   291 bits (744),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  708  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRFL RVRCWEYRQ P+IVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPAIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFEVILVDVA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHLHHK RPSRRATWKRN T
Sbjct  121  HNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHLHHKNRPSRRATWKRNNT  179



>ref|XP_005845356.1| hypothetical protein CHLNCDRAFT_32281 [Chlorella variabilis]
 gb|EFN53254.1| hypothetical protein CHLNCDRAFT_32281 [Chlorella variabilis]
Length=204

 Score =   291 bits (746),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YV ELW+KKQSDV+RFLLRVRCWE+RQLP IVR+TRP+RPDKARR+G+KAKQGYV
Sbjct  1    MGAYKYVEELWKKKQSDVLRFLLRVRCWEFRQLPGIVRLTRPSRPDKARRMGFKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRK+PV KGIVYGKP +QGVTQLK  R+ +++AEER GRK GGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKKPVSKGIVYGKPVHQGVTQLKPTRNLQNIAEERVGRKCGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +N+D+ YKYFEVILVD AH AIR D R+NW+CNPVHKHRE RGLTSAGKKYRGL G+GHL
Sbjct  121  VNQDAVYKYFEVILVDPAHKAIRKDARVNWICNPVHKHREQRGLTSAGKKYRGLVGKGHL  180

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRA W++N +
Sbjct  181  HHKARPSRRAVWRKNNS  197



>ref|XP_005646118.1| ribosomal protein L15e [Coccomyxa subellipsoidea C-169]
 gb|EIE21574.1| ribosomal protein L15e [Coccomyxa subellipsoidea C-169]
Length=204

 Score =   290 bits (741),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELW++KQSDV+RFLLRVRCWEYRQLP IVR+T P+RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELWKRKQSDVLRFLLRVRCWEYRQLPGIVRLTGPSRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRK+PV KGIVYGKP NQG+TQLK  R+ RSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKKPVHKGIVYGKPVNQGITQLKPTRNLRSVAEERAGRKLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +N+DSTYKYFE+ILVD AH  +R DPR+NW+ +PVHKHRELRGLTSAGKK+RGLR +GH 
Sbjct  121  VNQDSTYKYFEIILVDIAHKVVREDPRVNWIVDPVHKHRELRGLTSAGKKFRGLRHKGHA  180

Query  222  HHKARPSRRATWKRNQ  175
             +K RPSRRATWKRN 
Sbjct  181  TNKLRPSRRATWKRNN  196



>gb|EMT29287.1| 60S ribosomal protein L15 [Aegilops tauschii]
Length=261

 Score =   291 bits (745),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 169/199 (85%), Positives = 186/199 (93%), Gaps = 0/199 (0%)
 Frame = -1

Query  768  TAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQg  589
               GAY +VSELWR+KQSDVMRF+ RVRCWEYR  P+IVR+TRP RPD+ARRLG+KAKQG
Sbjct  56   VVAGAYKFVSELWRRKQSDVMRFVQRVRCWEYRLQPAIVRITRPPRPDRARRLGFKAKQG  115

Query  588  yvvyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNS  409
            YVVYR+RVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNS
Sbjct  116  YVVYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNS  175

Query  408  YWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRG  229
            YW+NEDSTYKYFEVILVD AH+A+RNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+G
Sbjct  176  YWVNEDSTYKYFEVILVDVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKG  235

Query  228  HLHHKARPSRRATWKRNQT  172
            H HHK RPSRRATWKRNQT
Sbjct  236  HRHHKNRPSRRATWKRNQT  254



>gb|AFK40278.1| unknown [Lotus japonicus]
Length=222

 Score =   288 bits (738),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  723  KQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkr  544
            KQSDVMRFL RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKR
Sbjct  8    KQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKR  67

Query  543  pvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  364
            PV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+I
Sbjct  68   PVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEII  127

Query  363  LVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  187
            LVD AH AIRNDPRINWLC PVH HRELRG TSAGK  R LRGRGH +HKARPSRRATW
Sbjct  128  LVDIAHTAIRNDPRINWLCKPVHNHRELRGNTSAGKSNRCLRGRGHRYHKARPSRRATW  186



>ref|XP_011401241.1| 60S ribosomal protein L15 [Auxenochlorella protothecoides]
 gb|KFM28228.1| 60S ribosomal protein L15 [Auxenochlorella protothecoides]
Length=437

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELW+KKQSDV+RFLLRVRCWEYRQLPSIVR+T PTRPDKARR+GYKAKQGYV
Sbjct  1    MGAYKYIEELWKKKQSDVLRFLLRVRCWEYRQLPSIVRLTGPTRPDKARRMGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRK+PVPKGIVYGKP NQG+TQLK  R+  ++AEER GRK GGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKKPVPKGIVYGKPVNQGITQLKPTRNLANLAEERVGRKCGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +N+D+ YKYFEVILVD  H AIRND RINW+ NPVHKHRELRGLTSAGKKYRGL G+GHL
Sbjct  121  VNQDAVYKYFEVILVDPFHKAIRNDARINWIANPVHKHRELRGLTSAGKKYRGLTGKGHL  180

Query  222  HHKARPSRRATWKRNQ  175
            H K RPSRRA WK+N 
Sbjct  181  HTKNRPSRRAVWKKNN  196



>emb|CDX76573.1| BnaA08g08270D [Brassica napus]
Length=186

 Score =   281 bits (718),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  708  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILVDPA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H AIRNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N +
Sbjct  121  HNAIRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWKKNNS  179



>emb|CDY59531.1| BnaCnng35130D [Brassica napus]
Length=186

 Score =   280 bits (717),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  708  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILVDPA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N +
Sbjct  121  HNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWKKNNS  179



>emb|CDY09632.1| BnaC07g34290D [Brassica napus]
 emb|CDX90478.1| BnaA03g43030D [Brassica napus]
Length=186

 Score =   280 bits (717),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  708  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILVDPA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N +
Sbjct  121  HNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHRNHKNRPSRRATWKKNNS  179



>gb|KCW90850.1| hypothetical protein EUGRSUZ_A02903 [Eucalyptus grandis]
Length=183

 Score =   277 bits (708),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 164/197 (83%), Gaps = 21/197 (11%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSI  V                     
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIGYVV--------------------  40

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
             YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  41   -YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  99

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFEVILVD AH  IR DPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GH 
Sbjct  100  LNEDSTYKYFEVILVDAAHNTIRKDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHS  159

Query  222  HHKARPSRRATWKRNQT  172
            HHKARPSRRATWKRN +
Sbjct  160  HHKARPSRRATWKRNNS  176



>gb|AAF67144.1|AF230646_1 large subunit ribosomal protein L15 [Syntrichia ruralis]
Length=203

 Score =   278 bits (710),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 156/197 (79%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELWR+KQSDV+RFLLRVRCWE+RQLP IVRVT    PDKARRLGY+  +   
Sbjct  1    MGAYKYIEELWRRKQSDVLRFLLRVRCWEFRQLPGIVRVT-AQPPDKARRLGYRPSRVTW  59

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
                       +   P+ +   KP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYW
Sbjct  60   CTVCVCAVEAGRGRWPRVLCMEKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYW  119

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKYFE+ILVD  H  IR DPRINW+ NPVHKHR++RGLTSAGKKYRGLRGRGHL
Sbjct  120  INQDSTYKYFEIILVDPQHKVIRKDPRINWIVNPVHKHRDVRGLTSAGKKYRGLRGRGHL  179

Query  222  HHKARPSRRATWKRNQT  172
            + KARPS RATWKRN T
Sbjct  180  YTKARPSIRATWKRNNT  196



>emb|CEG01197.1| Ribosomal protein L15e, conserved site [Ostreococcus tauri]
Length=204

 Score =   278 bits (710),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 172/196 (88%), Gaps = 0/196 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YV ELW+KKQSDVMRFL R+R WEYRQLPSI RVTRPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVEELWKKKQSDVMRFLQRIRVWEYRQLPSICRVTRPTRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YR RVRRGGRKRPVPKG VYGKP + G+T+LKF R+ RSVAEERA R+ G LRVLNSYW
Sbjct  61   IYRARVRRGGRKRPVPKGQVYGKPVHCGITKLKFARNLRSVAEERAARRCGALRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +N+DS YKY+EVI+VD  H  IRNDPRINW+CNP HKHRE+RGLTSAG+KYRGLRG+GH 
Sbjct  121  LNQDSVYKYYEVIMVDPMHKCIRNDPRINWICNPTHKHREMRGLTSAGRKYRGLRGKGHN  180

Query  222  HHKARPSRRATWKRNQ  175
            + K+RPS+RATW+ N 
Sbjct  181  YTKSRPSKRATWRNNN  196



>ref|XP_003056552.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59928.1| predicted protein [Micromonas pusilla CCMP1545]
Length=204

 Score =   277 bits (709),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 170/196 (87%), Gaps = 0/196 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YV ELW+KKQSDV+RFL RVR WEYRQLPS+ RVTRPTRPDKARRLGYKAKQG+ 
Sbjct  1    MGAYKYVEELWKKKQSDVLRFLQRVRVWEYRQLPSVCRVTRPTRPDKARRLGYKAKQGFC  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYR RVRRGGRKRPV KGI YGKP +QGV +LKF R+ RSVAEER  R+ G LRVLNSYW
Sbjct  61   VYRARVRRGGRKRPVSKGIRYGKPVHQGVKKLKFARNLRSVAEERTARRCGALRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDS YKY+EVI+VD  H  IR DPRINW+C PVHKHRELRGLTSAG+KYRGL+G+GH 
Sbjct  121  LNEDSVYKYYEVIMVDPMHKVIRGDPRINWICAPVHKHRELRGLTSAGRKYRGLQGKGHN  180

Query  222  HHKARPSRRATWKRNQ  175
            ++K+RPS+R TWKRNQ
Sbjct  181  YNKSRPSKRGTWKRNQ  196



>gb|EMT18644.1| 60S ribosomal protein L15 [Aegilops tauschii]
Length=183

 Score =   274 bits (701),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 159/197 (81%), Gaps = 21/197 (11%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY +VSELWR+KQSDVMRF+ RVRCWEYRQ P+I  V    R    RR G K      
Sbjct  1    MGAYKFVSELWRRKQSDVMRFVQRVRCWEYRQQPAIGYVVYRIR---VRRGGRK------  51

