BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF023C17

Length=725
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57279.1|  alpha-expansin                                         494   4e-175   Ipomoea nil [qian niu]
ref|NP_001234081.1|  expansin A4 precursor                              429   2e-149   Solanum lycopersicum
ref|XP_009761115.1|  PREDICTED: expansin-A6-like                        429   3e-149   Nicotiana sylvestris
gb|AAR82849.1|  expansin-1                                              429   4e-149   Petunia x hybrida [garden petunia]
gb|KDP35637.1|  hypothetical protein JCGZ_09075                         428   4e-149   Jatropha curcas
ref|XP_006341021.1|  PREDICTED: expansin-A3                             428   6e-149   Solanum tuberosum [potatoes]
ref|XP_003519349.1|  PREDICTED: expansin-A4-like                        427   1e-148   Glycine max [soybeans]
ref|XP_009613959.1|  PREDICTED: expansin-A6-like                        427   2e-148   Nicotiana tomentosiformis
gb|KJB16930.1|  hypothetical protein B456_002G257400                    427   2e-148   Gossypium raimondii
ref|XP_004249634.1|  PREDICTED: expansin-A3                             426   2e-148   
gb|ACJ48968.2|  expansin                                                426   4e-148   Breonia chinensis
gb|AEQ55274.1|  expansin                                                426   5e-148   Breonia chinensis
ref|XP_003544219.1|  PREDICTED: expansin-A6-like                        426   5e-148   Glycine max [soybeans]
gb|KJB76740.1|  hypothetical protein B456_012G104400                    426   6e-148   Gossypium raimondii
gb|KHG30766.1|  Expansin-A4 -like protein                               426   6e-148   Gossypium arboreum [tree cotton]
ref|XP_009788740.1|  PREDICTED: expansin-A3-like                        425   8e-148   Nicotiana sylvestris
gb|AEQ55290.1|  expansin                                                425   1e-147   Breonia chinensis
ref|XP_004142066.1|  PREDICTED: expansin-A4-like                        424   1e-147   
ref|XP_007027012.1|  Expansin A4, ALPHA 1.6,EXPA4                       425   1e-147   
gb|AEQ55275.1|  expansin                                                424   2e-147   Breonia chinensis
ref|XP_004147685.1|  PREDICTED: expansin-A4-like                        424   2e-147   Cucumis sativus [cucumbers]
ref|NP_001234881.1|  expansin9 precursor                                424   2e-147   Solanum lycopersicum
ref|NP_001284471.1|  expansin-A4 precursor                              424   2e-147   Cucumis melo [Oriental melon]
ref|XP_009597793.1|  PREDICTED: expansin-A6-like                        424   3e-147   Nicotiana tomentosiformis
ref|XP_007009225.1|  Expansin A4, ALPHA 1.6,EXPA4                       423   4e-147   
ref|XP_002533097.1|  Alpha-expansin 4 precursor, putative               423   4e-147   Ricinus communis
ref|XP_008461679.1|  PREDICTED: expansin-A4                             423   5e-147   Cucumis melo [Oriental melon]
gb|AEE69071.1|  expansin-4                                              422   6e-147   Petunia hybrid cultivar [hybrid petunia]
ref|XP_006349505.1|  PREDICTED: expansin-A3-like                        423   7e-147   Solanum tuberosum [potatoes]
gb|KHG12430.1|  Expansin-A4 -like protein                               423   9e-147   Gossypium arboreum [tree cotton]
ref|XP_008233635.1|  PREDICTED: expansin-A4-like                        422   1e-146   Prunus mume [ume]
gb|KJB46592.1|  hypothetical protein B456_007G376300                    422   1e-146   Gossypium raimondii
gb|ACN94264.1|  expansin                                                422   2e-146   Rehmannia glutinosa [Chinese foxglove]
ref|XP_003537990.1|  PREDICTED: expansin-A4-like                        422   2e-146   
ref|XP_002298353.1|  alpha-expansin 1 family protein                    422   2e-146   Populus trichocarpa [western balsam poplar]
ref|XP_010256907.1|  PREDICTED: expansin-A4                             421   2e-146   Nelumbo nucifera [Indian lotus]
ref|XP_009768238.1|  PREDICTED: expansin-A6-like                        421   2e-146   Nicotiana sylvestris
ref|XP_003616412.1|  Expansin                                           421   3e-146   Medicago truncatula
gb|ACO07292.1|  expansin 10                                             421   3e-146   Cucumis sativus [cucumbers]
gb|ADC35365.1|  alpha-expansin 2                                        421   4e-146   Coffea arabica [arabica coffee]
ref|XP_011035307.1|  PREDICTED: expansin-A6                             421   4e-146   Populus euphratica
ref|XP_007218834.1|  hypothetical protein PRUPE_ppa010198mg             421   4e-146   Prunus persica
ref|XP_006366490.1|  PREDICTED: expansin-A6                             421   4e-146   Solanum tuberosum [potatoes]
gb|AAM22625.1|AF428178_1  expansin 11 precursor                         421   5e-146   Rumex palustris
gb|ACK36943.1|  expansin                                                421   5e-146   Annona cherimola [cherimoya]
dbj|BAN09210.1|  alpha expansin                                         421   6e-146   Eustoma exaltatum subsp. russellianum [bluebells]
gb|KDP44940.1|  hypothetical protein JCGZ_01440                         420   7e-146   Jatropha curcas
ref|XP_009607348.1|  PREDICTED: expansin-A3-like                        422   7e-146   Nicotiana tomentosiformis
ref|XP_007016396.1|  Expansin A4, ALPHA 1.6,EXPA4                       420   7e-146   Theobroma cacao [chocolate]
gb|KDP20458.1|  hypothetical protein JCGZ_05303                         420   7e-146   Jatropha curcas
ref|XP_009757427.1|  PREDICTED: expansin-A4-like                        420   8e-146   Nicotiana sylvestris
ref|XP_007140533.1|  hypothetical protein PHAVU_008G120700g             420   8e-146   Phaseolus vulgaris [French bean]
ref|XP_007205740.1|  hypothetical protein PRUPE_ppa010180mg             420   8e-146   Prunus persica
emb|CDP00110.1|  unnamed protein product                                420   9e-146   Coffea canephora [robusta coffee]
gb|AHL25255.1|  expansin                                                420   1e-145   Boehmeria nivea [Chinese silk-plant]
gb|KHG15821.1|  Expansin-A4 -like protein                               420   1e-145   Gossypium arboreum [tree cotton]
ref|XP_003552923.2|  PREDICTED: expansin-A3-like                        420   1e-145   Glycine max [soybeans]
ref|XP_002283530.1|  PREDICTED: expansin-A4                             419   1e-145   Vitis vinifera
gb|KJB36710.1|  hypothetical protein B456_006G172400                    420   1e-145   Gossypium raimondii
ref|XP_009587747.1|  PREDICTED: expansin-A3-like                        419   2e-145   Nicotiana tomentosiformis
emb|CDP09064.1|  unnamed protein product                                419   2e-145   Coffea canephora [robusta coffee]
gb|AAR82850.1|  expansin-2                                              419   2e-145   Petunia x hybrida [garden petunia]
ref|XP_008223717.1|  PREDICTED: expansin-A4                             419   2e-145   Prunus mume [ume]
ref|XP_011089478.1|  PREDICTED: expansin-A6                             419   2e-145   Sesamum indicum [beniseed]
gb|KJB73995.1|  hypothetical protein B456_011G266000                    419   2e-145   Gossypium raimondii
ref|XP_010264435.1|  PREDICTED: expansin-A4                             419   2e-145   Nelumbo nucifera [Indian lotus]
ref|XP_002313434.1|  alpha-expansin 1 family protein                    419   2e-145   Populus trichocarpa [western balsam poplar]
gb|AAM22624.1|AF428177_1  expansin 10 precursor                         419   3e-145   Rumex palustris
gb|AFZ78606.1|  expansin protein                                        419   3e-145   Populus tomentosa [Chinese white poplar]
gb|AAM22626.1|AF428179_1  expansin 12 precursor                         419   3e-145   Rumex palustris
ref|XP_007141864.1|  hypothetical protein PHAVU_008G232200g             419   3e-145   Phaseolus vulgaris [French bean]
gb|AEN70914.1|  expansin                                                419   4e-145   Gossypium trilobum
ref|XP_004486999.1|  PREDICTED: expansin-A6-like                        418   4e-145   Cicer arietinum [garbanzo]
gb|AFB77223.1|  expansin 1                                              418   4e-145   Betula platyphylla [Asian white birch]
gb|ADY68814.1|  expansin                                                418   4e-145   Gossypium barbadense [Egyptian cotton]
ref|NP_001242978.1|  expansin-A4-like precursor                         418   5e-145   Glycine max [soybeans]
ref|XP_003552173.1|  PREDICTED: expansin-A4                             418   6e-145   Glycine max [soybeans]
ref|XP_004300427.1|  PREDICTED: expansin-A6                             418   6e-145   Fragaria vesca subsp. vesca
gb|AAR09168.1|  alpha-expansin 1                                        418   6e-145   Populus tremula x Populus tremuloides
gb|ADY68815.1|  expansin                                                418   7e-145   Gossypium barbadense [Egyptian cotton]
ref|XP_010920576.1|  PREDICTED: expansin-A4-like                        418   7e-145   Elaeis guineensis
gb|AEN70893.1|  expansin                                                418   7e-145   Gossypium schwendimanii
gb|AEU08407.1|  expansin 2                                              417   8e-145   Prunus salicina [Japanese plum]
ref|XP_010685747.1|  PREDICTED: expansin-A4                             417   8e-145   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003543517.1|  PREDICTED: expansin-A4                             417   9e-145   Glycine max [soybeans]
gb|AEN70891.1|  expansin                                                417   9e-145   Gossypium thurberi
emb|CAN73252.1|  hypothetical protein VITISV_027049                     417   1e-144   Vitis vinifera
gb|KJB55836.1|  hypothetical protein B456_009G098800                    417   1e-144   Gossypium raimondii
gb|ADY68817.1|  expansin                                                417   1e-144   Gossypium raimondii
ref|XP_002283358.1|  PREDICTED: expansin-A4                             417   1e-144   Vitis vinifera
gb|KHG20113.1|  Expansin-A4 -like protein                               417   1e-144   Gossypium arboreum [tree cotton]
ref|XP_002266625.1|  PREDICTED: expansin-A6                             417   2e-144   Vitis vinifera
ref|XP_009787901.1|  PREDICTED: expansin-A3-like                        418   2e-144   Nicotiana sylvestris
gb|AAT11859.2|  expansin 1                                              417   2e-144   Mangifera indica
gb|AEN70907.1|  expansin                                                416   2e-144   Gossypium armourianum
gb|AEN70901.1|  expansin                                                416   2e-144   Gossypium barbadense var. brasiliense
gb|EYU18981.1|  hypothetical protein MIMGU_mgv1a012125mg                416   2e-144   Erythranthe guttata [common monkey flower]
ref|XP_009343581.1|  PREDICTED: expansin-A4-like                        416   2e-144   Pyrus x bretschneideri [bai li]
gb|ADY68818.1|  expansin                                                416   2e-144   Gossypium hirsutum [American cotton]
ref|XP_003538409.1|  PREDICTED: expansin-A6                             416   2e-144   Glycine max [soybeans]
ref|XP_004490888.1|  PREDICTED: expansin-A4-like                        416   3e-144   Cicer arietinum [garbanzo]
ref|XP_011077214.1|  PREDICTED: expansin-A6-like                        416   3e-144   Sesamum indicum [beniseed]
ref|XP_006350774.1|  PREDICTED: expansin-A6                             416   4e-144   Solanum tuberosum [potatoes]
ref|XP_006488339.1|  PREDICTED: expansin-A4-like                        416   4e-144   Citrus sinensis [apfelsine]
ref|NP_001288899.1|  expansin-A6 precursor                              416   4e-144   Brassica rapa
ref|XP_011042710.1|  PREDICTED: expansin-A4-like                        416   4e-144   Populus euphratica
gb|AEN70900.1|  expansin                                                416   4e-144   Gossypium tomentosum
ref|XP_009589397.1|  PREDICTED: expansin-A4-like                        416   4e-144   Nicotiana tomentosiformis
gb|KHG29956.1|  Expansin-A4 -like protein                               416   4e-144   Gossypium arboreum [tree cotton]
ref|NP_001233958.1|  expansin precursor                                 416   4e-144   Solanum lycopersicum
ref|XP_010528418.1|  PREDICTED: expansin-A3                             416   4e-144   Tarenaya hassleriana [spider flower]
gb|KCW65541.1|  hypothetical protein EUGRSUZ_G02938                     416   4e-144   Eucalyptus grandis [rose gum]
ref|XP_009364387.1|  PREDICTED: expansin-A4                             416   5e-144   Pyrus x bretschneideri [bai li]
ref|XP_003547326.1|  PREDICTED: expansin-A4-like                        416   5e-144   Glycine max [soybeans]
ref|XP_006424843.1|  hypothetical protein CICLE_v10029094mg             416   6e-144   Citrus clementina [clementine]
gb|AAM47000.1|AF512542_1  alpha-expansin precursor                      416   6e-144   Gossypium hirsutum [American cotton]
gb|AEQ55271.1|  expansin                                                415   6e-144   Breonia chinensis
gb|AEN70895.1|  expansin                                                415   6e-144   Gossypium mustelinum
ref|XP_006435550.1|  hypothetical protein CICLE_v10032484mg             415   7e-144   Citrus clementina [clementine]
gb|AAK48848.1|AF350939_1  expansin                                      415   7e-144   Prunus cerasus [pie cherry]
ref|NP_181300.1|  expansin-A3                                           415   7e-144   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008384848.1|  PREDICTED: expansin-A4                             415   7e-144   Malus domestica [apple tree]
ref|XP_008343537.1|  PREDICTED: expansin-A4-like                        415   8e-144   Malus domestica [apple tree]
ref|XP_010106493.1|  hypothetical protein L484_025251                   415   9e-144   Morus notabilis
ref|XP_008784594.1|  PREDICTED: expansin-A4-like                        415   1e-143   Phoenix dactylifera
ref|XP_009353647.1|  PREDICTED: expansin-A6-like                        415   1e-143   Pyrus x bretschneideri [bai li]
ref|NP_001234761.1|  expansin18 precursor                               415   1e-143   
ref|XP_004143121.1|  PREDICTED: expansin-A4-like                        415   1e-143   Cucumis sativus [cucumbers]
emb|CDY31742.1|  BnaA04g16780D                                          415   1e-143   Brassica napus [oilseed rape]
ref|XP_010067412.1|  PREDICTED: expansin-A4                             416   1e-143   Eucalyptus grandis [rose gum]
ref|XP_010043542.1|  PREDICTED: expansin-A4-like                        415   1e-143   Eucalyptus grandis [rose gum]
emb|CDP06606.1|  unnamed protein product                                414   1e-143   Coffea canephora [robusta coffee]
ref|XP_010111457.1|  hypothetical protein L484_021280                   414   1e-143   Morus notabilis
emb|CDX77222.1|  BnaC04g40170D                                          414   2e-143   
gb|KJB78839.1|  hypothetical protein B456_013G022200                    414   2e-143   Gossypium raimondii
ref|XP_008464122.1|  PREDICTED: expansin-A4                             414   2e-143   Cucumis melo [Oriental melon]
emb|CBI16120.3|  unnamed protein product                                414   2e-143   Vitis vinifera
gb|KEH39447.1|  expansin A10                                            414   3e-143   Medicago truncatula
ref|XP_004492358.1|  PREDICTED: expansin-A6-like                        414   3e-143   Cicer arietinum [garbanzo]
ref|XP_006410954.1|  hypothetical protein EUTSA_v10017095mg             414   3e-143   Eutrema salsugineum [saltwater cress]
ref|XP_008802710.1|  PREDICTED: expansin-A4                             413   4e-143   Phoenix dactylifera
ref|XP_009349313.1|  PREDICTED: expansin-A6-like                        413   5e-143   Pyrus x bretschneideri [bai li]
ref|XP_011027216.1|  PREDICTED: expansin-A4                             413   5e-143   Populus euphratica
ref|XP_002881524.1|  ATEXPA3                                            413   6e-143   Arabidopsis lyrata subsp. lyrata
ref|XP_010690765.1|  PREDICTED: expansin-A4                             413   6e-143   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009772489.1|  PREDICTED: expansin-A3-like                        412   6e-143   Nicotiana sylvestris
ref|XP_011031225.1|  PREDICTED: expansin-A4-like                        412   7e-143   Populus euphratica
ref|XP_010521846.1|  PREDICTED: expansin-A6                             412   7e-143   Tarenaya hassleriana [spider flower]
ref|XP_010517036.1|  PREDICTED: expansin-A3                             412   8e-143   Camelina sativa [gold-of-pleasure]
ref|XP_002312101.1|  alpha-expansin 9 precursor family protein          412   9e-143   Populus trichocarpa [western balsam poplar]