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
                        RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW
Sbjct  52   ------------RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYW  99

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKYFEVILVD AH+A+RNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  100  VNEDSTYKYFEVILVDVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHR  159

Query  222  HHKARPSRRATWKRNQT  172
            HHK RPSRRATWKRNQT
Sbjct  160  HHKNRPSRRATWKRNQT  176



>ref|XP_001416062.1| Ribosomal protein L15, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO94354.1| Ribosomal protein L15, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=204

 Score =   274 bits (701),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 168/196 (86%), Gaps = 0/196 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YV ELW+KKQSDVMRFL R+R WEYRQLPSI RVTRPTRPDKARRLGYKAKQG+ 
Sbjct  1    MGAYKYVEELWKKKQSDVMRFLQRIRVWEYRQLPSICRVTRPTRPDKARRLGYKAKQGFC  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YR RVRRGGRKRPV KG VYGKP + G+T+LKF R+ RSVAEERA R+ G LRVLNSYW
Sbjct  61   IYRARVRRGGRKRPVAKGQVYGKPVHCGITKLKFARNLRSVAEERAARRCGALRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +N+DS YKY+EVI+VD  H  +RNDPRINW+CNP HKHRE+RGLTSAG+KYRGL G+GH 
Sbjct  121  LNQDSVYKYYEVIMVDPMHKCVRNDPRINWICNPTHKHREMRGLTSAGRKYRGLHGKGHN  180

Query  222  HHKARPSRRATWKRNQ  175
              K+RPS+RATW+ N 
Sbjct  181  FTKSRPSKRATWRNNN  196



>gb|KDD73446.1| ribosomal L15, partial [Helicosporidium sp. ATCC 50920]
Length=200

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELW+KKQSDV+RFLLRVRCWE+RQLP IVR+T P+RPDKARR+GYKAKQGYV
Sbjct  1    MGAYKYIEELWKKKQSDVLRFLLRVRCWEFRQLPRIVRLTGPSRPDKARRMGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRK+PV KGIVYGKP NQG+TQLK +R+ ++++E R GR   GLRVLNSYW
Sbjct  61   IYRVRVRRGGRKKPVAKGIVYGKPVNQGITQLKPRRNLQAISEGRVGRACRGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +N+D+++KY+EVI+VD AH  IRNDP INW+CNPVHKHRE  GLTSAGKK+RGL G+GH 
Sbjct  121  VNQDASHKYYEVIMVDPAHTVIRNDPHINWICNPVHKHREGHGLTSAGKKHRGLGGKGHG  180

Query  222  HHKARPSRRATWKRNQ  175
            H  ARPSRRATW+RNQ
Sbjct  181  HVHARPSRRATWRRNQ  196



>ref|XP_005717822.1| 60S ribosomal protein L15, partial [Chondrus crispus]
 emb|CDF37953.1| 60S ribosomal protein L15, partial [Chondrus crispus]
Length=216

 Score =   265 bits (678),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 173/203 (85%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  FSSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYK  601
             ++ + MGAY Y+ ELWR KQSDVMRF+LRVR WEYRQLPSI R +RPTRP+KARRLGYK
Sbjct  7    LTTNSNMGAYKYMEELWRHKQSDVMRFMLRVRAWEYRQLPSIHRASRPTRPEKARRLGYK  66

Query  600  AKQgyvvyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLR  421
            +KQG+VVYRVRVRRGGRKRPV KGI YGKP +QG+T+LKF+R+KR+VAEERAGR+ G LR
Sbjct  67   SKQGFVVYRVRVRRGGRKRPVKKGIQYGKPKHQGITELKFKRNKRAVAEERAGRRCGNLR  126

Query  420  VLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGL  241
            VLNSYW+NED+ YKYFE+ILVD +H AIRNDPR+NWL  PV KHRELRGLT+AG+K RGL
Sbjct  127  VLNSYWVNEDAAYKYFEIILVDPSHNAIRNDPRLNWLARPVMKHRELRGLTAAGRKGRGL  186

Query  240  RGRGHLHHKARPSRRATWKRNQT  172
              RGH  +  RPS RA WK++ T
Sbjct  187  HVRGHRANSTRPSVRAVWKKHNT  209



>ref|XP_004348091.1| ribosomal protein L15 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE93479.1| ribosomal protein L15 [Capsaspora owczarzaki ATCC 30864]
Length=204

 Score =   265 bits (676),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 175/198 (88%), Gaps = 2/198 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ EL++KKQSDV+RFL+R+RCW+YRQLP+I R +RPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYLEELYKKKQSDVLRFLVRLRCWQYRQLPAIHRASRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YR+R+RRGGRKRPV KGI+YGKP  QGVTQLK QRS R++AEER GR +GGLRVLNSYW
Sbjct  61   IYRIRLRRGGRKRPVFKGIIYGKPAAQGVTQLKNQRSHRAIAEERIGRAIGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            I +DST+KY+EVI+VDTAH AIR DPRINW+C  VHKHRELRGLT+AG+K+RG+ G+GHL
Sbjct  121  ICQDSTFKYYEVIMVDTAHKAIRRDPRINWICENVHKHRELRGLTAAGRKHRGV-GKGHL  179

Query  222  HHK-ARPSRRATWKRNQT  172
            H+K A  SRRA WKR  T
Sbjct  180  HNKTAGSSRRANWKRRNT  197



>gb|ACU45020.1| 60s ribosomal protein L15 [Pfiesteria piscicida]
Length=204

 Score =   264 bits (674),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 163/197 (83%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELWR+KQSDV+RFLLR+RCWE R LP + R TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYLQELWRRKQSDVLRFLLRIRCWELRHLPRVHRATRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YR RVRRGGRK+ V KG   GKP +QGV  LKFQRSK SVAEER GR  G LRVLNSYW
Sbjct  61   IYRSRVRRGGRKKRVAKGNTDGKPKHQGVNHLKFQRSKASVAEERVGRVCGNLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +N+DST+KY+EVI VD +H AIRNDPRINW+  PVHKHRELRGLTSAGKK RGL GRG  
Sbjct  121  VNQDSTFKYYEVICVDPSHNAIRNDPRINWITKPVHKHRELRGLTSAGKKNRGLVGRGRR  180

Query  222  HHKARPSRRATWKRNQT  172
            + K RPSRRA WK+N T
Sbjct  181  YQKNRPSRRAVWKKNNT  197



>gb|KIY95038.1| 60S ribosomal protein L15-1 [Monoraphidium neglectum]
Length=198

 Score =   259 bits (663),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 169/197 (86%), Gaps = 6/197 (3%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELWR+KQSDV+RFLLRVRCWE+RQLP IVR+ RP+RPDKARR+G+KAKQGYV
Sbjct  1    MGAYKYIEELWRRKQSDVLRFLLRVRCWEFRQLPGIVRLNRPSRPDKARRMGFKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPV KGIVYGKP NQG+TQLK  R+ R+VAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPVNQGITQLKASRNLRNVAEERAGRRLGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDS YKYFEVILVD  H AIRND RINW+       RELRGLTSAGKKYRGL G+G  
Sbjct  121  VNEDSAYKYFEVILVDPNHNAIRNDARINWI------RRELRGLTSAGKKYRGLHGKGSR  174

Query  222  HHKARPSRRATWKRNQT  172
            ++K  PS+RATW ++ +
Sbjct  175  YNKNAPSKRATWLKHNS  191



>ref|XP_005703122.1| 60S ribosomal protein L15e isoform 2 [Galdieria sulphuraria]
 ref|XP_005703123.1| 60S ribosomal protein L15e isoform 1 [Galdieria sulphuraria]
 gb|EME26602.1| 60S ribosomal protein L15e isoform 2 [Galdieria sulphuraria]
 gb|EME26603.1| 60S ribosomal protein L15e isoform 1 [Galdieria sulphuraria]
Length=204

 Score =   258 bits (660),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 165/197 (84%), Gaps = 0/197 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELWRKKQSDVMRFLLRVR WEYR LPS+ R +RPTRPDKAR LGYKAKQG+V
Sbjct  1    MGAYKYMQELWRKKQSDVMRFLLRVRAWEYRHLPSVHRASRPTRPDKARMLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKGI YGKP NQG+TQLKF+R+KRSVAEERAGR+ G LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIQYGKPKNQGITQLKFKRNKRSVAEERAGRRCGNLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+D  YKYFEVILVD  H AIR DPRI+W+C P  KHRE RGLTSAG+ +RGLR +G  
Sbjct  121  INQDGIYKYFEVILVDPNHKAIRRDPRIHWICKPTMKHRERRGLTSAGRAHRGLRRKGLG  180

Query  222  HHKARPSRRATWKRNQT  172
              K RPS RA WKR  T
Sbjct  181  VAKVRPSVRANWKRRNT  197



>ref|XP_503229.1| 60S ribosomal protein L15 [Yarrowia lipolytica]
 emb|CAG81430.1| YALI0D24387p [Yarrowia lipolytica CLIB122]
Length=203

 Score =   258 bits (658),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 161/197 (82%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ E+ RKKQSDV+RFLLRVRCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEEIHRKKQSDVLRFLLRVRCWEYRQKTGIHRASRPSRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRG RKRP  KG  YGKPTNQG+ QLK QRS R+VAEER GR+ G LRVLNSYW
Sbjct  61   IYRVRVRRGNRKRPSKKGATYGKPTNQGINQLKLQRSLRAVAEERVGRRAGNLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +N+DSTYKYFEVILVD +H  IRNDPRINW+CNPVHKHRE RGLT+AGKK RG+  +GH 
Sbjct  121  VNQDSTYKYFEVILVDPSHVVIRNDPRINWICNPVHKHRESRGLTAAGKKNRGI-NKGHK  179

Query  222  HHKARPSRRATWKRNQT  172
            +H     RR TWK   T
Sbjct  180  YHNTSAGRRHTWKLQNT  196



>ref|XP_762879.1| 60S ribosomal protein L15 [Theileria parva strain Muguga]
 gb|EAN30596.1| 60S ribosomal protein L15, putative [Theileria parva]
Length=204

 Score =   255 bits (652),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 165/196 (84%), Gaps = 0/196 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELWRKKQSDVMR LLR+R WEYRQLP++ RV+RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELWRKKQSDVMRTLLRIRTWEYRQLPALHRVSRPTRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRG RK+ V  GIVYGKP +QG+ + K +R+ RSVAEER GR  GGLRVLNSYW
Sbjct  61   IYRVRVRRGDRKKNVANGIVYGKPKHQGIRKQKSKRNLRSVAEERVGRHCGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            + +D  YK++EV+LVD AH A+RN+PR+N+LC PVHKHRE+RGLTSAGKKYRGLR +G  
Sbjct  121  VGQDEVYKFYEVVLVDPAHNAVRNNPRLNYLCKPVHKHREMRGLTSAGKKYRGLRVKGPR  180

Query  222  HHKARPSRRATWKRNQ  175
              K+RPS RA W+R Q
Sbjct  181  ASKSRPSVRANWRRRQ  196



>ref|XP_005534852.1| 60S ribosomal protein L15 [Cyanidioschyzon merolae strain 10D]
 dbj|BAM80245.1| 60S ribosomal protein L15 [Cyanidioschyzon merolae strain 10D]
Length=205

 Score =   255 bits (651),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 169/198 (85%), Gaps = 1/198 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELWRKKQS+ +RFL RVR WEYRQ P++ R TRP+RPDKARRLGY+AKQGYV
Sbjct  1    MGAYKYLQELWRKKQSEALRFLQRVRAWEYRQRPTVHRATRPSRPDKARRLGYRAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL-GGLRVLNSY  406
            +YRVRVRRGGRKRPVPKGI YGKP +QG+TQLKFQR+KRSVAEER GRK+   LRVLNSY
Sbjct  61   IYRVRVRRGGRKRPVPKGIQYGKPKHQGITQLKFQRNKRSVAEERVGRKICANLRVLNSY  120

Query  405  WINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGH  226
            WINED+ YKY+EVIL+D  H AIR DPRINW+C P  KHRELRGLTSAG+K RGL  +GH
Sbjct  121  WINEDALYKYYEVILIDPNHNAIRRDPRINWICRPTMKHRELRGLTSAGRKGRGLHRKGH  180

Query  225  LHHKARPSRRATWKRNQT  172
            L +KARPS R+ WKR+ T
Sbjct  181  LVNKARPSVRSVWKRHNT  198



>ref|XP_003382517.1| PREDICTED: 60S ribosomal protein L15-like [Amphimedon queenslandica]
Length=204

 Score =   255 bits (651),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 163/198 (82%), Gaps = 2/198 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YV ELWRKKQSD++RFLLRVRCW+YRQL  + R  RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVQELWRKKQSDLLRFLLRVRCWQYRQLNVLHRAPRPTRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YR+RVRRGGRKR   KG  YGKPTNQGV +LKFQRS +SVAEER GR  GGLRVLNSYW
Sbjct  61   IYRIRVRRGGRKRKARKGATYGKPTNQGVNELKFQRSLQSVAEERVGRHCGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            + +DST+K++EVILVD AH  IR DPR NW+C PVHKHRE+RGLTS G+K RGL G+GHL
Sbjct  121  VGQDSTFKFYEVILVDPAHKVIRQDPRTNWICRPVHKHREMRGLTSCGRKNRGL-GKGHL  179

Query  222  HHKAR-PSRRATWKRNQT  172
              K +  SRRA WKR  T
Sbjct  180  RTKVQGGSRRANWKRRNT  197



>ref|XP_003884098.1| hypothetical protein NCLIV_045010 [Neospora caninum Liverpool]
 emb|CBZ54067.1| hypothetical protein NCLIV_045010 [Neospora caninum Liverpool]
Length=205

 Score =   255 bits (651),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 164/198 (83%), Gaps = 1/198 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELW+KKQSDV+RFLLRVR WEYRQLP++ R T+ TRPDKARRLGYK KQG+V
Sbjct  1    MGAYKYLEELWKKKQSDVLRFLLRVRTWEYRQLPAVHRCTQSTRPDKARRLGYKKKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL-GGLRVLNSY  406
            +YRVRVRRG RK+ V KGIVYGKP NQGV + K  R+ R+VAEE+ GRK+ GGLRVLNSY
Sbjct  61   IYRVRVRRGDRKKQVHKGIVYGKPKNQGVRKQKSSRNLRAVAEEKVGRKICGGLRVLNSY  120

Query  405  WINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGH  226
            W+ +D+ YKY+EVILVD AH AIRNDPRINWLC PV KHRE RGLTSAGKKYRGLR +G 
Sbjct  121  WVGQDAVYKYYEVILVDPAHNAIRNDPRINWLCKPVMKHRECRGLTSAGKKYRGLRTKGS  180

Query  225  LHHKARPSRRATWKRNQT  172
               + RPSRRA WK+ Q 
Sbjct  181  GAARLRPSRRACWKKRQA  198



>ref|XP_007511637.1| 60S ribosomal protein L15 [Bathycoccus prasinos]
 emb|CCO17758.1| 60S ribosomal protein L15 [Bathycoccus prasinos]
Length=204

 Score =   254 bits (650),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 164/196 (84%), Gaps = 0/196 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YV ELW+KKQSDV+RFL R+R WEYRQLPSI RVTRPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVEELWKKKQSDVLRFLQRIRVWEYRQLPSICRVTRPTRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YR RVRRGGRKRPV KGIV GKP + G+T+LKF R+ +SVAEERA R+ G LRVLNSYW
Sbjct  61   IYRARVRRGGRKRPVRKGIVNGKPVHCGITKLKFARNLKSVAEERAARRCGALRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +N+DS YKY+EVI+VD  H AIR+DPRINW+C P HK R +RGLTSAG+K+RGL G+GH 
Sbjct  121  LNQDSVYKYYEVIMVDPMHKAIRSDPRINWICAPTHKGRAMRGLTSAGRKHRGLHGKGHN  180

Query  222  HHKARPSRRATWKRNQ  175
            + K R S+ A WK N 
Sbjct  181  YTKNRSSKHAQWKNNN  196



>gb|EPE06282.1| 60s ribosomal protein l15 [Ophiostoma piceae UAMH 11346]
Length=203

 Score =   254 bits (650),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  YV EL ++KQSDV+RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKRKQSDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRK+PV KG  YGKPTNQGV QLK+QRS +S AEER GR+ G LRVLNSYW
Sbjct  61   IYRVRVRRGGRKKPVRKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCGNLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +N+DSTYKYFEVILVD  HAAIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  VNQDSTYKYFEVILVDPQHAAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHK  179

Query  222  HHKARPSRRATWKRNQT  172
             +K R  RR TWKR+ T
Sbjct  180  FNKTRAGRRKTWKRHNT  196



>ref|XP_002366469.1| ribosomal protein L15, putative [Toxoplasma gondii ME49]
 ref|XP_008882193.1| ribosomal protein RPL15 [Hammondia hammondi]
 gb|EPR62406.1| ribosomal protein RPL15 [Toxoplasma gondii GT1]
 gb|EPT27335.1| ribosomal protein RPL15 [Toxoplasma gondii ME49]
 gb|ESS32798.1| ribosomal protein RPL15 [Toxoplasma gondii VEG]
 gb|KEP67758.1| ribosomal protein RPL15 [Hammondia hammondi]
 gb|KFG42256.1| ribosomal protein RPL15 [Toxoplasma gondii p89]
 gb|KFG44929.1| ribosomal protein RPL15 [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG52242.1| ribosomal protein RPL15 [Toxoplasma gondii FOU]
 gb|KFG65712.1| ribosomal protein RPL15 [Toxoplasma gondii RUB]
 gb|KFH10025.1| ribosomal protein RPL15 [Toxoplasma gondii MAS]
 gb|KFH12821.1| ribosomal protein RPL15 [Toxoplasma gondii VAND]
Length=205

 Score =   254 bits (650),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 164/198 (83%), Gaps = 1/198 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELW+KKQSDV+RFLLRVR WEYRQLP++ R T+ TRPDKARRLGYK KQG+V
Sbjct  1    MGAYKYLEELWKKKQSDVLRFLLRVRTWEYRQLPAVHRCTQSTRPDKARRLGYKKKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL-GGLRVLNSY  406
            +YRVRVRRG RK+ V KGIVYGKP NQGV + K  R+ R+VAEE+ GRK+ GGLRVLNSY
Sbjct  61   IYRVRVRRGDRKKQVHKGIVYGKPKNQGVRKQKSTRNLRAVAEEKVGRKICGGLRVLNSY  120

Query  405  WINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGH  226
            W+ +D+ YKY+EVILVD AH AIRNDPRINWLC PV KHRE RGLTSAGKKYRGLR +G 
Sbjct  121  WVGQDAVYKYYEVILVDPAHNAIRNDPRINWLCKPVMKHRECRGLTSAGKKYRGLRTKGS  180

Query  225  LHHKARPSRRATWKRNQT  172
               + RPSRRA WK+ Q 
Sbjct  181  GAARLRPSRRACWKKRQA  198



>ref|XP_009691154.1| 60S ribosomal protein L15 [Theileria orientalis strain Shintoku]
 dbj|BAM40853.1| 60S ribosomal protein L15 [Theileria orientalis strain Shintoku]
Length=204

 Score =   254 bits (649),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 165/196 (84%), Gaps = 0/196 (0%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELWRKKQSDVMR LLRVR WEYRQLP++ RVT+PTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYRYLEELWRKKQSDVMRTLLRVRTWEYRQLPALHRVTKPTRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            ++RVRVRRG RK+ V  GIVYGKP +QG+ + K +R+ RSVAEER GR+ GGLRVLNSYW
Sbjct  61   IFRVRVRRGDRKKNVANGIVYGKPKHQGIRKQKSKRNLRSVAEERVGRRCGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            + +D  YK++EVILVD AH A+RN+PR+N+LC PVHKHRE+RGLTSAG+K RGLR +G  
Sbjct  121  VGQDEVYKFYEVILVDPAHNAVRNNPRLNYLCKPVHKHREMRGLTSAGRKARGLRVKGPK  180

Query  222  HHKARPSRRATWKRNQ  175
              K+RPS RA WKR Q
Sbjct  181  ASKSRPSVRANWKRRQ  196



>ref|XP_006822011.1| PREDICTED: 60S ribosomal protein L15-like isoform X1 [Saccoglossus 
kowalevskii]
 ref|XP_006822012.1| PREDICTED: 60S ribosomal protein L15-like isoform X2 [Saccoglossus 
kowalevskii]
Length=204