ref|XP_002315218.1|  alpha-expansin 9 precursor family protein          412   1e-142   
ref|XP_010505357.1|  PREDICTED: expansin-A3-like                        412   2e-142   Camelina sativa [gold-of-pleasure]
ref|XP_007150329.1|  hypothetical protein PHAVU_005G144500g             411   2e-142   Phaseolus vulgaris [French bean]
gb|KFK32246.1|  hypothetical protein AALP_AA6G217100                    411   3e-142   Arabis alpina [alpine rockcress]
gb|EYU41729.1|  hypothetical protein MIMGU_mgv1a012073mg                411   3e-142   Erythranthe guttata [common monkey flower]
ref|XP_009409516.1|  PREDICTED: expansin-A6-like                        411   3e-142   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002881024.1|  ATEXPA6                                            410   4e-142   Arabidopsis lyrata subsp. lyrata
ref|XP_009357738.1|  PREDICTED: expansin-A4-like                        411   4e-142   Pyrus x bretschneideri [bai li]
gb|ABO32367.1|  expansin                                                410   4e-142   Litchi
gb|KHG24991.1|  Expansin-A4 -like protein                               410   5e-142   Gossypium arboreum [tree cotton]
gb|AAP48989.1|  expansin                                                410   5e-142   Sambucus nigra
ref|XP_006409928.1|  hypothetical protein EUTSA_v10017116mg             410   7e-142   Eutrema salsugineum [saltwater cress]
emb|CAA04385.1|  Expansin                                               410   7e-142   Brassica napus [oilseed rape]
ref|XP_008357089.1|  PREDICTED: expansin-A6                             410   8e-142   
gb|ABK93541.1|  unknown                                                 410   8e-142   Populus trichocarpa [western balsam poplar]
ref|XP_009380637.1|  PREDICTED: expansin-A4                             410   8e-142   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN17924.1|  Expansin-A3                                             412   9e-142   Glycine soja [wild soybean]
ref|XP_009610453.1|  PREDICTED: expansin-A3-like                        409   1e-141   Nicotiana tomentosiformis
ref|XP_010033123.1|  PREDICTED: expansin-A4                             410   1e-141   Eucalyptus grandis [rose gum]
ref|XP_002309061.1|  expansin family protein                            410   1e-141   Populus trichocarpa [western balsam poplar]
ref|XP_007205748.1|  hypothetical protein PRUPE_ppa010226mg             409   1e-141   Prunus persica
gb|ABO30976.2|  alpha expansin protein 1                                409   2e-141   Calotropis procera
dbj|BAC67194.1|  expansin                                               409   2e-141   Pyrus communis
ref|XP_011019858.1|  PREDICTED: expansin-A6                             409   2e-141   Populus euphratica
ref|XP_008777004.1|  PREDICTED: expansin-A4-like                        409   2e-141   Phoenix dactylifera
ref|XP_006339024.1|  PREDICTED: expansin-A3-like                        409   2e-141   Solanum tuberosum [potatoes]
emb|CAA59470.1|  orf                                                    409   2e-141   Pisum sativum [garden pea]
gb|AAV85475.1|  expansin                                                409   2e-141   Populus tomentosa [Chinese white poplar]
ref|XP_008387765.1|  PREDICTED: expansin-A4-like                        409   2e-141   
gb|KJB08889.1|  hypothetical protein B456_001G111100                    409   2e-141   Gossypium raimondii
ref|NP_001288852.1|  expansin-A3 precursor                              409   3e-141   Brassica rapa
ref|XP_010557251.1|  PREDICTED: expansin-A6-like                        409   3e-141   Tarenaya hassleriana [spider flower]
ref|XP_006480833.1|  PREDICTED: expansin-A4-like                        409   3e-141   Citrus sinensis [apfelsine]
gb|AIE54285.1|  expansin                                                409   3e-141   Nicotiana tabacum [American tobacco]
ref|XP_003552064.1|  PREDICTED: expansin-A4                             409   3e-141   Glycine max [soybeans]
ref|XP_006429095.1|  hypothetical protein CICLE_v10012518mg             409   3e-141   Citrus clementina [clementine]
ref|XP_006846223.1|  hypothetical protein AMTR_s00012p00230920          408   4e-141   Amborella trichopoda
ref|XP_010937609.1|  PREDICTED: expansin-A4                             408   4e-141   Elaeis guineensis
emb|CDY47883.1|  BnaA07g14280D                                          408   5e-141   Brassica napus [oilseed rape]
emb|CDX74942.1|  BnaA05g06880D                                          408   5e-141   
ref|XP_008371813.1|  PREDICTED: expansin-A4-like                        408   5e-141   Malus domestica [apple tree]
ref|XP_004249536.1|  PREDICTED: expansin-A6-like                        408   5e-141   Solanum lycopersicum
ref|XP_006294816.1|  hypothetical protein CARUB_v10023867mg             408   6e-141   Capsella rubella
gb|KFK36651.1|  alpha-expansin 4                                        407   8e-141   Arabis alpina [alpine rockcress]
ref|XP_007132063.1|  hypothetical protein PHAVU_011G063800g             407   1e-140   Phaseolus vulgaris [French bean]
ref|XP_011094866.1|  PREDICTED: expansin-A6                             407   1e-140   Sesamum indicum [beniseed]
gb|EPS67093.1|  hypothetical protein M569_07682                         407   2e-140   Genlisea aurea
ref|XP_010111142.1|  hypothetical protein L484_010756                   407   2e-140   Morus notabilis
ref|XP_004154408.1|  PREDICTED: expansin-A4-like                        407   2e-140   
ref|XP_010534508.1|  PREDICTED: expansin-A4                             406   2e-140   Tarenaya hassleriana [spider flower]
ref|XP_008457477.1|  PREDICTED: expansin-A4-like                        406   3e-140   Cucumis melo [Oriental melon]
ref|XP_008799850.1|  PREDICTED: expansin-A6-like                        406   3e-140   Phoenix dactylifera
ref|XP_009124371.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A6        406   3e-140   Brassica rapa
ref|XP_002463623.1|  hypothetical protein SORBIDRAFT_01g003120          406   4e-140   Sorghum bicolor [broomcorn]
ref|XP_010922313.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A4-...    405   7e-140   
ref|XP_006411198.1|  hypothetical protein EUTSA_v10017119mg             405   8e-140   Eutrema salsugineum [saltwater cress]
gb|KJB46593.1|  hypothetical protein B456_007G376300                    406   8e-140   Gossypium raimondii
gb|KEH22886.1|  expansin-A1-like protein                                405   9e-140   Medicago truncatula
gb|AAF32410.1|AF230277_1  alpha-expansin 2                              405   1e-139   Triphysaria versicolor
emb|CDY07024.1|  BnaA04g22910D                                          404   1e-139   
ref|XP_007133996.1|  hypothetical protein PHAVU_010G010200g             404   1e-139   Phaseolus vulgaris [French bean]
dbj|BAC67193.1|  expansin                                               404   2e-139   Pyrus communis
ref|XP_007163413.1|  hypothetical protein PHAVU_001G232600g             404   2e-139   Phaseolus vulgaris [French bean]
emb|CDY07642.1|  BnaA03g18690D                                          404   3e-139   Brassica napus [oilseed rape]
gb|AAL31477.1|AF319472_1  alpha-expansin 6 precursor                    404   3e-139   Cucumis sativus [cucumbers]
ref|XP_009419260.1|  PREDICTED: expansin-A7-like                        403   4e-139   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY20467.1|  BnaC04g05770D                                          403   5e-139   Brassica napus [oilseed rape]
ref|XP_009341751.1|  PREDICTED: expansin-A4-like                        403   6e-139   Pyrus x bretschneideri [bai li]
ref|XP_010931278.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A7        402   6e-139   Elaeis guineensis
emb|CAH18933.1|  expansin                                               402   7e-139   Pyrus communis
ref|XP_006288496.1|  hypothetical protein CARUB_v10001761mg             402   7e-139   Capsella rubella
ref|XP_010532011.1|  PREDICTED: expansin-A4-like                        402   7e-139   Tarenaya hassleriana [spider flower]
ref|XP_009388613.1|  PREDICTED: expansin-A7                             402   8e-139   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009141827.1|  PREDICTED: expansin-A4-like                        402   9e-139   Brassica rapa
emb|CDY24952.1|  BnaC03g22200D                                          402   1e-138   Brassica napus [oilseed rape]
gb|ACT67493.1|  expansin A1                                             402   1e-138   Raphanus sativus
ref|XP_009143296.1|  PREDICTED: expansin-A4-like                        402   1e-138   Brassica rapa
ref|NP_181500.1|  expansin A4                                           402   1e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881669.1|  ATEXPA4                                            401   2e-138   
ref|XP_004981242.1|  PREDICTED: expansin-A7-like                        401   2e-138   Setaria italica
ref|XP_009381075.1|  PREDICTED: expansin-A7-like                        401   2e-138   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009409019.1|  PREDICTED: expansin-A4-like                        401   3e-138   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAH36862.1|  alpha expansin                                         401   3e-138   Rosa hybrid cultivar
ref|XP_006294843.1|  hypothetical protein CARUB_v10023894mg             401   3e-138   Capsella rubella
dbj|BAE06067.1|  expansin                                               401   3e-138   Sagittaria pygmaea
ref|NP_001288961.1|  expansin-A4 precursor                              400   4e-138   Brassica rapa
emb|CDY69611.1|  BnaCnng64440D                                          400   4e-138   Brassica napus [oilseed rape]
gb|ACA05164.1|  expansin 1                                              400   5e-138   Dimocarpus longan [longan]
ref|XP_008240857.1|  PREDICTED: expansin-A6-like                        400   5e-138   Prunus mume [ume]
ref|XP_002878036.1|  ATEXPA16                                           400   6e-138   Arabidopsis lyrata subsp. lyrata
ref|XP_009398502.1|  PREDICTED: expansin-A7-like                        400   7e-138   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABN09939.1|  expansin A4                                             399   1e-137   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010414459.1|  PREDICTED: expansin-A6-like                        399   1e-137   Camelina sativa [gold-of-pleasure]
ref|XP_010558331.1|  PREDICTED: expansin-A9                             400   1e-137   Tarenaya hassleriana [spider flower]
ref|XP_004505858.1|  PREDICTED: expansin-A6-like                        399   1e-137   Cicer arietinum [garbanzo]
ref|XP_004302749.1|  PREDICTED: expansin-A6                             399   2e-137   Fragaria vesca subsp. vesca
ref|XP_010505648.1|  PREDICTED: expansin-A4                             399   2e-137   Camelina sativa [gold-of-pleasure]
ref|XP_010452058.1|  PREDICTED: expansin-A9-like                        399   2e-137   Camelina sativa [gold-of-pleasure]
ref|XP_010517323.1|  PREDICTED: expansin-A4-like                        399   2e-137   Camelina sativa [gold-of-pleasure]
ref|XP_010423881.1|  PREDICTED: expansin-A9-like                        399   2e-137   Camelina sativa [gold-of-pleasure]
gb|EPS64820.1|  hypothetical protein M569_09956                         399   2e-137   Genlisea aurea
ref|XP_010510558.1|  PREDICTED: expansin-A6                             399   3e-137   Camelina sativa [gold-of-pleasure]
emb|CDY10456.1|  BnaCnng03570D                                          398   3e-137   Brassica napus [oilseed rape]
ref|XP_010508990.1|  PREDICTED: expansin-A4-like                        397   6e-137   Camelina sativa [gold-of-pleasure]
ref|XP_004145295.1|  PREDICTED: expansin-A4-like                        397   6e-137   
ref|NP_180461.1|  expansin A6                                           397   7e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009122794.1|  PREDICTED: expansin-A9                             397   8e-137   Brassica rapa
ref|XP_006294844.1|  hypothetical protein CARUB_v10023895mg             397   8e-137   Capsella rubella
ref|XP_010490643.1|  PREDICTED: expansin-A9                             397   1e-136   Camelina sativa [gold-of-pleasure]
gb|ACF87150.1|  unknown                                                 397   2e-136   Zea mays [maize]
gb|ABN09942.1|  expansin A5                                             395   2e-136   Musa acuminata AAA Group [Cavendish banana]
gb|ABK24904.1|  unknown                                                 396   2e-136   Picea sitchensis
ref|XP_009130690.1|  PREDICTED: expansin-A9-like                        396   2e-136   Brassica rapa
gb|AAQ08016.1|  expansin                                                396   2e-136   Melilotus albus
ref|NP_001051731.1|  Os03g0822000                                       396   3e-136   
ref|XP_010554612.1|  PREDICTED: expansin-A4                             396   3e-136   Tarenaya hassleriana [spider flower]
ref|NP_001150534.1|  alpha-expansin 6 precursor                         396   4e-136   
ref|NP_001288942.1|  expansin-A16 precursor                             395   4e-136   Brassica rapa
ref|XP_011077647.1|  PREDICTED: expansin-A6-like                        395   4e-136   
ref|XP_006398690.1|  hypothetical protein EUTSA_v10014430mg             395   5e-136   Eutrema salsugineum [saltwater cress]
ref|NP_001236550.1|  expansin precursor                                 395   6e-136   
gb|AAM62937.1|  Alpha-expansin 4 precursor (At-EXP4) (AtEx4) (Ath...    395   6e-136   Arabidopsis thaliana [mouse-ear cress]
emb|CDX80810.1|  BnaC03g00640D                                          395   7e-136   
emb|CDY04847.1|  BnaAnng00290D                                          395   7e-136   
gb|KJB08890.1|  hypothetical protein B456_001G111100                    396   8e-136   Gossypium raimondii
ref|NP_001288956.1|  expansin-A9-like precursor                         395   1e-135   Brassica rapa
gb|AAM62987.1|  expansin AtEx6                                          394   1e-135   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191109.1|  expansin A16                                          394   1e-135   Arabidopsis thaliana [mouse-ear cress]
emb|CDY48101.1|  BnaC02g03580D                                          394   1e-135   Brassica napus [oilseed rape]
ref|NP_195846.1|  expansin A9                                           394   1e-135   
gb|AAL31480.1|AF319475_1  alpha-expansin 9 precursor                    394   1e-135   
gb|ABN09940.1|  expansin A5                                             394   2e-135   
ref|XP_010516124.1|  PREDICTED: expansin-A16                            394   2e-135   
ref|XP_002870966.1|  ATEXPA9                                            393   4e-135   
emb|CDY40233.1|  BnaA09g35150D                                          392   6e-135   
ref|XP_003563572.1|  PREDICTED: expansin-A7                             393   7e-135   
ref|XP_010504408.1|  PREDICTED: expansin-A16-like                       392   1e-134   
gb|ABM54492.1|  expansin 2                                              392   1e-134   
gb|EYU26594.1|  hypothetical protein MIMGU_mgv1a012061mg                391   2e-134   
gb|KFK34799.1|  hypothetical protein AALP_AA5G194700                    391   3e-134   
ref|XP_006291698.1|  hypothetical protein CARUB_v10017862mg             390   6e-134   
gb|KFK36856.1|  hypothetical protein AALP_AA4G180600                    390   7e-134   
emb|CDX76090.1|  BnaA04g03540D                                          389   1e-133   
gb|KEH30169.1|  expansin A10                                            389   1e-133   
gb|AFK44569.1|  unknown                                                 389   1e-133   
ref|XP_009139160.1|  PREDICTED: expansin-A16-like                       389   2e-133   
ref|XP_006650810.1|  PREDICTED: expansin-A7-like                        389   2e-133   
ref|XP_010427324.1|  PREDICTED: expansin-A16-like                       389   3e-133   
ref|XP_006403453.1|  hypothetical protein EUTSA_v10010989mg             388   5e-133   
emb|CDY02943.1|  BnaC04g25430D                                          387   8e-133   
gb|ACG46282.1|  alpha-expansin 6 precursor                              387   9e-133   
gb|AAS48878.1|  expansin EXPA9                                          387   1e-132   
gb|KFK24708.1|  hypothetical protein AALP_AA8G014300                    385   3e-132   
emb|CDY41218.1|  BnaC08g26400D                                          385   1e-131   
ref|XP_008458865.1|  PREDICTED: expansin-A4                             384   2e-131   
gb|KHN07218.1|  Expansin-A4                                             380   3e-130   
gb|ACF84785.1|  unknown                                                 380   6e-130   
ref|XP_004171211.1|  PREDICTED: expansin-A16-like                       379   1e-129   
dbj|BAD00017.1|  expansin                                               375   1e-128   
gb|KHN21950.1|  Expansin-A4                                             376   9e-128   
gb|EPS68567.1|  hypothetical protein M569_06200                         373   2e-127   
gb|ADD14631.1|  expansin precursor                                      370   5e-127   
ref|XP_010677870.1|  PREDICTED: expansin-A4-like                        372   7e-127   
gb|KHN30166.1|  Expansin-A4                                             372   2e-126   
gb|ADD14635.1|  expansin precursor                                      369   3e-126   
gb|ABM66430.1|  expansin 3                                              368   2e-125   
ref|NP_001267685.1|  expansin-A16-like                                  367   3e-125   
gb|ADD14630.1|  expansin precursor                                      365   6e-125   
gb|AAR10411.2|  EXP1                                                    365   7e-125   
gb|EYU19913.1|  hypothetical protein MIMGU_mgv1a012177mg                366   2e-124   
gb|KHN32128.1|  Expansin-A4                                             363   3e-124   
gb|KHN33378.1|  Expansin-A4                                             364   7e-124   
gb|AFK40565.1|  unknown                                                 363   1e-123   
gb|AEV43315.1|  expansin A5                                             361   2e-123   
gb|KHF98169.1|  Expansin-A4 -like protein                               360   8e-123   
gb|ADD14636.1|  expansin precursor                                      359   1e-122   
gb|AAL87021.1|  cell wall protein EXP2 precursor                        361   2e-122   
gb|AEQ55268.1|  expansin                                                359   1e-121   
gb|KHN07565.1|  Expansin-A4                                             356   3e-121   
ref|XP_004307494.1|  PREDICTED: expansin-A4-like                        357   4e-121   
ref|XP_010931357.1|  PREDICTED: expansin-A4-like                        357   7e-121   
ref|NP_001276255.1|  expansin-A4-like precursor                         354   2e-120   
gb|AAZ08313.1|  putative alpha-expansin                                 353   3e-120   
ref|XP_009410516.1|  PREDICTED: expansin-A4-like                        354   6e-120   
gb|AAF35900.1|AF230331_1  expansin 1                                    352   8e-120   
ref|XP_002520863.1|  Alpha-expansin 8 precursor, putative               353   1e-119   
ref|XP_006435913.1|  hypothetical protein CICLE_v10032524mg             353   1e-119   
gb|AEQ55270.1|  expansin                                                353   2e-119   
gb|AGU13763.1|  expansin                                                353   2e-119   
ref|XP_010938009.1|  PREDICTED: expansin-A2-like                        353   3e-119   
emb|CDP13911.1|  unnamed protein product                                352   3e-119   
gb|AEQ55284.1|  expansin                                                352   3e-119   
gb|AEQ55269.1|  expansin                                                352   4e-119   
emb|CDP04049.1|  unnamed protein product                                352   7e-119   
gb|AAL87023.1|  cell wall protein Exp4 precursor                        351   7e-119   
ref|XP_008792215.1|  PREDICTED: expansin-A8-like                        350   2e-118   
ref|XP_008354429.1|  PREDICTED: expansin-A4-like                        350   2e-118   
ref|XP_003544930.1|  PREDICTED: expansin-A8                             350   2e-118   
gb|KDO49685.1|  hypothetical protein CISIN_1g025193mg                   350   2e-118   
ref|NP_001275780.1|  expansin 2 precursor                               350   2e-118   
ref|NP_001289251.1|  expansin-A4-like precursor                         350   3e-118   
ref|XP_009384771.1|  PREDICTED: expansin-A2                             350   3e-118   
gb|AEQ55272.1|  expansin                                                350   3e-118   
ref|XP_006429564.1|  hypothetical protein CICLE_v10013804mg             350   4e-118   
ref|XP_010921134.1|  PREDICTED: expansin-A2-like isoform X1             349   5e-118   
ref|XP_009374380.1|  PREDICTED: expansin-A4-like                        349   5e-118   
ref|XP_011019014.1|  PREDICTED: expansin-A8-like                        349   6e-118   
gb|ADC35364.1|  alpha-expansin 1                                        348   1e-117   
ref|XP_010922733.1|  PREDICTED: expansin-A2-like                        348   1e-117   
ref|XP_007205762.1|  hypothetical protein PRUPE_ppa010314mg             348   1e-117   
gb|ADC35366.1|  alpha-expansin 3                                        348   1e-117   
gb|KHG27586.1|  Expansin-A8 -like protein                               348   2e-117   
gb|ABO32366.1|  expansin                                                348   2e-117   
gb|KHN40987.1|  Expansin-A8                                             347   2e-117   
gb|AAR82851.1|  expansin-3                                              348   2e-117   
ref|XP_010103644.1|  hypothetical protein L484_011237                   348   2e-117   
ref|XP_002309181.2|  hypothetical protein POPTR_0006s10850g             348   2e-117   
ref|XP_011089527.1|  PREDICTED: expansin-A4-like                        347   2e-117   
gb|ABB59694.1|  alpha-expansin 2                                        348   2e-117   
ref|XP_003519289.1|  PREDICTED: expansin-A8-like                        348   2e-117   
ref|XP_006654542.1|  PREDICTED: expansin-A4-like                        347   2e-117   
gb|AFK24458.1|  expansin 5                                              347   2e-117   
gb|AAC33529.1|  expansin                                                347   3e-117   
ref|XP_010252076.1|  PREDICTED: expansin-A8-like                        347   3e-117   
gb|AAB81662.1|  expansin                                                347   3e-117   
gb|KJB74926.1|  hypothetical protein B456_012G014400                    347   3e-117   
gb|ADN03964.1|  EXP1                                                    347   3e-117   
ref|XP_003523276.1|  PREDICTED: expansin-A8-like                        347   4e-117   
gb|ACK43222.1|  expansin 2                                              347   4e-117   
ref|XP_008782645.1|  PREDICTED: expansin-A2-like                        347   4e-117   
ref|XP_003529476.1|  PREDICTED: expansin-A15-like                       347   5e-117   
gb|AHL25254.1|  expansin                                                347   5e-117   
ref|XP_004294733.1|  PREDICTED: expansin-A4-like                        347   5e-117   
ref|NP_001055842.1|  Os05g0477600                                       347   5e-117   
ref|NP_001281040.1|  expansin-A4-like precursor                         347   6e-117   
ref|XP_010031088.1|  PREDICTED: expansin-A8-like                        346   6e-117   
gb|AAG13982.1|AF297521_1  expansin 1                                    347   7e-117   
ref|XP_007142047.1|  hypothetical protein PHAVU_008G248000g             346   7e-117   
gb|AGR44459.1|  expansin 7                                              345   7e-117   
ref|XP_009399910.1|  PREDICTED: expansin-A2-like                        346   8e-117   
ref|XP_003568245.1|  PREDICTED: expansin-A4                             346   9e-117   
ref|XP_010257816.1|  PREDICTED: expansin-A1                             346   1e-116   
gb|ACX69842.1|  expansin                                                346   1e-116   
gb|ACJ70084.1|  expansin                                                346   1e-116   
ref|XP_002456550.1|  hypothetical protein SORBIDRAFT_03g038290          346   1e-116   
ref|XP_010917068.1|  PREDICTED: expansin-A10-like                       346   1e-116   
gb|AJR32958.1|  expansin                                                345   1e-116   
ref|XP_010108480.1|  hypothetical protein L484_010673                   346   1e-116   
ref|XP_010253098.1|  PREDICTED: expansin-A8-like                        345   2e-116   
ref|NP_001265970.1|  expansin-A8-like precursor                         345   2e-116   
emb|CBI15823.3|  unnamed protein product                                344   2e-116   
ref|XP_008242138.1|  PREDICTED: expansin-A8-like                        345   3e-116   
gb|KDP22771.1|  hypothetical protein JCGZ_00358                         344   3e-116   
ref|NP_001240113.1|  expansin precursor                                 345   3e-116   
gb|ABM66452.1|  expansin                                                344   4e-116   
gb|ACA05166.1|  expansin 3                                              344   4e-116   
ref|NP_001105040.1|  alpha expansin1 precursor                          344   5e-116   
ref|XP_002276565.3|  PREDICTED: expansin-A4                             344   5e-116   
gb|AEL88239.1|  expansin                                                343   5e-116   
gb|ACK43884.1|  expansin                                                344   5e-116   
gb|ACK87022.1|  expansin                                                344   6e-116   
dbj|BAJ10397.1|  alpha-expansin                                         344   6e-116   
ref|XP_002323665.1|  expansin S1 precursor family protein               344   6e-116   
dbj|BAH36861.1|  alpha expansin                                         344   6e-116   
ref|XP_004961745.1|  PREDICTED: expansin-A4-like                        344   6e-116   
gb|AEN70881.1|  alpha-expansin 1                                        344   7e-116   
gb|AFK24457.1|  expansin 4                                              344   7e-116   
gb|AEE69072.1|  expansin-5                                              344   8e-116   
ref|XP_010258311.1|  PREDICTED: expansin-A1 isoform X2                  343   9e-116   
ref|XP_010258310.1|  PREDICTED: expansin-A1 isoform X1                  343   9e-116   
gb|ACM90161.1|  expansin 3                                              343   1e-115   
gb|ACD37706.1|  alpha expansin                                          343   1e-115   
gb|EYU46016.1|  hypothetical protein MIMGU_mgv1a012336mg                343   1e-115   
gb|ACI02326.1|  expansion-related protein                               343   1e-115   
ref|XP_009622932.1|  PREDICTED: expansin-A8-like                        343   2e-115   
dbj|BAJ10398.1|  alpha-expansin                                         343   2e-115   
gb|KDP21654.1|  hypothetical protein JCGZ_03325                         343   2e-115   
gb|ADY68810.1|  alpha-expansin 1                                        343   2e-115   
ref|XP_003613849.1|  Expansin                                           342   2e-115   
gb|ABD48785.1|  alpha-expansin 1                                        343   2e-115   
gb|AAF35901.1|AF230332_1  expansin 2                                    342   2e-115   
ref|XP_002325925.2|  alpha-expansin 8 precursor family protein          342   2e-115   
ref|XP_009404081.1|  PREDICTED: expansin-A15                            342   3e-115   
gb|ABF48653.1|  expansin precursor                                      342   3e-115   
ref|XP_010678491.1|  PREDICTED: expansin-A10-like                       342   3e-115   
ref|XP_010525408.1|  PREDICTED: expansin-A8                             342   3e-115   
ref|XP_011013147.1|  PREDICTED: expansin-A1                             342   3e-115   
ref|XP_004970396.1|  PREDICTED: expansin-A2-like                        342   3e-115   
ref|XP_002532867.1|  Alpha-expansin 8 precursor, putative               342   3e-115   
gb|EMT32065.1|  hypothetical protein F775_28771                         340   3e-115   
ref|XP_003518007.1|  PREDICTED: expansin-A1-like                        342   3e-115   
ref|XP_007158645.1|  hypothetical protein PHAVU_002G170300g             344   3e-115   
gb|ABC55453.1|  expansin protein                                        342   3e-115   
gb|AEN70883.1|  alpha-expansin 1                                        342   4e-115   
gb|AEN70871.1|  alpha-expansin 1                                        342   4e-115   
gb|KJB73009.1|  hypothetical protein B456_011G209100                    342   4e-115   
ref|XP_002523388.1|  Alpha-expansin 1 precursor, putative               342   4e-115   
ref|XP_011080662.1|  PREDICTED: expansin-A4-like                        342   4e-115   
gb|AFZ78603.1|  expansin protein                                        342   4e-115   
gb|AEN70869.1|  alpha-expansin 1                                        342   4e-115   
gb|KEH35551.1|  expansin A10                                            342   4e-115   
gb|KHG29916.1|  Expansin-A8 -like protein                               342   5e-115   
gb|AAY43797.1|  expansin                                                342   5e-115   
gb|AEN70875.1|  alpha-expansin 1                                        342   5e-115   
ref|XP_010044491.1|  PREDICTED: expansin-A1-like                        342   5e-115   
gb|KHG02505.1|  Expansin-A2                                             342   6e-115   
gb|AEN70887.1|  alpha-expansin 1                                        342   6e-115   
gb|ACK36942.1|  expansin                                                341   6e-115   
gb|AEN70867.1|  alpha-expansin 1                                        342   6e-115   
ref|NP_001267550.1|  expansin-A8-like precursor                         341   7e-115   
ref|XP_010043148.1|  PREDICTED: expansin-A4-like                        342   7e-115   
ref|XP_008808309.1|  PREDICTED: expansin-A2-like                        342   7e-115   
gb|ACK43886.1|  expansin                                                341   7e-115   
gb|AEN70868.1|  alpha-expansin 1                                        342   7e-115   
ref|XP_002441263.1|  hypothetical protein SORBIDRAFT_09g023440          341   8e-115   
gb|AHL25252.1|  expansin                                                341   8e-115   
gb|AFK34543.1|  unknown                                                 341   8e-115   
ref|XP_007209512.1|  hypothetical protein PRUPE_ppa010443mg             341   8e-115   
gb|ABL86681.1|  EX4                                                     341   9e-115   
gb|KEH35550.1|  expansin A10                                            341   1e-114   
gb|AEN70885.1|  alpha-expansin 1                                        341   1e-114   
ref|XP_004246275.1|  PREDICTED: expansin-A10-like                       341   1e-114   
ref|XP_011076589.1|  PREDICTED: expansin-A4-like                        341   1e-114   
ref|XP_010670609.1|  PREDICTED: expansin-A4                             341   1e-114   
dbj|BAN09211.1|  alpha expansin                                         340   1e-114   
ref|XP_002522457.1|  Alpha-expansin 1 precursor, putative               340   1e-114   
gb|AAM46997.1|AF512539_1  alpha-expansin precursor                      341   1e-114   
ref|NP_001240136.1|  expansin-A1-like precursor                         340   1e-114   
gb|KHG01029.1|  Expansin-A15 -like protein                              340   2e-114   
gb|KJB60202.1|  hypothetical protein B456_009G293500                    340   2e-114   
ref|XP_009607404.1|  PREDICTED: expansin-A10-like                       341   2e-114   
ref|NP_001044656.1|  Os01g0823100                                       340   2e-114   
ref|XP_010108685.1|  hypothetical protein L484_015671                   340   2e-114   
gb|ADY68811.1|  alpha-expansin 1                                        340   2e-114   
ref|XP_008798561.1|  PREDICTED: expansin-A8-like                        340   2e-114   
gb|AEQ55281.1|  expansin                                                340   2e-114   
ref|XP_003607738.1|  Expansin                                           341   2e-114   
ref|XP_010921302.1|  PREDICTED: expansin-A10-like                       340   2e-114   
dbj|BAJ99188.1|  predicted protein                                      340   2e-114   
ref|XP_002280300.1|  PREDICTED: expansin-A8                             340   2e-114   
gb|AEN70870.1|  alpha-expansin 1                                        340   3e-114   
gb|AFK38068.1|  unknown                                                 340   3e-114   
dbj|BAC66696.1|  expansin                                               340   3e-114   
gb|KDP41217.1|  hypothetical protein JCGZ_15624                         340   3e-114   
ref|XP_010066900.1|  PREDICTED: expansin-A1                             340   3e-114   
gb|AAC39512.1|  expansin                                                340   3e-114   
ref|XP_008239926.1|  PREDICTED: expansin-A1-like                        339   3e-114   
gb|ABR17119.1|  unknown                                                 340   3e-114   
gb|EYU20096.1|  hypothetical protein MIMGU_mgv1a012489mg                339   4e-114   
gb|KJB30413.1|  hypothetical protein B456_005G142200                    339   4e-114   