 Score =   254 bits (648),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 168/198 (85%), Gaps = 2/198 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ E+W+KKQSD MRFLLRVRCW+YRQL +I R  RPTRPDKARRLGY+AKQGYV
Sbjct  1    MGAYKYMQEVWKKKQSDAMRFLLRVRCWQYRQLTAIHRAPRPTRPDKARRLGYRAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YR+R+RRGGRKRPVPKG  YGKPTNQGV QLK+QRS +S+AEERAGR+ GGLRVLNSYW
Sbjct  61   IYRIRLRRGGRKRPVPKGATYGKPTNQGVNQLKWQRSLQSLAEERAGRRCGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            + +DSTYK+FEVI+VD  H AIR +P   W+CNPVHKHRELRGLTSAGKK RG+ G+GHL
Sbjct  121  VGQDSTYKFFEVIMVDPFHKAIRRNPDTQWICNPVHKHRELRGLTSAGKKNRGI-GKGHL  179

Query  222  HHKA-RPSRRATWKRNQT  172
            H +    SRRA WKR  T
Sbjct  180  HTQTIGGSRRAAWKRRNT  197



>gb|ERS96332.1| 60S ribosomal protein L15 [Sporothrix schenckii ATCC 58251]
Length=203

 Score =   253 bits (646),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  YV EL ++KQSDV+RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKRKQSDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRK+PV KG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKKPVRKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKYFEVILVD  HAAIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  INQDSTYKYFEVILVDPQHAAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHK  179

Query  222  HHKARPSRRATWKRNQT  172
             +K R  RR TWKR+ T
Sbjct  180  FNKTRAGRRKTWKRHNT  196



>ref|XP_006690758.1| ribosomal protein L15-like protein [Chaetomium thermophilum var. 
thermophilum DSM 1495]
 gb|EGS23516.1| ribosomal protein L15-like protein [Chaetomium thermophilum var. 
thermophilum DSM 1495]
Length=203

 Score =   253 bits (645),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  Y+ EL +KKQSDV+RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYLEELSKKKQSDVVRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS R+ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRATAEERVGRRCSNLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +N+DSTYKY+EVILVD  H AIR DPRINW+CNPVHKHRE RGLTS GKK RGL  +GH 
Sbjct  121  VNQDSTYKYYEVILVDPNHKAIRRDPRINWICNPVHKHRECRGLTSTGKKSRGL-NKGHR  179

Query  222  HHKARPSRRATWKRNQT  172
             +K R  RR TWKR+ T
Sbjct  180  FNKTRAGRRKTWKRHNT  196



>gb|EFX04788.1| 60S ribosomal protein l15 [Grosmannia clavigera kw1407]
Length=203

 Score =   252 bits (643),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  YV EL ++KQSDV+RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKRKQSDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YR RVRRGGRK+PV KG  +GKPTNQGV QLK+QRS +S AEER GR+ G LRVLNSYW
Sbjct  61   IYRARVRRGGRKKPVAKGATFGKPTNQGVNQLKYQRSLKSTAEERVGRRCGNLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +N+DSTYKY+EVILVD  HAAIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  VNQDSTYKYYEVILVDPNHAAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHK  179

Query  222  HHKARPSRRATWKRNQT  172
             +K R  RR TWKR+ T
Sbjct  180  FNKTRAGRRKTWKRHNT  196



>gb|ESW97334.1| 60S ribosomal protein L15-B [Ogataea parapolymorpha DL-1]
Length=204

 Score =   252 bits (643),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ EL RKKQSDVMRFLLR+RCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELQRKKQSDVMRFLLRIRCWEYRQKTVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            ++R+RVRRGGRKRPVPKG  YGKPTNQGV QLK+Q++ RS AEER GRK   LRVLNSYW
Sbjct  61   IFRIRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQKALRSTAEERVGRKAANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +NEDSTYKY+EVI VD  H AIR DPR NW+CNPVHKHRE RGLT+ GKK RG+  +GHL
Sbjct  121  VNEDSTYKYYEVICVDPQHKAIRRDPRYNWICNPVHKHREARGLTATGKKSRGI-AKGHL  179

Query  222  HHKARPSRRATWKRNQT  172
             +K R  RR TWK++ T
Sbjct  180  FNKTRKGRRHTWKQHNT  196



>ref|XP_001624083.1| predicted protein [Nematostella vectensis]
 gb|EDO31983.1| predicted protein [Nematostella vectensis]
Length=204

 Score =   251 bits (642),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 167/198 (84%), Gaps = 2/198 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ EL++KKQSD++RFLLRVRCW+YRQL +I R TRPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELYKKKQSDLLRFLLRVRCWQYRQLTAIHRATRPTRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKG  YGKP NQGV +LKFQRS RSVAEERAGR  GGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPVNQGVNELKFQRSLRSVAEERAGRYCGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            + +DS YKYFEVI+VD  H AIR D RINW+C P HKHRELRGLT+AG K RG+R +GH 
Sbjct  121  VGQDSIYKYFEVIMVDPFHKAIRRDARINWICKPTHKHRELRGLTAAGTKNRGMR-KGHN  179

Query  222  HHKA-RPSRRATWKRNQT  172
            ++K    SRRA WKR+ T
Sbjct  180  YNKVIGSSRRANWKRHNT  197



>gb|ACR24948.1| ribosomal protein L15 [Lepidochitona cinerea]
Length=204

 Score =   251 bits (640),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 166/198 (84%), Gaps = 2/198 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ EL+RKKQSDV+RFLLR+R W+YRQL S+ R +RPTRPDKARRLGY+AKQGYV
Sbjct  1    MGAYKYMQELYRKKQSDVLRFLLRIRSWQYRQLASVHRASRPTRPDKARRLGYRAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKG  YGKP NQGV QLKFQRS +SVAEER GRK  GLRVL+SYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPVNQGVNQLKFQRSLQSVAEERVGRKCQGLRVLSSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            + +DSTYK+FE+++VD  H AIR DP+INWLCNPVHKHRELRGLT+AGK  RGL  +GH 
Sbjct  121  VAQDSTYKFFEIVMVDPFHKAIRRDPKINWLCNPVHKHRELRGLTTAGKSSRGLX-KGHK  179

Query  222  HHKA-RPSRRATWKRNQT  172
             HK    SRRA WKR  T
Sbjct  180  FHKTIGGSRRANWKRQNT  197



>gb|KIV95599.1| 60S ribosomal protein L15 [Exophiala mesophila]
Length=203

 Score =   251 bits (640),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRAANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKYFEVILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH 
Sbjct  121  INQDSTYKYFEVILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHG  179

Query  222  HHKARPSRRATWKRNQT  172
            ++K    RR TWKR+ T
Sbjct  180  YNKTTAGRRKTWKRHNT  196



>gb|KIN02516.1| hypothetical protein OIDMADRAFT_18358 [Oidiodendron maius Zn]
Length=203

 Score =   250 bits (639),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKYFE+ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH 
Sbjct  121  INQDSTYKYFEIILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHS  179

Query  222  HHKARPSRRATWKRNQT  172
            ++K    RR TWKR+ T
Sbjct  180  YNKTTAGRRKTWKRHNT  196



>emb|CEJ94099.1| Putative Ribosomal protein L15 [Torrubiella hemipterigena]
Length=203

 Score =   250 bits (639),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 160/197 (81%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  YV EL +KKQSDVMRFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRK+P  KG  YGKPTNQG+ QLK+QRS R+ AEER GR+   LRVLNSYW
Sbjct  61   VYRVRVRRGGRKKPARKGATYGKPTNQGINQLKYQRSLRATAEERVGRRCANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKYFEVILVD  H AIR DPRINW+ NPVHKHRE RGLTS GK+ RGL  +GH 
Sbjct  121  INQDSTYKYFEVILVDPQHKAIRIDPRINWIVNPVHKHREARGLTSTGKRSRGL-NKGHR  179

Query  222  HHKARPSRRATWKRNQT  172
            ++K    RR TWKR+ T
Sbjct  180  YNKTTAGRRKTWKRHNT  196



>gb|KEF63356.1| 60S ribosomal protein L15 [Exophiala aquamarina CBS 119918]
Length=203

 Score =   250 bits (639),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRASNLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKYFEVILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH 
Sbjct  121  INQDSTYKYFEVILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHG  179

Query  222  HHKARPSRRATWKRNQT  172
            ++K    RR TWKR+ T
Sbjct  180  YNKTTAGRRKTWKRHNT  196



>ref|XP_008713401.1| 60S ribosomal protein L15 [Cyphellophora europaea CBS 101466]
 gb|ETN44328.1| 60S ribosomal protein L15 [Cyphellophora europaea CBS 101466]
Length=203

 Score =   250 bits (639),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 161/197 (82%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  YV EL +KKQSDVMRFLLRVRCWE RQL  I R TRP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELHKKKQSDVMRFLLRVRCWELRQLNVIHRATRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRP PKG  YGKPTNQG+ QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPAPKGATYGKPTNQGINQLKYQRSLKSTAEERVGRRCANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKYFEVILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  INQDSTYKYFEVILVDPQHKAIRKDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHG  179

Query  222  HHKARPSRRATWKRNQT  172
            ++K    RR TWKR+ T
Sbjct  180  YNKTSAGRRKTWKRHNT  196



>gb|KIX01331.1| 60S ribosomal protein L15 [Rhinocladiella mackenziei CBS 650.93]
Length=203

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRCANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKY+EVILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH+
Sbjct  121  INQDSTYKYYEVILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHV  179

Query  222  HHKARPSRRATWKRNQT  172
             +K    RR TWKR+ T
Sbjct  180  FNKTTAGRRKTWKRHNT  196



>ref|XP_002545593.1| 60S ribosomal protein L15-B [Candida tropicalis MYA-3404]
 gb|EER35635.1| 60S ribosomal protein L15-B [Candida tropicalis MYA-3404]
Length=204

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ EL RKKQSDVMRFL RVRCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELQRKKQSDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRASNLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +N+DSTYKYFEVILVD +H AIR D R NW+ NPVHKHRE RGLTSAGKK RG+  +GHL
Sbjct  121  VNQDSTYKYFEVILVDPSHKAIRRDARYNWIANPVHKHRESRGLTSAGKKSRGI-NKGHL  179