>dbj|BAO57279.1| alpha-expansin [Ipomoea nil]
Length=257

 Score =   494 bits (1273),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 241/241 (100%), Positives = 241/241 (100%), Gaps = 0/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN
Sbjct  17   TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  76

Query  543  NGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            NGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP
Sbjct  77   NGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  136

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS
Sbjct  137  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  196

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR
Sbjct  197  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  256

Query  3    A  1
            A
Sbjct  257  A  257



>ref|NP_001234081.1| expansin A4 precursor [Solanum lycopersicum]
 gb|AAD13632.1| expansin precursor [Solanum lycopersicum]
Length=263

 Score =   429 bits (1103),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 203/242 (84%), Positives = 224/242 (93%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            TAV+ARIPGVY+GG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALST LFN
Sbjct  22   TAVNARIPGVYTGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTVLFN  81

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFE+KC ND + C PGNPSIFVTATNFCPPNFALPND+GGWCNPPRPHFDLAM
Sbjct  82   NGLSCGACFELKCDNDGKWCLPGNPSIFVTATNFCPPNFALPNDDGGWCNPPRPHFDLAM  141

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKI  YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNL+LVTNVAGAGDIQKVL+KG
Sbjct  142  PMFLKIGLYRAGIVPVTYRRVPCRKQGGIRFTINGFRYFNLLLVTNVAGAGDIQKVLIKG  201

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            + T WI +SRNWGQNW+T++ LVGQ+LS RV+ASD R VT+ NVAP+NWQFGQTF+GKNF
Sbjct  202  TNTQWIAMSRNWGQNWQTNSPLVGQALSIRVKASDHRSVTNVNVAPSNWQFGQTFEGKNF  261

Query  6    RA  1
            R 
Sbjct  262  RV  263



>ref|XP_009761115.1| PREDICTED: expansin-A6-like [Nicotiana sylvestris]
Length=260

 Score =   429 bits (1103),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 204/240 (85%), Positives = 223/240 (93%), Gaps = 1/240 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V ARIPGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG
Sbjct  21   VEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  80

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFEIKC N  + C  G+PSI +TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPM
Sbjct  81   LSCGACFEIKCDNQPQWCHAGSPSILITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPM  140

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI K++VKGSR
Sbjct  141  FLKIAEYRAGIVPVVYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKLMVKGSR  200

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            T WIT+SRNWGQNW+T++ LVGQ+LSFRV ASDRR+ TSWN+APA+WQFGQTF GKNFR 
Sbjct  201  TGWITMSRNWGQNWQTNSVLVGQALSFRVTASDRRKSTSWNIAPAHWQFGQTFVGKNFRV  260



>gb|AAR82849.1| expansin-1 [Petunia x hybrida]
Length=260

 Score =   429 bits (1102),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 205/239 (86%), Positives = 220/239 (92%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V ARIPGVYSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNN ALSTALFNNG
Sbjct  21   VEARIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNGALSTALFNNG  80

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFEIKC  D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPM
Sbjct  81   LSCGACFEIKCDKDPQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPM  140

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI +V VKGS+
Sbjct  141  FLKIAEYRAGIVPVVYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVRVRVKGSK  200

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            T WITLSRNWGQNW+T+A L GQSLSFRV ASDRR  TSWN+APA+WQFGQTF GKNFR
Sbjct  201  TNWITLSRNWGQNWQTNAVLTGQSLSFRVTASDRRSSTSWNIAPAHWQFGQTFMGKNFR  259



>gb|KDP35637.1| hypothetical protein JCGZ_09075 [Jatropha curcas]
Length=258

 Score =   428 bits (1101),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 201/241 (83%), Positives = 226/241 (94%), Gaps = 1/241 (0%)
 Frame = -3

Query  720  AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  541
             V+ARIPGVY+GG+W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNN
Sbjct  18   VVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNN  77

Query  540  GLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            GLSCGACFEIKC++D + C+PG+PSIF+TATNFCPPNFALP+DNGGWCNPPRPHFDLAMP
Sbjct  78   GLSCGACFEIKCADDPKWCNPGSPSIFITATNFCPPNFALPSDNGGWCNPPRPHFDLAMP  137

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLKIA YRAGIVPVNFRRIPCRKQGGIRFT+NGFRYFNLVLV+NVAGAGDI KV +KGS
Sbjct  138  MFLKIAEYRAGIVPVNFRRIPCRKQGGIRFTINGFRYFNLVLVSNVAGAGDIVKVSIKGS  197

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            +T W+++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWN+APANWQFGQTF GKNFR
Sbjct  198  KTDWLSMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNIAPANWQFGQTFTGKNFR  257

Query  3    A  1
             
Sbjct  258  V  258



>ref|XP_006341021.1| PREDICTED: expansin-A3 [Solanum tuberosum]
Length=263

 Score =   428 bits (1101),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 202/242 (83%), Positives = 224/242 (93%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            TAV+ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALST LFN
Sbjct  22   TAVNARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTVLFN  81

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFE+KC ND + C PGNPSIFVTATNFCPPNFALPND+GGWCNPPRPHFDLAM
Sbjct  82   NGLSCGACFELKCDNDGKWCLPGNPSIFVTATNFCPPNFALPNDDGGWCNPPRPHFDLAM  141

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKI  YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNL+LVTNVAGAGDIQKVL+KG
Sbjct  142  PMFLKIGLYRAGIVPVTYRRVPCRKQGGIRFTINGFRYFNLLLVTNVAGAGDIQKVLIKG  201

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            + T WI +SRNWGQNW+T++ LVGQ+LS RV+ASD R VT+ NVAP+NWQFGQTF+GKNF
Sbjct  202  TNTQWIAMSRNWGQNWQTNSPLVGQALSIRVKASDHRSVTNVNVAPSNWQFGQTFEGKNF  261

Query  6    RA  1
            R 
Sbjct  262  RV  263



>ref|XP_003519349.1| PREDICTED: expansin-A4-like [Glycine max]
Length=257

 Score =   427 bits (1098),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 201/241 (83%), Positives = 222/241 (92%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T+  ARIPG YSGGAW+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  16   TSTEARIPGAYSGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  75

Query  543  NGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFEIKC+ND S C  G+PSIFVTATNFCPPN+ALPNDNGGWCNPPRPHFDLAM
Sbjct  76   NGLSCGACFEIKCANDPSWCHAGSPSIFVTATNFCPPNYALPNDNGGWCNPPRPHFDLAM  135

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV++RR+PCRKQGG+RFT+NGFRYFNLVL+TNVAGAGDI K  VKG
Sbjct  136  PMFLKIAQYRAGIVPVSYRRVPCRKQGGMRFTINGFRYFNLVLITNVAGAGDIVKTSVKG  195

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W+++SRNWGQNW+++A LVGQSLSFRV ASDRR  TSWN+ PANWQFGQTF GKNF
Sbjct  196  SKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTSWNLVPANWQFGQTFTGKNF  255

Query  6    R  4
            +
Sbjct  256  K  256



>ref|XP_009613959.1| PREDICTED: expansin-A6-like [Nicotiana tomentosiformis]
Length=260