Query  222  HHKARPSRRATWKRNQT  172
             +K +  RR TWK++ T
Sbjct  180  FNKTKAGRRHTWKKHNT  196



>gb|EQL00837.1| Ribosomal protein L15e [Ophiocordyceps sinensis CO18]
Length=203

 Score =   249 bits (637),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  YV EL +KKQSDVMRFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPV KG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVRKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKY+E+ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  INQDSTYKYYEIILVDPQHKAIRIDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHR  179

Query  222  HHKARPSRRATWKRNQT  172
            ++K R  RR TWKR+ T
Sbjct  180  YNKTRAGRRKTWKRHNT  196



>ref|XP_004221219.1| 60S ribosomal protein L15-1 [Plasmodium cynomolgi strain B]
 dbj|GAB65272.1| 60S ribosomal protein L15-1 [Plasmodium cynomolgi strain B]
Length=205

 Score =   249 bits (636),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ E+W+KKQSD M FLLRVR WEYRQLP + RV+RP+RPDKARRLGYKA QG+V
Sbjct  1    MGAYKYIQEIWKKKQSDAMHFLLRVRTWEYRQLPVVHRVSRPSRPDKARRLGYKALQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL-GGLRVLNSY  406
            +YRVRVRRG RK+ V KG+V+GKP +QGV + K  R+ +SVAE + G+ + G LRVLNSY
Sbjct  61   IYRVRVRRGDRKKRVRKGVVHGKPKHQGVHKQKSTRNLKSVAEGKVGKSICGNLRVLNSY  120

Query  405  WINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGH  226
            W+ +D+ YKY+EVILVD  H AIRN+P+INW+CNPVHKHRELRGLTSAGKKYRGLR +GH
Sbjct  121  WVGQDAVYKYYEVILVDPMHNAIRNNPKINWICNPVHKHRELRGLTSAGKKYRGLRVKGH  180

Query  225  LHHKARPSRRATWKRNQ  175
            L  K+RPS RA WKR Q
Sbjct  181  LSAKSRPSIRANWKRRQ  197



>gb|EOA94531.1| 60S ribosomal protein L15, partial [Anas platyrhynchos]
Length=206

 Score =   249 bits (636),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 162/199 (81%), Gaps = 2/199 (1%)
 Frame = -1

Query  765  AMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgy  586
            AMGAY Y+ ELWRKKQSDVMRFLLRVRCW+YRQL ++ R  RPTRPDKARRLGYKAKQGY
Sbjct  2    AMGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGY  61

Query  585  vvyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSY  406
            V+YRVRVRRGGRKRPVPKG  YGKP + GV QLKF RS +SVAEERAGR  G LRVLNSY
Sbjct  62   VIYRVRVRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGALRVLNSY  121

Query  405  WINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGH  226
            W+ EDSTYK+FEVIL+D  H AIR +P   W+  PVHKHRE+RGLTSAG+K RGL G+GH
Sbjct  122  WVGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGL-GKGH  180

Query  225  -LHHKARPSRRATWKRNQT  172
              HH    SRRA WKR  T
Sbjct  181  KFHHTIGGSRRAAWKRRNT  199



>gb|KGQ83010.1| 60S ribosomal protein L15-A [Candida albicans P37005]
 gb|KGT63650.1| 60S ribosomal protein L15-A [Candida albicans 12C]
 gb|KGU02265.1| 60S ribosomal protein L15-A [Candida albicans L26]
 gb|KGU02520.1| 60S ribosomal protein L15-A [Candida albicans 19F]
Length=204

 Score =   249 bits (635),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ EL RKKQSDVMRFL RVRCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELQRKKQSDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YR+RVRRGGRKRPV KG  YGKPTNQGV QLK+Q+S RS AEER GR+   LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVLKGATYGKPTNQGVNQLKYQKSLRSTAEERVGRRASNLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +N+DSTYKYFEVILVD +H AIR D R NW+ NPVHKHRE RGLTSAGKK RG+  +GHL
Sbjct  121  VNQDSTYKYFEVILVDPSHKAIRRDARYNWIVNPVHKHREARGLTSAGKKSRGI-NKGHL  179

Query  222  HHKARPSRRATWKRNQT  172
             +K +  RR TWK++ T
Sbjct  180  FNKTKAGRRHTWKKHNT  196



>gb|KEQ99844.1| hypothetical protein AUEXF2481DRAFT_25720 [Aureobasidium subglaciale 
EXF-2481]
Length=253

 Score =   251 bits (640),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 162/202 (80%), Gaps = 1/202 (0%)
 Frame = -1

Query  777  SSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKA  598
            S+   MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKA
Sbjct  46   SNTDKMGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKA  105

Query  597  KQgyvvyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV  418
            KQGYV+YRVRVRRGGRKRPVPKG  YGKPTNQGV QLKFQRS RSVAEER GR+   LRV
Sbjct  106  KQGYVIYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKFQRSLRSVAEERVGRRCANLRV  165

Query  417  LNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLR  238
            LNSYWIN+DSTYKYFE+ILVD  H AIR D RINW+ NPVHKHRELRGLTS GK  RG+ 
Sbjct  166  LNSYWINQDSTYKYFEIILVDPQHKAIRKDARINWIVNPVHKHRELRGLTSTGKHNRGI-  224

Query  237  GRGHLHHKARPSRRATWKRNQT  172
             +GH ++     RR TWKR  T
Sbjct  225  NKGHRYNNTSAGRRKTWKRQNT  246



>ref|XP_009159952.1| 60S ribosomal protein L15 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY59491.1| 60S ribosomal protein L15 [Exophiala dermatitidis NIH/UT8656]
Length=203

 Score =   249 bits (635),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS R+ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRATAEERVGRRCANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKYFEVILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH 
Sbjct  121  INQDSTYKYFEVILVDPQHKAIRRDPRINWIVNPVHKHREARGLTATGKKSRGL-GKGHG  179

Query  222  HHKARPSRRATWKRNQT  172
             +K    RR TWKR+ T
Sbjct  180  FNKTTAGRRKTWKRHNT  196



>ref|XP_001615040.1| 60S ribosomal protein L15-1 [Plasmodium vivax Sal-1]
 gb|EDL45313.1| 60S ribosomal protein L15-1, putative [Plasmodium vivax]
Length=205

 Score =   248 bits (634),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ E+W+KKQSD M FLLRVR WEYRQLP + RV+RP+RPDKARRLGYKA QG+V
Sbjct  1    MGAYKYIQEIWKKKQSDAMHFLLRVRTWEYRQLPVVHRVSRPSRPDKARRLGYKALQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL-GGLRVLNSY  406
            +YRVRVRRG RK+ V KG+V+GKP +QGV + K  R+ +SVAE + G+ + G LRVLNSY
Sbjct  61   IYRVRVRRGDRKKRVRKGVVHGKPKHQGVHKQKSTRNLKSVAEGKVGKSICGNLRVLNSY  120

Query  405  WINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGH  226
            W+ +D+ YKY+EVILVD  H A+RN+P+INW+CNPVHKHRELRGLTSAGKKYRGLR +GH
Sbjct  121  WVGQDAVYKYYEVILVDPMHNAVRNNPKINWICNPVHKHRELRGLTSAGKKYRGLRVKGH  180

Query  225  LHHKARPSRRATWKRNQ  175
            L  K+RPS RA WKR Q
Sbjct  181  LSAKSRPSIRANWKRRQ  197



>ref|XP_957199.1| 60S ribosomal protein L15 [Neurospora crassa OR74A]
 ref|XP_009852151.1| hypothetical protein NEUTE1DRAFT_117386 [Neurospora tetrasperma 
FGSC 2508]
 sp|Q8X034.1|RL15_NEUCR RecName: Full=60S ribosomal protein L15 [Neurospora crassa OR74A]
 emb|CAD21192.1| probable ribosomal protein L15.e.B, cytosolic [Neurospora crassa]
 gb|EAA27963.1| 60S ribosomal protein L15 [Neurospora crassa OR74A]
 gb|EGO56565.1| hypothetical protein NEUTE1DRAFT_117386 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ70567.1| putative ribosomal protein L15.e.B, cytosolic [Neurospora tetrasperma 
FGSC 2509]
 gb|KHE83595.1| hypothetical protein GE21DRAFT_3246 [Neurospora crassa]
Length=203

 Score =   248 bits (634),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  Y+ EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYLEELQKKKQSDVVRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YR RVRRGGRK+PVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  61   IYRARVRRGGRKKPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKYFEVILVD  H AIR DPRINW+ NPVHKHRE RGLTS GK+ RGL  +GH 
Sbjct  121  INQDSTYKYFEVILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTSTGKRSRGL-NKGHR  179

Query  222  HHKARPSRRATWKRNQT  172
            ++K R  RR TWKR+ T
Sbjct  180  YNKTRAGRRKTWKRHNT  196



>ref|XP_717445.1| likely cytosolic ribosomal protein L15 [Candida albicans SC5314]
 ref|XP_717356.1| likely cytosolic ribosomal protein L15 [Candida albicans SC5314]
 ref|XP_002421973.1| 60S ribosomal protein L15 [Candida dubliniensis CD36]
 gb|EAK98387.1| likely cytosolic ribosomal protein L15 [Candida albicans SC5314]
 gb|EAK98479.1| likely cytosolic ribosomal protein L15 [Candida albicans SC5314]
 emb|CAX39974.1| ribosomal protein, large subunit, putative [Candida dubliniensis 
CD36]
 gb|EEQ43509.1| 60S ribosomal protein L15-B [Candida albicans WO-1]
 gb|KGQ81742.1| 60S ribosomal protein L15-A [Candida albicans P94015]
 gb|KGQ82421.1| 60S ribosomal protein L15-A [Candida albicans GC75]
 gb|KGR01884.1| 60S ribosomal protein L15-A [Candida albicans P57072]
 gb|KGR03380.1| 60S ribosomal protein L15-A [Candida albicans P78048]
 gb|KGR06697.1| 60S ribosomal protein L15-A [Candida albicans P37037]
 gb|KGU01202.1| 60S ribosomal protein L15-A [Candida albicans P87]
 gb|KGU19047.1| 60S ribosomal protein L15-A [Candida albicans P34048]
 gb|KGU21267.1| 60S ribosomal protein L15-A [Candida albicans P57055]
 gb|KGU22062.1| 60S ribosomal protein L15-A [Candida albicans P75063]
 gb|KHC28236.1| 60S ribosomal protein L15-A [Candida albicans P76067]
 gb|KHC29192.1| 60S ribosomal protein L15-A [Candida albicans Ca6]
 gb|KHC29778.1| 60S ribosomal protein L15-A [Candida albicans P76055]
 gb|KHC45171.1| 60S ribosomal protein L15-A [Candida albicans P60002]
 gb|KHC45723.1| 60S ribosomal protein L15-A [Candida albicans P37039]
 gb|KHC54469.1| 60S ribosomal protein L15-A [Candida albicans P75010]
 gb|KHC61439.1| 60S ribosomal protein L15-A [Candida albicans P75016]
 gb|KHC66364.1| 60S ribosomal protein L15-A [Candida albicans P78042]
 gb|KHC71356.1| 60S ribosomal protein L15-A [Candida albicans SC5314]
 gb|KHC78351.1| 60S ribosomal protein L15-A [Candida albicans SC5314]
Length=204

 Score =   248 bits (634),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ EL RKKQSDVMRFL RVRCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELQRKKQSDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YR+RVRRGGRKRPVPKG  YGKPTNQGV QLK+Q+S RS AEER GR+   LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQKSLRSTAEERVGRRASNLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +N+DSTYKYFEVILVD +H AIR D R NW+ NPVHKHRE RGLTSAGKK RG+  +GHL
Sbjct  121  VNQDSTYKYFEVILVDPSHKAIRRDARYNWIVNPVHKHREARGLTSAGKKSRGI-NKGHL  179

Query  222  HHKARPSRRATWKRNQT  172
             +K +  RR TWK++ T
Sbjct  180  FNKTKAGRRHTWKKHNT  196



>ref|XP_007373844.1| hypothetical protein SPAPADRAFT_59682 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW34260.1| hypothetical protein SPAPADRAFT_59682 [Spathaspora passalidarum 
NRRL Y-27907]
Length=204

 Score =   248 bits (634),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ EL RKKQSDVMRFL RVRCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELQRKKQSDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            ++RVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+ G LRVLNSYW
Sbjct  61   IFRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRAGNLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKYFEVILVD +H AIR D R NW+  PVHKHRE RGLT+AGKK RG+  +GH 
Sbjct  121  INQDSTYKYFEVILVDPSHKAIRRDARYNWITEPVHKHRESRGLTAAGKKSRGI-NKGHR  179

Query  222  HHKARPSRRATWKRNQT  172
            + K +  RR TWK+N T
Sbjct  180  YTKTKAGRRHTWKKNNT  196



>ref|XP_008725811.1| 60S ribosomal protein L15 [Cladophialophora carrionii CBS 160.54]
 gb|ETI26466.1| 60S ribosomal protein L15 [Cladophialophora carrionii CBS 160.54]
Length=203

 Score =   248 bits (634),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 161/197 (82%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRCANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKYFEVILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH 
Sbjct  121  INQDSTYKYFEVILVDPNHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHG  179

Query  222  HHKARPSRRATWKRNQT  172
            ++     RR TWKR  T
Sbjct  180  YNNTTAGRRKTWKRQNT  196



>ref|XP_002162844.1| PREDICTED: 60S ribosomal protein L15-like [Hydra vulgaris]
Length=204

 Score =   248 bits (634),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 166/197 (84%), Gaps = 2/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ EL++KKQSD++RFL R+RCW+ R L +I R +RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELYKKKQSDLLRFLFRIRCWQLRHLNAIHRASRPTRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPV KGI YGKP  +GV QLKFQRS RSVAEERAGR  GGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVAKGITYGKPKGEGVNQLKFQRSIRSVAEERAGRYCGGLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            I +DSTYKYFEVI+VD AH A+R DPRINW+C  VHKHRELRGLT+AGKK RG+R +GH 
Sbjct  121  IAQDSTYKYFEVIMVDPAHKAVRRDPRINWICKAVHKHRELRGLTAAGKKNRGMR-KGHG  179

Query  222  HHKA-RPSRRATWKRNQ  175
            ++K    SRRA WK++ 
Sbjct  180  YNKVIGSSRRANWKKHN  196



>ref|XP_001525424.1| 60S ribosomal protein L15-B [Lodderomyces elongisporus NRRL YB-4239]
 gb|EDK45173.1| 60S ribosomal protein L15-B [Lodderomyces elongisporus NRRL YB-4239]
Length=204

 Score =   248 bits (634),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ EL RKKQSDVMRFL RVRCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELQRKKQSDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV  LK+Q+S RS AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNHLKYQKSLRSTAEERVGRRAANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +N+DSTYKYFEVILVD  H AIR DPR NW+ N VHKHRE RGLTSAGKK RG+  +GHL
Sbjct  121  VNQDSTYKYFEVILVDPQHKAIRRDPRYNWIANAVHKHREARGLTSAGKKSRGI-NKGHL  179

Query  222  HHKARPSRRATWKRNQT  172
            ++K R  RR TWK++ T
Sbjct  180  YNKTRAGRRHTWKKHNT  196



>gb|KIE03942.1| Ribosomal protein L15e, partial [Metarhizium majus ARSEF 297]
Length=203

 Score =   248 bits (634),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  YV EL +KKQSDVMRFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVMRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKY+EVILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  INQDSTYKYYEVILVDPQHKAIRIDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHR  179

Query  222  HHKARPSRRATWKRNQT  172
            ++K +  RR TW R+ T
Sbjct  180  YNKTQAGRRKTWLRHNT  196



>ref|XP_004377436.1| PREDICTED: 60S ribosomal protein L15 isoform 1 [Trichechus manatus 
latirostris]
 ref|XP_004377437.1| PREDICTED: 60S ribosomal protein L15 isoform 2 [Trichechus manatus 
latirostris]
Length=204

 Score =   248 bits (634),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 161/198 (81%), Gaps = 2/198 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELWRKKQSDVMRFLLRVRCW+YRQL ++ R  RPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKG  YGKP N GV QLKF RS +SVAEERAGR  G LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPVNHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGH-  226
            + EDSTYK+FEVIL+D  H AIR +P   W+  PVHKHRE+RGLTSAG+K RGL G+GH 
Sbjct  121  VGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGL-GKGHK  179

Query  225  LHHKARPSRRATWKRNQT  172
             HH    SRRA W+R  T
Sbjct  180  FHHTIGGSRRAAWRRRNT  197



>ref|XP_001541513.1| 60S ribosomal protein L15 [Histoplasma capsulatum NAm1]
 gb|EDN07080.1| 60S ribosomal protein L15 [Histoplasma capsulatum NAm1]
 gb|EEH11352.1| 60S ribosomal protein L15 [Histoplasma capsulatum G186AR]
 gb|EER43402.1| 60S ribosomal protein L15 [Histoplasma capsulatum H143]
 gb|EGC46336.1| 60S ribosomal protein [Histoplasma capsulatum H88]
Length=203

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 158/197 (80%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVIRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKR  PKG  YGKPTN GV QLK+QRS R  AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRQAPKGATYGKPTNHGVNQLKYQRSLRCTAEERVGRRCANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            INEDSTYKYFEVILVD  H AIR DPRINW+  PVHKHRE RGLT+AGKK RGL GRGH 
Sbjct  121  INEDSTYKYFEVILVDPQHKAIRRDPRINWIVKPVHKHRESRGLTAAGKKSRGL-GRGHS  179

Query  222  HHKARPSRRATWKRNQT  172
            ++K    RR TWKR  T
Sbjct  180  YNKTSAGRRKTWKRLNT  196



>ref|XP_008816354.1| ribosomal L15 [Plasmodium inui San Antonio 1]
 gb|EUD66949.1| ribosomal L15 [Plasmodium inui San Antonio 1]
Length=205

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ E+W+KKQSD M FLLR+R WEYRQLP + RV+RP+RPDKARRLGYKA QG+V
Sbjct  1    MGAYKYIQEIWKKKQSDAMHFLLRIRTWEYRQLPVVHRVSRPSRPDKARRLGYKALQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL-GGLRVLNSY  406
            +YRVRVRRG RK+ V KG+V+GKP +QGV + K  R+ +SVAE + G+ + G LRVLNSY
Sbjct  61   IYRVRVRRGDRKKRVRKGVVHGKPKHQGVHKQKSTRNLKSVAEGKVGKSICGNLRVLNSY  120

Query  405  WINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGH  226
            W+ +D+ YKY+EVILVD  H A+RN+P+INW+CNPVHKHRELRGLTSAGKKYRGLR +GH
Sbjct  121  WVGQDAVYKYYEVILVDPMHNAVRNNPKINWICNPVHKHRELRGLTSAGKKYRGLRVKGH  180

Query  225  LHHKARPSRRATWKRNQ  175
            L  K+RPS RA WKR Q
Sbjct  181  LSAKSRPSIRANWKRRQ  197



>ref|XP_002808654.1| 60S ribosomal protein L15, putative [Plasmodium falciparum 3D7]
 pdb|1VX7|P Chain P, Cryo-em Structure Of The Plasmodium Falciparum 80s Ribosome 
Bound To The Anti-protozoan Drug Emetine, Large Subunit 
(protein Only)
 emb|CAX63924.1| 60S ribosomal protein L15, putative [Plasmodium falciparum 3D7]
 gb|ETW20301.1| hypothetical protein PFFVO_00777 [Plasmodium falciparum Vietnam 
Oak-Knoll (FVO)]
 gb|ETW44797.1| hypothetical protein PFNF135_00852 [Plasmodium falciparum NF135/5.C10]
 gb|ETW51144.1| hypothetical protein PFMALIP_00795 [Plasmodium falciparum MaliPS096_E11]
 gb|ETW56710.1| hypothetical protein PFUGPA_01500 [Plasmodium falciparum Palo 
Alto/Uganda]
 gb|ETW63318.1| hypothetical protein PFMC_00794 [Plasmodium falciparum CAMP/Malaysia]
 gb|EUR78661.1| hypothetical protein PFBG_00756 [Plasmodium falciparum 7G8]
 gb|EUT91394.1| hypothetical protein PFAG_00728 [Plasmodium falciparum Santa 
Lucia]
 emb|CDO62804.1| 60S ribosomal protein L15, putative [Plasmodium reichenowi]
Length=205