 Score =   427 bits (1098),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 202/240 (84%), Positives = 223/240 (93%), Gaps = 1/240 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V ARIPGVY+GG+WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG
Sbjct  21   VEARIPGVYTGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  80

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFEIKC N  + C  G+PSI +TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPM
Sbjct  81   LSCGACFEIKCDNQPQWCHAGSPSILITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPM  140

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI K++VKGSR
Sbjct  141  FLKIAEYRAGIVPVVYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDILKLMVKGSR  200

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            + WIT+SRNWGQNW+T++ LVGQ+LSFRV ASDRR+ TSWN+APA+WQFGQTF GKNFR 
Sbjct  201  SGWITMSRNWGQNWQTNSVLVGQALSFRVTASDRRKSTSWNIAPAHWQFGQTFVGKNFRV  260



>gb|KJB16930.1| hypothetical protein B456_002G257400 [Gossypium raimondii]
Length=264

 Score =   427 bits (1097),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 199/239 (83%), Positives = 222/239 (93%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V+ARIPGVY+GG+W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  25   VNARIPGVYTGGSWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  84

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFEIKC+ND R C PG+PSIF+TATNFCPPNFALP+DNGGWCNPPRPHFDLAMPM
Sbjct  85   LSCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNFALPSDNGGWCNPPRPHFDLAMPM  144

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI KV +KG+ 
Sbjct  145  FLKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKVSIKGTN  204

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            T W ++SRNWGQNW+++  LVGQ+LSFRV+ SD+R  TSWNVAP NWQFGQTF GKNFR
Sbjct  205  TGWTSMSRNWGQNWQSNVILVGQALSFRVKGSDKRTSTSWNVAPTNWQFGQTFTGKNFR  263



>ref|XP_004249634.1| PREDICTED: expansin-A3 [Solanum lycopersicum]
Length=259

 Score =   426 bits (1096),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 202/242 (83%), Positives = 223/242 (92%), Gaps = 2/242 (1%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T V+A+I GVY+GG W +AHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN
Sbjct  17   TVVNAKIAGVYTGGPWTSAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  76

Query  543  NGLSCGACFEIKCSNDRS--CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLA  370
            NGLSCGACFEIKC++ +   C+PGNPSI VT TNFCPPN+ALPNDNGGWCNPPRPHFDLA
Sbjct  77   NGLSCGACFEIKCTDSKKEYCNPGNPSILVTGTNFCPPNYALPNDNGGWCNPPRPHFDLA  136

Query  369  MPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVK  190
            MPMFLKIA YRAGIV VN+RR+PCRKQGGIRFTVNGF+YFNLVLVTNVAGAGDIQKV VK
Sbjct  137  MPMFLKIAVYRAGIVAVNYRRVPCRKQGGIRFTVNGFQYFNLVLVTNVAGAGDIQKVYVK  196

Query  189  GSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKN  10
            G+ TPWI+++RNWGQNW+T+A LVGQ+LSFRV ASDRR   S+N+APANWQFGQTFQGKN
Sbjct  197  GTNTPWISMTRNWGQNWQTNAKLVGQALSFRVTASDRRSSASYNIAPANWQFGQTFQGKN  256

Query  9    FR  4
            FR
Sbjct  257  FR  258



>gb|ACJ48968.2| expansin [Breonia chinensis]
 gb|ACT10284.2| expansin [Breonia chinensis]
Length=258

 Score =   426 bits (1095),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 200/241 (83%), Positives = 221/241 (92%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T   ARIPGVYSGG+WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  17   TLAEARIPGVYSGGSWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  76

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFE+KC++D + C PG+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHFDLAM
Sbjct  77   NGLSCGACFELKCADDPQWCHPGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLAM  136

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV++RR+PCRKQGGIRF +NGFRYFNLVL+TNVAGAGDI +  VKG
Sbjct  137  PMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFQINGFRYFNLVLITNVAGAGDIVQAWVKG  196

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            SRT WI+LSRNWGQNW+T++ L GQSLSFRVRASDRR  TSWN+ P+NWQFGQTF GKNF
Sbjct  197  SRTGWISLSRNWGQNWQTNSVLAGQSLSFRVRASDRRSSTSWNIVPSNWQFGQTFTGKNF  256

Query  6    R  4
            R
Sbjct  257  R  257



>gb|AEQ55274.1| expansin [Breonia chinensis]
 gb|AEQ55289.1| expansin [Breonia chinensis]
Length=256

 Score =   426 bits (1094),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 200/239 (84%), Positives = 221/239 (92%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY+GG+WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN  ALSTALFN+GL
Sbjct  18   EARIPGVYTGGSWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTGALSTALFNSGL  77

Query  534  SCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFE+KC+ND   C PG+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPMF
Sbjct  78   SCGACFELKCANDPGWCHPGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMF  137

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPVN+RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI +V VKGSRT
Sbjct  138  LKIAEYRAGIVPVNYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVRVFVKGSRT  197

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             WI++SRNWGQNW+T++ LVGQSLSFRV ASDRR  TSWN+ PA+WQFGQTF GKNFR 
Sbjct  198  GWISMSRNWGQNWQTNSVLVGQSLSFRVTASDRRSSTSWNMVPAHWQFGQTFVGKNFRV  256



>ref|XP_003544219.1| PREDICTED: expansin-A6-like [Glycine max]
Length=260

 Score =   426 bits (1094),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 221/240 (92%), Gaps = 1/240 (0%)
 Frame = -3

Query  720  AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  541
            +  AR+PGVYSGGAW+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNN
Sbjct  20   STEARVPGVYSGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNN  79

Query  540  GLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            GLSCGACFEIKC+ND S C  G+PSIFVTATNFCPPN+ALPNDNGGWCNPPRPHFDLAMP
Sbjct  80   GLSCGACFEIKCANDPSWCHAGSPSIFVTATNFCPPNYALPNDNGGWCNPPRPHFDLAMP  139

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLKIA YRAGIVPV++RR+PCRKQGG+RFT+NGFRYFNLVL+TNVAGAGDI +  VKGS
Sbjct  140  MFLKIAQYRAGIVPVSYRRVPCRKQGGMRFTINGFRYFNLVLITNVAGAGDIVRTSVKGS  199

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            +T W+++SRNWGQNW+++A LVGQSLSFRV ASDRR  TSWN+ PANWQFGQTF  KNFR
Sbjct  200  KTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTSWNIVPANWQFGQTFTAKNFR  259



>gb|KJB76740.1| hypothetical protein B456_012G104400 [Gossypium raimondii]
Length=264

 Score =   426 bits (1094),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 223/240 (93%), Gaps = 1/240 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V+ARIPGVY+GG+W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  25   VNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  84

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFEIKC++D R C PGNPSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPM
Sbjct  85   LSCGACFEIKCTDDPRWCHPGNPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPM  144

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLK+A YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI KV VKG+ 
Sbjct  145  FLKMAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKVSVKGTN  204

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            T W+++SRNWGQNW+++A LVGQ LSFRV  SDRR  TSWN+APANWQFGQTF GKNFR 
Sbjct  205  TGWLSMSRNWGQNWQSNAVLVGQQLSFRVTGSDRRTSTSWNMAPANWQFGQTFTGKNFRV  264



>gb|KHG30766.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=262

 Score =   426 bits (1094),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 200/241 (83%), Positives = 226/241 (94%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T+V+ARIPGV+S G+W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  21   TSVNARIPGVFSTGSWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  80

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFEIKC++D R C PG+PSIFVTATNFCPPNFALP+DNGGWCNPPRPHFDLAM
Sbjct  81   NGLSCGACFEIKCASDPRWCHPGSPSIFVTATNFCPPNFALPSDNGGWCNPPRPHFDLAM  140

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV+FRR+PCRKQGGIRFTVNGFRYFNLVL+TNVAGAGDI KV +KG
Sbjct  141  PMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTVNGFRYFNLVLITNVAGAGDIVKVSIKG  200

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            ++T W+++SRNWGQNW+++A L+GQ+LSFRV  SD+R  TSWNVAP+NWQFGQTF GKNF
Sbjct  201  TKTGWMSMSRNWGQNWQSNAVLIGQALSFRVTGSDKRTSTSWNVAPSNWQFGQTFTGKNF  260

Query  6    R  4
            R
Sbjct  261  R  261



>ref|XP_009788740.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=259

 Score =   425 bits (1093),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 202/242 (83%), Positives = 221/242 (91%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            TAV+A+IPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALST LFN
Sbjct  18   TAVNAKIPGVYTGGPWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTVLFN  77

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFEIKC +D + C PGNPSIFVTATNFCPPNFALPND+GGWCNPPRPHFDLAM
Sbjct  78   NGLSCGACFEIKCVDDGKWCLPGNPSIFVTATNFCPPNFALPNDDGGWCNPPRPHFDLAM  137

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKI  YRAGIVPV +RR+PCRK GGIRFT+NGFRYFNL+LVTNVAGAGDIQKVL+KG
Sbjct  138  PMFLKIGQYRAGIVPVTYRRVPCRKAGGIRFTINGFRYFNLLLVTNVAGAGDIQKVLIKG  197

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            + T WI +SRNWGQNW+T+A LVGQ+LS RV+ASD R VTS NVAP NWQFGQTF+GKNF
Sbjct  198  TNTQWIAMSRNWGQNWQTNAVLVGQALSIRVKASDHRSVTSTNVAPPNWQFGQTFEGKNF  257

Query  6    RA  1
            R 
Sbjct  258  RV  259



>gb|AEQ55290.1| expansin [Breonia chinensis]
Length=259

 Score =   425 bits (1092),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 201/238 (84%), Positives = 220/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN+GL
Sbjct  21   EARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNSGL  80

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
             CGACFEIKC+N+ + C PG+PSIFVTATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPMF
Sbjct  81   RCGACFEIKCANEPQWCHPGSPSIFVTATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV +RR+PCRKQGG RFT+NGFRYFNLVLVTNVAGAGDI +V VKGSRT
Sbjct  141  LKIAEYRAGIVPVTYRRVPCRKQGGTRFTINGFRYFNLVLVTNVAGAGDIVRVFVKGSRT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             WI+LSRNWGQNW+T++ LVGQSLSFRV ASDRR  TSWN+ PA+WQFGQTF GKNFR
Sbjct  201  GWISLSRNWGQNWQTNSVLVGQSLSFRVTASDRRSSTSWNIVPAHWQFGQTFVGKNFR  258



>ref|XP_004142066.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN54256.1| hypothetical protein Csa_4G296100 [Cucumis sativus]
Length=259

 Score =   424 bits (1091),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 202/238 (85%), Positives = 220/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
            HARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   HARIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC+ND R C PG+PSIF+TATNFCPPNFALPNDNGGWCNPPR HFDLAMPMF
Sbjct  81   SCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNFALPNDNGGWCNPPRTHFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI KV VKGS T
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKVSVKGSNT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A LVGQ+LSFR+  SDRR  TSWNVAP+NWQFGQTF GKNFR
Sbjct  201  GWMSMSRNWGQNWQSNAVLVGQTLSFRLTGSDRRTSTSWNVAPSNWQFGQTFTGKNFR  258



>ref|XP_007027012.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY07514.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=263

 Score =   425 bits (1092),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 200/239 (84%), Positives = 223/239 (93%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V+ARIPGVY+GG+W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  24   VNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  83

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFEIKC+ND R C PG+PSIFVTATNFCPPN+ALP+DNGGWCNPPR HFDLAMPM
Sbjct  84   LSCGACFEIKCANDPRWCHPGSPSIFVTATNFCPPNYALPSDNGGWCNPPRSHFDLAMPM  143

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI KV VKG++
Sbjct  144  FLKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKVSVKGTK  203

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            T W+++SRNWGQNW+++A LVGQ+LSFRV  SD+R  TSWNVA ANWQFGQTF GKNFR
Sbjct  204  TGWLSMSRNWGQNWQSNAVLVGQALSFRVTGSDKRTSTSWNVASANWQFGQTFTGKNFR  262



>gb|AEQ55275.1| expansin [Breonia chinensis]
Length=259

 Score =   424 bits (1091),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 201/238 (84%), Positives = 220/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN+GL
Sbjct  21   EARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNSGL  80

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
             CGACFEIKC+N+ + C PG+PSIFVTATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPMF
Sbjct  81   RCGACFEIKCANEPQWCHPGSPSIFVTATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV +RR+PCRKQGG RFT+NGFRYFNLVLVTNVAGAGDI +V VKGSRT
Sbjct  141  LKIAEYRAGIVPVTYRRVPCRKQGGTRFTINGFRYFNLVLVTNVAGAGDIVRVFVKGSRT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             WI+LSRNWGQNW+T++ LVGQSLSFRV ASDRR  TSWN+ PA+WQFGQTF GKNFR
Sbjct  201  GWISLSRNWGQNWQTNSVLVGQSLSFRVTASDRRSSTSWNIVPAHWQFGQTFVGKNFR  258



>ref|XP_004147685.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004161909.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN50556.1| hypothetical protein Csa_5G182120 [Cucumis sativus]
Length=259

 Score =   424 bits (1091),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 222/239 (93%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            VHARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  20   VHARIPGVYSGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  79

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFE+KC+ND + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPM
Sbjct  80   LSCGACFELKCANDPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPM  139

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNL+L+TNVAGAGDI K  VKGS+
Sbjct  140  FLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLILITNVAGAGDIVKASVKGSK  199

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            T W+++SRNWGQNW+++A LVGQSLSFRV +SDRR  TSWN+ P+NWQFGQTF GKNFR
Sbjct  200  TEWMSMSRNWGQNWQSNAILVGQSLSFRVTSSDRRTSTSWNIVPSNWQFGQTFTGKNFR  258



>ref|NP_001234881.1| expansin9 precursor [Solanum lycopersicum]
 emb|CAB46492.1| expansin9 [Solanum lycopersicum]
Length=257

 Score =   424 bits (1090),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 200/242 (83%), Positives = 220/242 (91%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
              V  RIPGVYSGG+WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALSTALFN
Sbjct  16   VGVEGRIPGVYSGGSWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFN  75

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFEIKC N  + C PG+PSI +TATNFCPPN+ALPNDNGGWCNPPR HFDLAM
Sbjct  76   NGLSCGACFEIKCDNQPQWCHPGSPSILITATNFCPPNYALPNDNGGWCNPPRTHFDLAM  135

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV +RR+PCRKQGGIRFT+NGF YFNL+LVTNVAGAGDI KV+VKG
Sbjct  136  PMFLKIAEYRAGIVPVVYRRVPCRKQGGIRFTINGFSYFNLILVTNVAGAGDITKVMVKG  195

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            +RT WITLSRNWGQNW+T++ LVGQSLSFRV ASD+R+ TSWN+AP++WQFGQTF GKNF
Sbjct  196  TRTNWITLSRNWGQNWQTNSVLVGQSLSFRVTASDKRKSTSWNIAPSHWQFGQTFVGKNF  255

Query  6    RA  1
            R 
Sbjct  256  RV  257



>ref|NP_001284471.1| expansin-A4 precursor [Cucumis melo]
 gb|ABI94060.1| ripening-related expansin [Cucumis melo]
Length=259

 Score =   424 bits (1090),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 202/239 (85%), Positives = 220/239 (92%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
            HARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   HARIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC+ND R C PG+PSIF+TATNFCPPNFALPNDNGGWCNPPR HFDLAMPMF
Sbjct  81   SCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNFALPNDNGGWCNPPRTHFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI +V VKGS T
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVRVSVKGSNT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWNVAP+NWQFGQTF GKNFR 
Sbjct  201  GWMSMSRNWGQNWQSNAVLVGQTLSFRVTGSDRRTSTSWNVAPSNWQFGQTFTGKNFRV  259



>ref|XP_009597793.1| PREDICTED: expansin-A6-like [Nicotiana tomentosiformis]
Length=260

 Score =   424 bits (1089),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 201/242 (83%), Positives = 221/242 (91%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
             AV +RIPGVYSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNN ALSTALFN
Sbjct  19   VAVESRIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNGALSTALFN  78

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFEIKC  D + C  G+PSIF+TATNFCPPNFALPNDNGGWCNPPR HFDLAM
Sbjct  79   NGLSCGACFEIKCDKDPQWCHSGSPSIFITATNFCPPNFALPNDNGGWCNPPRSHFDLAM  138

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVLVTNVAGAGDI +V VKG
Sbjct  139  PMFLKIAEYRAGIVPVVYRRVPCRKKGGIRFTINGFRYFNLVLVTNVAGAGDIVRVYVKG  198

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T WIT+SRNWGQN++T++ L+GQSLSFRV ASDRR  TSWN+APA+WQFGQTF GKNF
Sbjct  199  SKTNWITMSRNWGQNYQTNSVLIGQSLSFRVTASDRRSSTSWNIAPAHWQFGQTFSGKNF  258

Query  6    RA  1
            R 
Sbjct  259  RV  260



>ref|XP_007009225.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY18035.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=259

 Score =   423 bits (1088),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 200/241 (83%), Positives = 220/241 (91%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
             AV ARIPGVYSG  WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  18   VAVEARIPGVYSGAEWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  77

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFEIKC+N+ + C  G+PSIFVTATNFCPPN+ALP+DNGGWCNPPRPHFDLAM
Sbjct  78   NGLSCGACFEIKCANEPQWCHAGSPSIFVTATNFCPPNYALPSDNGGWCNPPRPHFDLAM  137

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI K  VKG
Sbjct  138  PMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKASVKG  197

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+NWQFGQTF GKNF
Sbjct  198  SKTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQTFTGKNF  257

Query  6    R  4
            R
Sbjct  258  R  258



>ref|XP_002533097.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
 gb|EEF29289.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
Length=259

 Score =   423 bits (1088),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 199/241 (83%), Positives = 220/241 (91%), Gaps = 1/241 (0%)
 Frame = -3

Query  720  AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  541
            A  ARIPGVY+GG+WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNN
Sbjct  19   ASEARIPGVYTGGSWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNN  78

Query  540  GLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            GLSCGACFEIKC+ND + C  G+PSI +TATNFCPPNFALPNDNGGWCNPPRPHFDLAMP
Sbjct  79   GLSCGACFEIKCANDPKWCHSGSPSILITATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  138

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI KV VKGS
Sbjct  139  MFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKVSVKGS  198

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            RT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PANWQFGQTF GKNFR
Sbjct  199  RTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPANWQFGQTFTGKNFR  258

Query  3    A  1
             
Sbjct  259  V  259



>ref|XP_008461679.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=260

 Score =   423 bits (1088),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 222/240 (93%), Gaps = 1/240 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            VHARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  21   VHARIPGVYSGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  80

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFE+KC+ND + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPM
Sbjct  81   LSCGACFELKCANDPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPM  140

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNL+L+TNVAGAGDI K  VKGS+
Sbjct  141  FLKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLILITNVAGAGDIVKASVKGSK  200

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            T W+++SRNWGQNW+++A LVGQSLSFRV +SDRR  TSWN+ P+NWQFGQTF GKNFR 
Sbjct  201  TEWMSMSRNWGQNWQSNAILVGQSLSFRVTSSDRRTSTSWNIVPSNWQFGQTFTGKNFRV  260



>gb|AEE69071.1| expansin-4 [Petunia hybrid cultivar]
Length=248

 Score =   422 bits (1086),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 198/241 (82%), Positives = 222/241 (92%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            TAV+A+IPGVY GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALST LFN
Sbjct  7    TAVYAKIPGVYIGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTVLFN  66

Query  543  NGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            +GLSCGACFE+KC+ND   C PGNPSIFVTATNFCPPN+ALPND+GGWCNPPRPHFDLAM
Sbjct  67   SGLSCGACFELKCTNDEPWCLPGNPSIFVTATNFCPPNYALPNDDGGWCNPPRPHFDLAM  126

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPVN+RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDIQ+V VKG
Sbjct  127  PMFLKIAQYRAGIVPVNYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIQQVYVKG  186

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            + T WI +SRNWGQNW+++A + GQ+LSFRVR SD+R   S N+APANWQFGQTF+G+NF
Sbjct  187  TNTEWIAMSRNWGQNWQSNALIAGQALSFRVRGSDQRSSASLNIAPANWQFGQTFEGENF  246

Query  6    R  4
            R
Sbjct  247  R  247



>ref|XP_006349505.1| PREDICTED: expansin-A3-like [Solanum tuberosum]
Length=259

 Score =   423 bits (1087),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 198/243 (81%), Positives = 223/243 (92%), Gaps = 2/243 (1%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T V+A+I GVY+GG+W +AHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN
Sbjct  17   TVVNAKIVGVYTGGSWTSAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  76

Query  543  NGLSCGACFEIKCSNDRS--CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLA  370
            +GLSCG+CFEIKC++ +   C+PGNPSI VT TNFCPPN+ALPNDNGGWCNPPRPHFDLA
Sbjct  77   SGLSCGSCFEIKCTDSKKEYCNPGNPSILVTGTNFCPPNYALPNDNGGWCNPPRPHFDLA  136

Query  369  MPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVK  190
            MPMFLKIA YRAGIV VN+RR+PCRKQGGIRFTVNGF+YFNLVLVTNVAGAGDIQKV VK
Sbjct  137  MPMFLKIAVYRAGIVAVNYRRVPCRKQGGIRFTVNGFQYFNLVLVTNVAGAGDIQKVYVK  196

Query  189  GSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKN  10
            G+ TPWI+++RNWGQNW+T+A L+GQ+LSFRV  SDRR   S+N+APANWQFGQTFQGKN
Sbjct  197  GTNTPWISMTRNWGQNWQTNAKLIGQALSFRVTGSDRRSSASYNIAPANWQFGQTFQGKN  256

Query  9    FRA  1
            FR 
Sbjct  257  FRV  259



>gb|KHG12430.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=264

 Score =   423 bits (1087),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 222/240 (93%), Gaps = 1/240 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V+ARIPGVY+GG+W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTA+FNNG
Sbjct  25   VNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTAIFNNG  84

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFEIKC++D R C PGNPSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPM
Sbjct  85   LSCGACFEIKCTDDPRWCHPGNPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPM  144

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAG+I KV VKG+ 
Sbjct  145  FLKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGNIVKVSVKGTN  204

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            T W+++SRNWGQNW+++A LVGQ LSFRV  SDRR  TSWNVAPANWQFGQTF  KNFR 
Sbjct  205  TGWLSMSRNWGQNWQSNAVLVGQQLSFRVTGSDRRTSTSWNVAPANWQFGQTFTAKNFRV  264



>ref|XP_008233635.1| PREDICTED: expansin-A4-like [Prunus mume]
Length=259

 Score =   422 bits (1085),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 201/241 (83%), Positives = 219/241 (91%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T V ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  18   TIVEARIPGVYSGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  77

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFEIKC+N  + C  G+PSIFVTATNFCPPN+ALPNDNGGWCNPPRPHFDLAM
Sbjct  78   NGLSCGACFEIKCANQPQWCHSGSPSIFVTATNFCPPNYALPNDNGGWCNPPRPHFDLAM  137

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+TNVAGAGDI KV VKG
Sbjct  138  PMFLKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGFKYFNLVLITNVAGAGDIVKVSVKG  197

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W++LSRNWGQNW+++A L GQSLSFRV  SDRR  TSWN+ PANWQFGQTF GKNF
Sbjct  198  SKTGWMSLSRNWGQNWQSNAVLAGQSLSFRVTGSDRRTSTSWNIVPANWQFGQTFTGKNF  257

Query  6    R  4
            R
Sbjct  258  R  258



>gb|KJB46592.1| hypothetical protein B456_007G376300 [Gossypium raimondii]
Length=262

 Score =   422 bits (1085),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 198/241 (82%), Positives = 224/241 (93%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T+V+A+IPGVYS G+W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  21   TSVNAKIPGVYSTGSWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  80

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFEIKC++D R C PG+PSIFVTATNFCPPNFALP+DNGGWCNPPRPHFDLAM
Sbjct  81   NGLSCGACFEIKCASDPRWCHPGSPSIFVTATNFCPPNFALPSDNGGWCNPPRPHFDLAM  140

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV+FRR+PCRK GGIRFTVNGFRYFNLVL+TNVAGAGD+ KV +KG
Sbjct  141  PMFLKIAEYRAGIVPVSFRRVPCRKHGGIRFTVNGFRYFNLVLITNVAGAGDLVKVSIKG  200

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            ++T W+++SRNWGQNW+++A L+GQ+LSFRV  SD+R  TSWNVAP NWQFGQTF GKNF
Sbjct  201  TKTGWMSMSRNWGQNWQSNAVLIGQALSFRVTGSDKRTSTSWNVAPPNWQFGQTFTGKNF  260

Query  6    R  4
            R
Sbjct  261  R  261



>gb|ACN94264.1| expansin [Rehmannia glutinosa]
 gb|ACN94265.1| expansin [Rehmannia glutinosa]
Length=260

 Score =   422 bits (1085),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 200/239 (84%), Positives = 218/239 (91%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            + ARIPG Y GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  21   IEARIPGNYGGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  80

Query  537  LSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
             SCGACFEIKC+ND+  C  G+PSIFVTATNFCPPN+ALPNDNGGWCNPPR HFDLAMPM
Sbjct  81   FSCGACFEIKCANDKQWCHAGSPSIFVTATNFCPPNYALPNDNGGWCNPPRTHFDLAMPM  140

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPVNFRR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI KV +KGSR
Sbjct  141  FLKIAEYRAGIVPVNFRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKVSIKGSR  200

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            T W+T+SRNWGQNW++++ L+GQSLSFRV  SDRR  TSWN+AP+NWQFGQTF GKNFR
Sbjct  201  TGWMTMSRNWGQNWQSNSVLIGQSLSFRVTGSDRRTSTSWNIAPSNWQFGQTFVGKNFR  259



>ref|XP_003537990.1| PREDICTED: expansin-A4-like [Glycine max]
Length=259

 Score =   422 bits (1084),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 219/240 (91%), Gaps = 1/240 (0%)
 Frame = -3

Query  720  AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  541
            AV ARIPG+YSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN+
Sbjct  19   AVEARIPGIYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNS  78

Query  540  GLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            GLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPNFALPNDNGGWCNPPRPHFDLAMP
Sbjct  79   GLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  138

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLKIA YRAGIVPV +RR+PCRK GGIRFTVNGFRYFNLVLV+NVAGAGDI +  VKG+
Sbjct  139  MFLKIAEYRAGIVPVAYRRVPCRKHGGIRFTVNGFRYFNLVLVSNVAGAGDIVRTYVKGT  198

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            RT W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWN+AP NWQFGQTF GKNFR
Sbjct  199  RTGWMPMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNIAPPNWQFGQTFTGKNFR  258



>ref|XP_002298353.1| alpha-expansin 1 family protein [Populus trichocarpa]
 gb|ABK92494.1| unknown [Populus trichocarpa]
 gb|EEE83158.1| alpha-expansin 1 family protein [Populus trichocarpa]
Length=262

 Score =   422 bits (1084),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 197/238 (83%), Positives = 222/238 (93%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALSTALFNNGL
Sbjct  24   EARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGL  83

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            +CG+CFEIKC++D R C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  84   TCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  143

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +V VKGS+T
Sbjct  144  LKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVQVSVKGSKT  203

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A LVGQSLSFRVRASDRR  TSWN+APA+WQFGQTF GKNFR
Sbjct  204  GWMSMSRNWGQNWQSNAVLVGQSLSFRVRASDRRSSTSWNIAPAHWQFGQTFTGKNFR  261



>ref|XP_010256907.1| PREDICTED: expansin-A4 [Nelumbo nucifera]
Length=260

 Score =   421 bits (1083),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 199/242 (82%), Positives = 220/242 (91%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T V ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  19   TLVDARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  78

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
             GLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHFDLAM
Sbjct  79   AGLSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLAM  138

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI KV VKG
Sbjct  139  PMFLKIAEYRAGIVPVAYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKVSVKG  198