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ E+W+KKQSD M FLLRVR WEYRQLP + RV++P+RPDKARRLGYKA QG+V
Sbjct  1    MGAYKYIQEIWKKKQSDAMHFLLRVRTWEYRQLPVVHRVSKPSRPDKARRLGYKAIQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL-GGLRVLNSY  406
            +YRVRVRRG RK+ V KGIV+GKP +QGV + K  R+ +SVAE + G+ + G LRVLNSY
Sbjct  61   IYRVRVRRGDRKKRVKKGIVHGKPKHQGVHKQKSTRNLKSVAEGKVGKSICGNLRVLNSY  120

Query  405  WINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGH  226
            W+ +D+ YKY+EVILVD  H A+RN+P+INW+CNPVHKHRELRGLTSAGKKYRGLR +GH
Sbjct  121  WVGQDAVYKYYEVILVDPNHNAVRNNPKINWICNPVHKHRELRGLTSAGKKYRGLRVKGH  180

Query  225  LHHKARPSRRATWKRNQ  175
            L  K+RPS RA WKR Q
Sbjct  181  LSAKSRPSIRANWKRRQ  197



>ref|XP_002598589.1| hypothetical protein BRAFLDRAFT_113717 [Branchiostoma floridae]
 gb|EEN54601.1| hypothetical protein BRAFLDRAFT_113717 [Branchiostoma floridae]
Length=204

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 163/198 (82%), Gaps = 2/198 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY YV ELWRKKQSDVMRFLLRVRCW+YR L +I R  RPTRP+KA RLGYKAKQGYV
Sbjct  1    MGAYKYVQELWRKKQSDVMRFLLRVRCWQYRNLSAIHRAPRPTRPEKAHRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YR+R+RRGGRK+PVPKG  YGKP +QGV Q+KF R+ RSVAEER GR  G LRV+NSYW
Sbjct  61   IYRIRLRRGGRKKPVPKGATYGKPVHQGVNQMKFARNLRSVAEERVGRACGALRVMNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            + +DSTYK+FEVILVD  H A+R+DP + W+C PV KHRELRGLTSAGK  RGL G+GHL
Sbjct  121  VGQDSTYKFFEVILVDPFHKAVRHDPEVQWICKPVMKHRELRGLTSAGKSSRGL-GKGHL  179

Query  222  HHKAR-PSRRATWKRNQT  172
            HHK +  S RA+WKR  T
Sbjct  180  HHKTKGGSWRASWKRRNT  197



>gb|KIW41910.1| 60S ribosomal protein L15 [Exophiala oligosperma]
Length=264

 Score =   250 bits (638),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  62   MGALKYVEELHKKKQSDVLRFLLRVRCWELRQLKVIHRASRPSRPDKARRLGYKAKQGYV  121

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  122  IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYW  181

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKYFEVILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH 
Sbjct  182  INQDSTYKYFEVILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHG  240

Query  222  HHKARPSRRATWKRNQT  172
            + K    RR TWKR+ T
Sbjct  241  YSKTTAGRRKTWKRHNT  257



>gb|KEQ59346.1| 60S ribosomal protein L15 [Aureobasidium melanogenum CBS 110374]
 gb|KEQ71724.1| 60S ribosomal protein L15 [Aureobasidium pullulans var. namibiae 
CBS 147.97]
 gb|KEQ81902.1| 60S ribosomal protein L15 [Aureobasidium pullulans EXF-150]
Length=203

 Score =   248 bits (632),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 160/197 (81%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLKFQRS RSVAEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKFQRSLRSVAEERVGRRCANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKYFE+ILVD  H AIR D RINW+ NPVHKHRELRGLTS GK  RG+  +GH 
Sbjct  121  INQDSTYKYFEIILVDPQHKAIRKDARINWIVNPVHKHRELRGLTSTGKHNRGI-NKGHR  179

Query  222  HHKARPSRRATWKRNQT  172
            ++     RR TWKR  T
Sbjct  180  YNNTSAGRRKTWKRQNT  196



>ref|XP_003869213.1| Rpl15a ribosomal protein [Candida orthopsilosis Co 90-125]
 emb|CCG23077.1| Rpl15a ribosomal protein [Candida orthopsilosis]
Length=204

 Score =   248 bits (632),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ EL RKKQSDVMRFL RVRCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELQRKKQSDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYR+RVRRGGRKRPVPKG  YGKPTNQGV  LK+QRS RS AEER GR+   LRVLNSYW
Sbjct  61   VYRIRVRRGGRKRPVPKGATYGKPTNQGVNHLKYQRSLRSTAEERVGRRAANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKY+EVILVD  H AIR DPR NW+ N VHKHRE RGLTSAGKK RG+  +GHL
Sbjct  121  INQDSTYKYYEVILVDPQHKAIRRDPRYNWIANAVHKHRESRGLTSAGKKSRGI-NKGHL  179

Query  222  HHKARPSRRATWKRNQT  172
            ++K R  RR TWK++ T
Sbjct  180  YNKTRAGRRHTWKKHNT  196



>ref|XP_003415776.1| PREDICTED: 60S ribosomal protein L15 [Loxodonta africana]
 ref|XP_005297124.1| PREDICTED: 60S ribosomal protein L15 [Chrysemys picta bellii]
 ref|XP_005297125.1| PREDICTED: 60S ribosomal protein L15 [Chrysemys picta bellii]
 ref|XP_005297126.1| PREDICTED: 60S ribosomal protein L15 [Chrysemys picta bellii]
 ref|XP_005297127.1| PREDICTED: 60S ribosomal protein L15 [Chrysemys picta bellii]
 ref|XP_006134385.1| PREDICTED: 60S ribosomal protein L15 [Pelodiscus sinensis]
 ref|XP_008168855.1| PREDICTED: 60S ribosomal protein L15 [Chrysemys picta bellii]
Length=204

 Score =   248 bits (632),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 161/198 (81%), Gaps = 2/198 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELWRKKQSDVMRFLLRVRCW+YRQL ++ R  RPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YR+RVRRGGRKRPVPKG  YGKP N GV QLKF RS +SVAEERAGR  G LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGATYGKPVNHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGH-  226
            + EDSTYK+FEVIL+D  H AIR +P   W+  PVHKHRE+RGLTSAG+K RGL G+GH 
Sbjct  121  VGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGL-GKGHK  179

Query  225  LHHKARPSRRATWKRNQT  172
             HH    SRRA W+R  T
Sbjct  180  FHHTIGGSRRAAWRRRNT  197



>ref|XP_004198963.1| Piso0_002360 [Millerozyma farinosa CBS 7064]
 emb|CCE82626.1| Piso0_002360 [Millerozyma farinosa CBS 7064]
Length=204

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 165/197 (84%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ EL RKKQSDV+RFL RVRCWE+RQ   I R +RP+RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELQRKKQSDVLRFLQRVRCWEFRQKNVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            ++R+RVRRGGRKRPVPKG+ YGKPTNQGV QLK+Q+  RS AEER GR+   LRVLNSYW
Sbjct  61   IFRIRVRRGGRKRPVPKGVTYGKPTNQGVNQLKYQKPLRSTAEERVGRRAANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +N+DSTYK+FEVI+VD +H AIR DPR NW+ NPVHKHRE RGLT+AGKKYRG+  +GHL
Sbjct  121  VNQDSTYKFFEVIMVDPSHKAIRRDPRFNWIANPVHKHRESRGLTAAGKKYRGI-NKGHL  179

Query  222  HHKARPSRRATWKRNQT  172
            ++ +R  RR  WK++ T
Sbjct  180  YNNSRSGRRHIWKKHNT  196



>ref|XP_005029295.1| PREDICTED: 60S ribosomal protein L15 [Anas platyrhynchos]
Length=204

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 161/198 (81%), Gaps = 2/198 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELWRKKQSDVMRFLLRVRCW+YRQL ++ R  RPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKG  YGKP + GV QLKF RS +SVAEERAGR  G LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGH-  226
            + EDSTYK+FEVIL+D  H AIR +P   W+  PVHKHRE+RGLTSAG+K RGL G+GH 
Sbjct  121  VGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGL-GKGHK  179

Query  225  LHHKARPSRRATWKRNQT  172
             HH    SRRA WKR  T
Sbjct  180  FHHTIGGSRRAAWKRRNT  197



>ref|XP_002258209.1| ribosomal protein l15 [Plasmodium knowlesi strain H]
 emb|CAQ38746.1| ribosomal protein l15, putative [Plasmodium knowlesi strain H]
Length=205

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ E+W+KKQSD M FLLRVR WEYRQLP + RV++P+RPDKARRLGYKA QG+V
Sbjct  1    MGAYKYIQEIWKKKQSDAMHFLLRVRTWEYRQLPVVHRVSKPSRPDKARRLGYKALQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL-GGLRVLNSY  406
            +YRVRVRRG RK+ V KG+V+GKP +QGV + K  R+ +SVAE + G+ + G LRVLNSY
Sbjct  61   IYRVRVRRGDRKKRVRKGVVHGKPKHQGVHKQKSTRNLKSVAEGKVGKSICGNLRVLNSY  120

Query  405  WINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGH  226
            W+ +D+ YKY+EVILVD  H A+RN+P+INW+CNPVHKHRELRGLTSAGKKYRGLR +GH
Sbjct  121  WVGQDAVYKYYEVILVDPMHNAVRNNPKINWICNPVHKHRELRGLTSAGKKYRGLRVKGH  180

Query  225  LHHKARPSRRATWKRNQ  175
            L  K+RPS RA WKR Q
Sbjct  181  LSAKSRPSIRANWKRRQ  197



>ref|XP_007812013.1| 60S ribosomal protein L15 [Metarhizium acridum CQMa 102]
 ref|XP_007818066.1| Ribosomal protein L15e [Metarhizium robertsii ARSEF 23]
 gb|EFY88332.1| 60S ribosomal protein L15 [Metarhizium acridum CQMa 102]
 gb|EFZ02295.1| Ribosomal protein L15e [Metarhizium robertsii ARSEF 23]
 gb|EXV05475.1| ribosomal protein L15 [Metarhizium robertsii]
 gb|KFG82830.1| 60S ribosomal protein L15 [Metarhizium anisopliae]
 gb|KID67254.1| Ribosomal protein L15e, partial [Metarhizium anisopliae ARSEF 
549]
 gb|KID88474.1| Ribosomal protein L15e [Metarhizium guizhouense ARSEF 977]
Length=203