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W+++SRNWGQNW+++A LVGQSLSFR+  SDRR  TSWNV P+NWQFGQTF GKNF
Sbjct  199  SQTGWMSMSRNWGQNWQSNAVLVGQSLSFRITGSDRRTSTSWNVVPSNWQFGQTFTGKNF  258

Query  6    RA  1
            R 
Sbjct  259  RV  260



>ref|XP_009768238.1| PREDICTED: expansin-A6-like [Nicotiana sylvestris]
Length=257

 Score =   421 bits (1083),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 200/241 (83%), Positives = 219/241 (91%), Gaps = 1/241 (0%)
 Frame = -3

Query  720  AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  541
            AV  RIPGVYSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNN ALSTALFNN
Sbjct  17   AVEGRIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNGALSTALFNN  76

Query  540  GLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            GLSCGACFEIKC  D +SC  G+PSIF+TATNFCPPNFALPNDNGGWCNPPRPHFDLAMP
Sbjct  77   GLSCGACFEIKCDKDPQSCHSGSPSIFITATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  136

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVLV NVAGAGDI +V VKGS
Sbjct  137  MFLKIAEYRAGIVPVVYRRVPCRKKGGIRFTINGFRYFNLVLVANVAGAGDIVRVYVKGS  196

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            +T WIT+SRNWGQN++T++ L+GQSLSFRV ASDRR   SWN+AP +WQFGQTF GKNFR
Sbjct  197  KTNWITMSRNWGQNYQTNSVLIGQSLSFRVTASDRRSSASWNIAPPHWQFGQTFIGKNFR  256

Query  3    A  1
             
Sbjct  257  V  257



>ref|XP_003616412.1| Expansin [Medicago truncatula]
 gb|AES99370.1| expansin A10 [Medicago truncatula]
Length=259

 Score =   421 bits (1083),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 196/242 (81%), Positives = 221/242 (91%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T+  AR+PGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  18   TSTEARLPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  77

Query  543  NGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCG+CFE+KCSND S C PG+PSI VTATNFCPPNFA  +DNGGWCNPPRPHFDLAM
Sbjct  78   NGLSCGSCFELKCSNDPSWCHPGSPSILVTATNFCPPNFAQASDNGGWCNPPRPHFDLAM  137

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV++RR+PCRKQGGIR+T+NGFRYFNLVL+TNVAGAGDI K  VKG
Sbjct  138  PMFLKIAQYRAGIVPVSYRRVPCRKQGGIRYTINGFRYFNLVLITNVAGAGDIVKTSVKG  197

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W+++SRNWGQNW++++ LVGQSLSFRV +SD+R  TSWN+ P+NWQFGQTF GKNF
Sbjct  198  SKTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTSSDKRTSTSWNIVPSNWQFGQTFTGKNF  257

Query  6    RA  1
            R 
Sbjct  258  RV  259



>gb|ACO07292.1| expansin 10 [Cucumis sativus]
Length=259

 Score =   421 bits (1082),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 200/238 (84%), Positives = 218/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
            HARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   HARIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC+ND R C PG+PSIF+TATNFCPPNFALPNDNGGWC PPR HFD AMPMF
Sbjct  81   SCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNFALPNDNGGWCTPPRTHFDFAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI KV VKGS T
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKVSVKGSNT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A LVGQ+LSFR+  SDRR  TSWNVAP+NWQFGQTF GKNFR
Sbjct  201  GWMSMSRNWGQNWQSNAVLVGQTLSFRLTGSDRRTSTSWNVAPSNWQFGQTFTGKNFR  258



>gb|ADC35365.1| alpha-expansin 2 [Coffea arabica]
Length=258

 Score =   421 bits (1082),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 196/241 (81%), Positives = 220/241 (91%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T   ARIPGVY+G +W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  17   TLTEARIPGVYTGDSWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  76

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG SCG+CFE+KC++D + C PG+PSI +TATNFCPPN+ALPNDNGGWCNPPRPHFDLAM
Sbjct  77   NGFSCGSCFELKCADDPQWCHPGSPSILITATNFCPPNYALPNDNGGWCNPPRPHFDLAM  136

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFL+IA YRAGIVPV++RR+PCRKQGGIRF +NGFRYFNLVL+TNVAGAGDI +  VKG
Sbjct  137  PMFLRIAEYRAGIVPVSYRRVPCRKQGGIRFQINGFRYFNLVLITNVAGAGDIVQASVKG  196

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T WITLSRNWGQNW+T+A L GQSLSFRVRASDRR  TSWN+APANWQFGQTF GKNF
Sbjct  197  SKTGWITLSRNWGQNWQTNAVLAGQSLSFRVRASDRRSSTSWNIAPANWQFGQTFTGKNF  256

Query  6    R  4
            R
Sbjct  257  R  257



>ref|XP_011035307.1| PREDICTED: expansin-A6 [Populus euphratica]
Length=262

 Score =   421 bits (1082),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 197/238 (83%), Positives = 221/238 (93%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALSTALFNNGL
Sbjct  24   EARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGL  83

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCG+CFEIKC++D R C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  84   SCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  143

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +V VKGS+T
Sbjct  144  LKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVQVSVKGSKT  203

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A LVGQSLSFRVRASDRR  TSWN+ PA+WQFGQTF GKNFR
Sbjct  204  GWMSMSRNWGQNWQSNAVLVGQSLSFRVRASDRRSSTSWNIVPAHWQFGQTFTGKNFR  261



>ref|XP_007218834.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
 gb|EMJ20033.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
Length=259

 Score =   421 bits (1082),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 201/241 (83%), Positives = 218/241 (90%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T V ARIPGVYSG AWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  18   TIVEARIPGVYSGEAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  77

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFEIKC+N  + C  G+PSIFVTATNFCPPN+ALPNDNGGWCNPPR HFDLAM
Sbjct  78   NGLSCGACFEIKCANQPQWCHSGSPSIFVTATNFCPPNYALPNDNGGWCNPPRSHFDLAM  137

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV++RR+PCRKQGGIRFTVNGF+YFNLVL+TNVAGAGDI KV VKG
Sbjct  138  PMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTVNGFKYFNLVLITNVAGAGDIVKVSVKG  197

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W++LSRNWGQNW+++A L GQSLSFRV  SDRR  TSWN+ PANWQFGQTF GKNF
Sbjct  198  SKTGWMSLSRNWGQNWQSNAVLAGQSLSFRVTGSDRRTSTSWNIVPANWQFGQTFTGKNF  257

Query  6    R  4
            R
Sbjct  258  R  258



>ref|XP_006366490.1| PREDICTED: expansin-A6 [Solanum tuberosum]
Length=257

 Score =   421 bits (1081),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 219/240 (91%), Gaps = 1/240 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V  RIPGVYSGG+WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG
Sbjct  18   VEGRIPGVYSGGSWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  77

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFEIKC N  + C PG+PSI +TATNFCPPN+ALPNDNGGWCNPPR HFDLAMPM
Sbjct  78   LSCGACFEIKCDNQPQWCHPGSPSILITATNFCPPNYALPNDNGGWCNPPRTHFDLAMPM  137

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV +RR+ CRKQGGIRFT+NGF YFNLVLVTNVAGAGDI KV+VKG+R
Sbjct  138  FLKIAEYRAGIVPVVYRRVSCRKQGGIRFTINGFSYFNLVLVTNVAGAGDITKVMVKGTR  197

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            T WITLSRNWGQNW+T++ LVGQSLSFRV ASD+R+ TSWN+AP++WQFGQTF GKNFR 
Sbjct  198  TNWITLSRNWGQNWQTNSVLVGQSLSFRVTASDKRKSTSWNIAPSHWQFGQTFVGKNFRV  257



>gb|AAM22625.1|AF428178_1 expansin 11 precursor [Rumex palustris]
Length=258

 Score =   421 bits (1081),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 221/240 (92%), Gaps = 1/240 (0%)
 Frame = -3

Query  720  AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  541
            +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGACG+GNLYSQGYGVN AALSTALFNN
Sbjct  18   SADARIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYSQGYGVNTAALSTALFNN  77

Query  540  GLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            GLSCGACFEIKC++D R C PG+PSI +TATNFCPPNFA P+DNGGWCNPPRPHFDLAMP
Sbjct  78   GLSCGACFEIKCADDPRWCHPGSPSILITATNFCPPNFAEPSDNGGWCNPPRPHFDLAMP  137

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLKIA YRAGIVPV FRR+PCRK+GGIRFTVNGFRYFNLVL+TNVAGAGDI +V +KGS
Sbjct  138  MFLKIAEYRAGIVPVAFRRVPCRKRGGIRFTVNGFRYFNLVLITNVAGAGDIVRVSIKGS  197

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            R+ W+ +SRNWGQNW+++A LVGQSLSFRV ASDRR+ TSWNVAPA+WQFGQTF GKNFR
Sbjct  198  RSDWMPMSRNWGQNWQSNAVLVGQSLSFRVTASDRRKSTSWNVAPASWQFGQTFTGKNFR  257



>gb|ACK36943.1| expansin [Annona cherimola]
Length=259

 Score =   421 bits (1081),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 197/242 (81%), Positives = 219/242 (90%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            + V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN A LSTA FN
Sbjct  18   SLVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAVLSTAFFN  77

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFEIKC++D + C  G+PSI +TATNFCPPN+ALP+DNGGWCNPPRPHFDLAM
Sbjct  78   NGLSCGACFEIKCADDPKWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAM  137

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI +V VKG
Sbjct  138  PMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVRVSVKG  197

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            SRT W+ +SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PANWQFGQTF GKNF
Sbjct  198  SRTGWMAMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPANWQFGQTFSGKNF  257

Query  6    RA  1
            R 
Sbjct  258  RV  259



>dbj|BAN09210.1| alpha expansin [Eustoma exaltatum subsp. russellianum]
Length=262

 Score =   421 bits (1081),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 218/240 (91%), Gaps = 3/240 (1%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAW++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  22   EARIPGVYSGGAWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  81

Query  534  SCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            SCGACFEIKC ND   R C PG+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMP
Sbjct  82   SCGACFEIKCINDPNWRWCHPGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLAMP  141

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFL +A YRAGIVPV +RR+PCRK GG+RFT+NGFRYFNLVL+TNVAGAGDI +  VKGS
Sbjct  142  MFLNLAQYRAGIVPVTYRRVPCRKHGGVRFTINGFRYFNLVLITNVAGAGDIVRASVKGS  201

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            RT WI+LSRNWGQNW+T+  L+GQSLSFRV ASDRR  TSWN+AP+NWQFGQTF GKNFR
Sbjct  202  RTNWISLSRNWGQNWQTNGVLIGQSLSFRVTASDRRTSTSWNIAPSNWQFGQTFVGKNFR  261



>gb|KDP44940.1| hypothetical protein JCGZ_01440 [Jatropha curcas]
Length=258

 Score =   420 bits (1080),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 197/238 (83%), Positives = 220/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPGVYSGG+W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLS
Sbjct  21   ARIPGVYSGGSWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLS  80

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFEIKC+N+ + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFL
Sbjct  81   CGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFL  140

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI K  VKGS+T 
Sbjct  141  KIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKASVKGSKTG  200

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PANWQFGQTF GKNFR 
Sbjct  201  WMSLSRNWGQNWQSNAILVGQSLSFRVTGSDRRTSTSWNIVPANWQFGQTFTGKNFRV  258



>ref|XP_009607348.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=293

 Score =   422 bits (1084),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 195/238 (82%), Positives = 220/238 (92%), Gaps = 0/238 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            TAV+A+I G Y+GG W TAHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALST LFN
Sbjct  18   TAVNAKISGNYAGGPWTTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTVLFN  77

Query  543  NGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            NGLSCGACFE+KC++ + C+PGNPSI VTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP
Sbjct  78   NGLSCGACFELKCTDQKWCTPGNPSILVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  137

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLKIA YRAGIVPVN+RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDIQKV VKG+
Sbjct  138  MFLKIAEYRAGIVPVNYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIQKVYVKGT  197

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKN  10
            +T WI ++RNWGQNW+T+A LVGQ+LSFRV ASD+R   S+++APANWQFGQTFQ ++
Sbjct  198  KTNWIAMNRNWGQNWQTNALLVGQALSFRVTASDKRSSASYDIAPANWQFGQTFQARD  255



>ref|XP_007016396.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY34015.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=258

 Score =   420 bits (1080),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 198/239 (83%), Positives = 218/239 (91%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             A+IPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  20   EAKIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  79

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC+ND + C  G PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPMF
Sbjct  80   SCGACFEIKCANDPKWCHSGGPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMF  139

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI KV VKGSRT
Sbjct  140  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKVSVKGSRT  199

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+++SRNWGQNW+++A LVGQSLSFRV   DRR  TSWN+ PANWQFGQTF GKNFR 
Sbjct  200  GWMSMSRNWGQNWQSNAVLVGQSLSFRVTGGDRRTSTSWNIVPANWQFGQTFAGKNFRV  258



>gb|KDP20458.1| hypothetical protein JCGZ_05303 [Jatropha curcas]
Length=260

 Score =   420 bits (1080),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 218/239 (91%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPG Y GGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  22   EARIPGNYMGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  81

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPMF
Sbjct  82   SCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMF  141

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK GGIRFT+NGFRYFNLVL++NVAGAGDI KV VKG+RT
Sbjct  142  LKIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFRYFNLVLISNVAGAGDIVKVSVKGTRT  201

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+NWQFGQTF GKNFR 
Sbjct  202  GWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRSSTSWNIVPSNWQFGQTFSGKNFRV  260



>ref|XP_009757427.1| PREDICTED: expansin-A4-like [Nicotiana sylvestris]
Length=261

 Score =   420 bits (1080),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 220/244 (90%), Gaps = 3/244 (1%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            + V ARIPGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  18   SLVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  77

Query  543  NGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  373
            NGLSCGACFEIKC+ND   + C PG+PSI +TATNFCPPN+A PNDNGGWCNPPR HFDL
Sbjct  78   NGLSCGACFEIKCTNDPNWKWCLPGSPSILITATNFCPPNYAKPNDNGGWCNPPRSHFDL  137