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  YV EL +KKQSDVMRFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVMRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKY+EVILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  INQDSTYKYYEVILVDPQHKAIRIDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHR  179

Query  222  HHKARPSRRATWKRNQT  172
            ++K +  RR TW R+ T
Sbjct  180  YNKTQAGRRKTWLRHNT  196



>gb|EMS24660.1| 60S ribosomal protein l15 [Rhodosporidium toruloides NP11]
 emb|CDR35885.1| RHTO0S01e09384g1_1 [Rhodosporidium toruloides]
Length=201

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 164/197 (83%), Gaps = 3/197 (2%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y++EL ++KQSDV+RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLTELQKRKQSDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            VYRVRVRRG RKRPVPKG  YGKPTNQGV QLKFQRS RS AEER  R+ G LRVLNSYW
Sbjct  61   VYRVRVRRGNRKRPVPKGATYGKPTNQGVNQLKFQRSLRSTAEERVARRCGNLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+D  YKY+EVILVD +H AIR D RINW+CNPVHK RE RGLTSAGK+ RGL G+GH 
Sbjct  121  INQDGVYKYYEVILVDPSHKAIRRDARINWICNPVHKRRESRGLTSAGKQNRGL-GKGHS  179

Query  222  HHKARPSRRATWKRNQT  172
            + K+  +RRA WKR  T
Sbjct  180  YTKS--NRRAHWKRTNT  194



>ref|XP_007788991.1| putative 60s ribosomal protein l15 protein [Eutypa lata UCREL1]
 gb|EMR71923.1| putative 60s ribosomal protein l15 protein [Eutypa lata UCREL1]
Length=203

 Score =   247 bits (630),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKY+EVILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  INQDSTYKYYEVILVDPQHKAIRLDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHR  179

Query  222  HHKARPSRRATWKRNQT  172
            ++K R  RR TWKR+ T
Sbjct  180  YNKTRAGRRKTWKRHNT  196



>gb|EPQ66314.1| Protein component of the large (60S) ribosomal subunit [Blumeria 
graminis f. sp. tritici 96224]
 emb|CCU77282.1| 60S ribosomal protein L15 [Blumeria graminis f. sp. hordei DH14]
Length=203

 Score =   247 bits (630),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  + R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVVHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKY+EVILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GK+ RGL G+GH 
Sbjct  121  INQDSTYKYYEVILVDPQHKAIRRDPRINWIVNPVHKHRECRGLTATGKRSRGL-GKGHG  179

Query  222  HHKARPSRRATWKRNQT  172
            ++K    RR TWKR+ T
Sbjct  180  YNKTTAGRRKTWKRHNT  196



>gb|KID77747.1| Ribosomal protein L15e, partial [Metarhizium brunneum ARSEF 3297]
Length=203

 Score =   247 bits (630),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  YV EL +KKQSDVMRFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVMRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKY+E+ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  INQDSTYKYYEIILVDPQHKAIRIDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHR  179

Query  222  HHKARPSRRATWKRNQT  172
            ++K +  RR TW R+ T
Sbjct  180  YNKTQAGRRKTWLRHNT  196



>gb|KIX93106.1| 60S ribosomal protein L15 [Fonsecaea multimorphosa CBS 102226]
Length=203

 Score =   247 bits (630),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YR+RVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRCANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKY+E+ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH 
Sbjct  121  INQDSTYKYYEIILVDPNHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHG  179

Query  222  HHKARPSRRATWKRNQT  172
            + K    RR TWKR+ T
Sbjct  180  YTKTTSGRRKTWKRHNT  196



>emb|CCE42581.1| hypothetical protein CPAR2_202240 [Candida parapsilosis]
Length=204

 Score =   247 bits (630),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ EL RKKQSDVMRFL RVRCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELQRKKQSDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YR+RVRRGGRKRPVPKG  YGKPTNQGV  LK+QRS RS AEER GR+   LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGATYGKPTNQGVNHLKYQRSLRSTAEERVGRRAANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            +N+DSTYKY+EVILVD  H AIR DPR NW+ N VHKHRE RGLTSAGKK RG+  +GHL
Sbjct  121  VNQDSTYKYYEVILVDPQHKAIRRDPRYNWIANAVHKHRESRGLTSAGKKSRGI-NKGHL  179

Query  222  HHKARPSRRATWKRNQT  172
            ++K R  RR TWK++ T
Sbjct  180  YNKTRAGRRHTWKKHNT  196



>ref|XP_003233932.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 118892]
 gb|EGD89563.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 118892]
 gb|EGD98634.1| 60S ribosomal protein L15 [Trichophyton tonsurans CBS 112818]
 gb|EGE06831.1| ribosomal protein L15 [Trichophyton equinum CBS 127.97]
 gb|EZF24323.1| 60S ribosomal protein L15 [Trichophyton rubrum MR850]
 gb|EZF35746.1| 60S ribosomal protein L15 [Trichophyton interdigitale H6]
 gb|EZF43284.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 100081]
 gb|EZF53926.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 288.86]
 gb|EZF64574.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 289.86]
 gb|EZF75156.1| 60S ribosomal protein L15 [Trichophyton soudanense CBS 452.61]
 gb|EZF85853.1| 60S ribosomal protein L15 [Trichophyton rubrum MR1448]
 gb|EZF96634.1| 60S ribosomal protein L15 [Trichophyton rubrum MR1459]
 gb|EZG07762.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 735.88]
 gb|EZG18074.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 202.88]
 gb|KDB26559.1| 60S ribosomal protein L15 [Trichophyton interdigitale MR816]
 gb|KDB35118.1| 60S ribosomal protein L15 [Trichophyton rubrum D6]
Length=203

 Score =   247 bits (630),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 158/197 (80%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  YV EL +KKQSDVMRFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YR+RVRRGGRKR   KG  YGKPTNQGV QLK+QRS RS AEER G++   LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRTARKGATYGKPTNQGVNQLKYQRSLRSTAEERVGKRCANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKY+E+ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  INQDSTYKYYEIILVDPQHKAIRKDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHG  179

Query  222  HHKARPSRRATWKRNQT  172
            ++K    RR TWKR  T
Sbjct  180  YNKTTAGRRKTWKRLNT  196



>ref|XP_010986099.1| PREDICTED: 60S ribosomal protein L15 [Camelus dromedarius]
Length=204

 Score =   247 bits (630),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 162/198 (82%), Gaps = 2/198 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELWRKKQSDVMRFLLRVRCW+YRQL ++ R  RPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YR+RVRRGGRKRPVPKG  YGKP + GV QLKF RS +SVAEERAGR  G LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGH-  226
            + EDSTYK+FEVIL+D+ H AIR +P   W+  PVHKHRE+RGLTSAG+K RGL G+GH 
Sbjct  121  VGEDSTYKFFEVILIDSFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGL-GKGHK  179

Query  225  LHHKARPSRRATWKRNQT  172
             HH    SRRA W+R  T
Sbjct  180  FHHTIGGSRRAAWRRRNT  197



>gb|ETW38445.1| hypothetical protein PFTANZ_00876 [Plasmodium falciparum Tanzania 
(2000708)]
Length=205

 Score =   247 bits (630),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ E+W+KKQSD M FLLRVR WEYRQLP + RV++P+RPDKARRLGYKA QG+V
Sbjct  1    MGAYKYIQEIWKKKQSDAMHFLLRVRTWEYRQLPVVHRVSKPSRPDKARRLGYKAIQGFV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL-GGLRVLNSY  406
            +YRVRVRRG RK+ V KGIV+GKP +QGV + K  R+ +SVAE + G+ + G LRVLNSY
Sbjct  61   IYRVRVRRGDRKKRVKKGIVHGKPKHQGVHKQKSTRNLKSVAEGKVGKSICGNLRVLNSY  120

Query  405  WINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGH  226
            W+ +D+ YKY+EVILVD  H A+RN+P+INW+CNPVHKHRELRGLTSAGKKYRGLR +GH
Sbjct  121  WVGQDAVYKYYEVILVDPNHNAVRNNPKINWICNPVHKHRELRGLTSAGKKYRGLRVKGH  180

Query  225  LHHKARPSRRATWKRNQ  175
            L  K+RPS RA W+R Q
Sbjct  181  LSAKSRPSIRANWRRRQ  197



>gb|KIW07591.1| 60S ribosomal protein L15 [Verruconis gallopava]
Length=203

 Score =   247 bits (630),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 161/197 (82%), Gaps = 1/197 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGA  Y+ EL ++KQSDVMRFLLRVRCWEYRQ   I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYIEELQKRKQSDVMRFLLRVRCWEYRQRHVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YR+RVRRGGRKRP PKG  YGKPTNQG+ QLK+QRS R+ AEER GR+   LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPAPKGATYGKPTNQGINQLKYQRSLRATAEERVGRRCANLRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  223
            IN+DSTYKY+EVILVD  H AIR DPRINW+ NPVHKHRE RGLTS GKK RGL  +GH 
Sbjct  121  INQDSTYKYYEVILVDPQHKAIRRDPRINWIVNPVHKHREARGLTSTGKKSRGL-NKGHR  179

Query  222  HHKARPSRRATWKRNQT  172
            ++K R  RR  WKR+ T
Sbjct  180  YNKTRGGRRKAWKRHNT  196



>ref|XP_007421748.1| PREDICTED: 60S ribosomal protein L15 isoform X1 [Python bivittatus]
 ref|XP_007421749.1| PREDICTED: 60S ribosomal protein L15 isoform X2 [Python bivittatus]
Length=204

 Score =   247 bits (630),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 162/198 (82%), Gaps = 2/198 (1%)
 Frame = -1

Query  762  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  583
            MGAY Y+ ELWRKKQSDVMRFLLRVRCW+YRQL ++ R  RPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYV  60

Query  582  vyrvrvrrggrkrpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  403
            +YR+RVRRGGRKRPVPKG  YGKP + GV QLKF RS +SVAEERAGR  G LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYW  120

Query  402  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGH-  226
            + EDSTYK+FEVILVD  H AIR +P   W+  PVHKHRE+RGLTSAG+K RGL G+GH 
Sbjct  121  VGEDSTYKFFEVILVDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGL-GKGHK  179

Query  225  LHHKARPSRRATWKRNQT  172
             HH    SRRA W+R+ T
Sbjct  180  FHHTIGGSRRAAWRRHNT  197



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1521097577940