Query  372  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  193
            AMPMFLKIA YRAGIVPV +RRIPCRK+GGIRFT+NGFRYFNLVL+TNVAGAGDI KV V
Sbjct  138  AMPMFLKIAEYRAGIVPVTYRRIPCRKRGGIRFTINGFRYFNLVLITNVAGAGDIIKVWV  197

Query  192  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGK  13
            KGS+T WI+LSRNWGQNW+++A L GQSLSFRV+ASD R  TSWN+ P++WQFGQTF GK
Sbjct  198  KGSKTNWISLSRNWGQNWQSNAVLTGQSLSFRVKASDHRSSTSWNIVPSHWQFGQTFTGK  257

Query  12   NFRA  1
            NF+ 
Sbjct  258  NFKV  261



>ref|XP_007140533.1| hypothetical protein PHAVU_008G120700g [Phaseolus vulgaris]
 gb|ESW12527.1| hypothetical protein PHAVU_008G120700g [Phaseolus vulgaris]
Length=258

 Score =   420 bits (1080),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 198/241 (82%), Positives = 218/241 (90%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
             +  ARIPGVY+GG+WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  17   VSTSARIPGVYTGGSWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  76

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFEIKC  D R C+PGNPSI +TATNFCPPNFALPNDNGGWCNPPRPHFDLAM
Sbjct  77   NGLSCGACFEIKCDQDPRWCNPGNPSILITATNFCPPNFALPNDNGGWCNPPRPHFDLAM  136

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV FRR+ CRK GGIRFT+NGFRYFNLVL+TNVAGAGDI +V VKG
Sbjct  137  PMFLKIAQYRAGIVPVAFRRVACRKTGGIRFTINGFRYFNLVLITNVAGAGDIVRVSVKG  196

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W+++SRNWGQNW+++A LVGQ+LSFR+  SDRR  TSWNVAP NWQFGQTF GKNF
Sbjct  197  SKTAWLSMSRNWGQNWQSNAVLVGQTLSFRITGSDRRTSTSWNVAPPNWQFGQTFTGKNF  256

Query  6    R  4
            R
Sbjct  257  R  257



>ref|XP_007205740.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
 dbj|BAC66787.1| expansin [Prunus persica]
 gb|EMJ06939.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
Length=260

 Score =   420 bits (1080),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 198/238 (83%), Positives = 220/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+ AALSTALFNNGL
Sbjct  22   EARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGL  81

Query  534  SCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMF
Sbjct  82   SCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMF  141

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVLV+NVAGAGDI +V VKGS+T
Sbjct  142  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVSNVAGAGDIVRVSVKGSKT  201

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A LVGQSLSFRVR SDRR  TSWNV PANWQFGQTF GKNFR
Sbjct  202  SWMSMSRNWGQNWQSNAVLVGQSLSFRVRGSDRRTSTSWNVVPANWQFGQTFTGKNFR  259



>emb|CDP00110.1| unnamed protein product [Coffea canephora]
Length=255

 Score =   420 bits (1079),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 196/241 (81%), Positives = 220/241 (91%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T   ARIPGVY+G +W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  14   TPTEARIPGVYTGDSWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  73

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG SCG+CFE+KC++D + C PG+PSI +TATNFCPPN+ALPNDNGGWCNPPRPHFDLAM
Sbjct  74   NGFSCGSCFELKCADDPQWCHPGSPSILITATNFCPPNYALPNDNGGWCNPPRPHFDLAM  133

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFL+IA YRAGIVPV++RR+PCRKQGGIRF +NGFRYFNLVL+TNVAGAGDI +  VKG
Sbjct  134  PMFLRIAEYRAGIVPVSYRRVPCRKQGGIRFQINGFRYFNLVLITNVAGAGDIVQASVKG  193

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T WITLSRNWGQNW+T+A L GQSLSFRVRASDRR  TSWN+APANWQFGQTF GKNF
Sbjct  194  SKTGWITLSRNWGQNWQTNAVLAGQSLSFRVRASDRRSSTSWNIAPANWQFGQTFTGKNF  253

Query  6    R  4
            R
Sbjct  254  R  254



>gb|AHL25255.1| expansin [Boehmeria nivea]
Length=260

 Score =   420 bits (1079),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 221/240 (92%), Gaps = 1/240 (0%)
 Frame = -3

Query  720  AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  541
            A  ARIPGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN+
Sbjct  20   ATEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNS  79

Query  540  GLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            GLSCGACFE+KC+ND +SC  G+PSI VTATNFCPPN+ALPND+GGWCNPPRPHFDLAMP
Sbjct  80   GLSCGACFELKCANDPKSCHSGSPSIIVTATNFCPPNYALPNDHGGWCNPPRPHFDLAMP  139

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+NG RYFNL+L++NVAG+GDI +  VKGS
Sbjct  140  MFLKIAEYRAGIVPVSFRRVPCRKRGGVRFTINGHRYFNLILISNVAGSGDIVRASVKGS  199

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            +T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+APANWQFGQTF GKNFR
Sbjct  200  KTGWMSLSRNWGQNWQSNAALVGQSLSFRVTGSDRRTSTSWNIAPANWQFGQTFTGKNFR  259



>gb|KHG15821.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=264

 Score =   420 bits (1079),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 199/239 (83%), Positives = 221/239 (92%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V+ARIPGV++GGAW++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  25   VNARIPGVFTGGAWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  84

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFEIKC+ND R C  G+PSI +TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPM
Sbjct  85   LSCGACFEIKCANDPRWCHSGSPSIIITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPM  144

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI KV VKG+ 
Sbjct  145  FLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKVKVKGTN  204

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            T W+++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS NVAPANWQFGQTF GKNFR
Sbjct  205  TNWMSMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSLNVAPANWQFGQTFTGKNFR  263



>ref|XP_003552923.2| PREDICTED: expansin-A3-like [Glycine max]
Length=262

 Score =   420 bits (1079),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 195/241 (81%), Positives = 218/241 (90%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T  HA+IPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  21   TQSHAKIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  80

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG SCGACFEIKC++D + C+PGNPSI VTATNFCPPN+ALP DNGGWCNPPRPHFDLAM
Sbjct  81   NGFSCGACFEIKCTDDPKWCNPGNPSILVTATNFCPPNYALPTDNGGWCNPPRPHFDLAM  140

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV++RR+ CRKQGG+RFT+NGFRYFNLVL+TNVAGAGDI +  VKG
Sbjct  141  PMFLKIAQYRAGIVPVSYRRVACRKQGGMRFTINGFRYFNLVLITNVAGAGDIMRASVKG  200

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P NWQFGQTF GKNF
Sbjct  201  SKTEWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPRNWQFGQTFAGKNF  260

Query  6    R  4
            R
Sbjct  261  R  261



>ref|XP_002283530.1| PREDICTED: expansin-A4 [Vitis vinifera]
Length=258

 Score =   419 bits (1078),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 197/241 (82%), Positives = 220/241 (91%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            + V A+IPG YSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  17   SLVQAKIPGAYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  76

Query  543  NGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFE+KC+ND + C  G+PSI +TATNFCPPN+ALP+DNGGWCNPPRPHFDLAM
Sbjct  77   NGLSCGACFELKCANDPTWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAM  136

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV FRR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI +  VKG
Sbjct  137  PMFLKIAEYRAGIVPVAFRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVRASVKG  196

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+APA+WQFGQTF GKNF
Sbjct  197  SKTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIAPAHWQFGQTFSGKNF  256

Query  6    R  4
            R
Sbjct  257  R  257



>gb|KJB36710.1| hypothetical protein B456_006G172400 [Gossypium raimondii]
Length=264

 Score =   420 bits (1079),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 199/239 (83%), Positives = 220/239 (92%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V+ARIPGVY+GGAW++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  25   VNARIPGVYTGGAWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  84

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCG CFEIKC+ND R C  G+PSI +TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPM
Sbjct  85   LSCGGCFEIKCANDPRWCHSGSPSIIITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPM  144

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI KV VKG+ 
Sbjct  145  FLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKVKVKGTN  204

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            T W+++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS NVAPANWQFGQTF GKNFR
Sbjct  205  TNWLSMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSLNVAPANWQFGQTFTGKNFR  263



>ref|XP_009587747.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=259

 Score =   419 bits (1078),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 200/242 (83%), Positives = 220/242 (91%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            TAV+A+IPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALST LFN
Sbjct  18   TAVNAKIPGVYTGGPWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTVLFN  77

Query  543  NGLSCGACFEIKC-SNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFEIKC  +D+ C PGNPSIFVTATNFCPPNFALPND+GGWCNPPRPHFDLAM
Sbjct  78   NGLSCGACFEIKCVDDDKWCLPGNPSIFVTATNFCPPNFALPNDDGGWCNPPRPHFDLAM  137

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKI  YRAGIVPV++RR+ CRK GGIRFT+NGFRYFNL+LVTNVAGAGDIQKVL+KG
Sbjct  138  PMFLKIGLYRAGIVPVSYRRVACRKAGGIRFTINGFRYFNLLLVTNVAGAGDIQKVLIKG  197

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            + T WI +SRNWGQNW+T+A LVG++LS RV+ASD R VTS NVAP NWQFGQTF GKNF
Sbjct  198  TNTQWIAMSRNWGQNWQTNAVLVGKALSIRVKASDHRSVTSNNVAPPNWQFGQTFVGKNF  257

Query  6    RA  1
            R 
Sbjct  258  RV  259



>emb|CDP09064.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   419 bits (1078),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 200/238 (84%), Positives = 220/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALF++GL
Sbjct  22   EARIPGVYTGGDWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFSSGL  81

Query  534  SCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC++D   C PG+PSIFVTATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPMF
Sbjct  82   SCGACFEIKCASDPGWCHPGSPSIFVTATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMF  141

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAG+I +V VKGSRT
Sbjct  142  LKIAEYRAGIVPVTYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGNIVRVSVKGSRT  201

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             WI++SRNWGQNW+T+  LVGQSLSFRV ASDRR  TSWN+APA+WQFGQTF GKNFR
Sbjct  202  GWISMSRNWGQNWQTNGNLVGQSLSFRVAASDRRSSTSWNIAPAHWQFGQTFVGKNFR  259



>gb|AAR82850.1| expansin-2 [Petunia x hybrida]
Length=262

 Score =   419 bits (1078),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 219/244 (90%), Gaps = 3/244 (1%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            + V ARIPGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  19   SLVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  78

Query  543  NGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  373
            NGLSCGACFE+KC+ND   + C PGNPSI +TATNFCPPN+A PNDNGGWCNPPR HFDL
Sbjct  79   NGLSCGACFELKCTNDPHWKWCLPGNPSILITATNFCPPNYAKPNDNGGWCNPPRSHFDL  138

Query  372  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  193
            AMPMFLKIA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLVL+ NVAGAGDI KV V
Sbjct  139  AMPMFLKIAEYRAGIVPVTYRRVPCRKQGGIRFTMNGFRYFNLVLIPNVAGAGDIIKVWV  198

Query  192  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGK  13
            KG++T WI LSRNWGQNW+T++ L GQSLSFRV+ASD R  TSWN+AP++WQFGQTF GK
Sbjct  199  KGTKTNWIPLSRNWGQNWQTNSILTGQSLSFRVKASDHRTSTSWNIAPSHWQFGQTFNGK  258

Query  12   NFRA  1
            NFR 
Sbjct  259  NFRV  262



>ref|XP_008223717.1| PREDICTED: expansin-A4 [Prunus mume]
Length=260

 Score =   419 bits (1078),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 198/238 (83%), Positives = 220/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+ AALSTALFNNGL
Sbjct  22   EARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGL  81

Query  534  SCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMF
Sbjct  82   SCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMF  141

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVLV+NVAGAGDI +V VKGS+T
Sbjct  142  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVSNVAGAGDIVRVSVKGSKT  201

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A LVGQSLSFRVR SDRR  TSWNV PANWQFGQTF GKNFR
Sbjct  202  GWMSMSRNWGQNWQSNAVLVGQSLSFRVRGSDRRTSTSWNVVPANWQFGQTFTGKNFR  259



>ref|XP_011089478.1| PREDICTED: expansin-A6 [Sesamum indicum]
Length=260

 Score =   419 bits (1077),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 218/239 (91%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY+GG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG 
Sbjct  22   EARIPGVYTGGGWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGF  81

Query  534  SCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC+ ++  C  G+PSIFVTATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPMF
Sbjct  82   SCGACFEIKCAMEKQWCHAGSPSIFVTATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMF  141

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL+TNVAGAGDI +V +KGSRT
Sbjct  142  LKIAEYRAGIVPVTYRRVPCRKKGGIRFTINGFRYFNLVLITNVAGAGDIVRVSIKGSRT  201

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+AP+NWQFGQTF GKNFR 
Sbjct  202  GWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIAPSNWQFGQTFVGKNFRV  260



>gb|KJB73995.1| hypothetical protein B456_011G266000 [Gossypium raimondii]
Length=258

 Score =   419 bits (1077),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 197/242 (81%), Positives = 220/242 (91%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            TAV ARIPGVYSGGAWQ+AHATFYGG DASGTMGGACG+GNLYSQGYGVN AALSTALFN
Sbjct  17   TAVEARIPGVYSGGAWQSAHATFYGGNDASGTMGGACGFGNLYSQGYGVNTAALSTALFN  76

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG SCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR HFDLAM
Sbjct  77   NGFSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRSHFDLAM  136

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL+TNVAGAGDI K  VKG
Sbjct  137  PMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLITNVAGAGDIVKASVKG  196

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P++WQFGQTF GKNF
Sbjct  197  SKTEWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSHWQFGQTFTGKNF  256

Query  6    RA  1
            R 
Sbjct  257  RV  258



>ref|XP_010264435.1| PREDICTED: expansin-A4 [Nelumbo nucifera]
Length=260

 Score =   419 bits (1077),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 216/239 (90%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V ARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  21   VDARIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  80

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFEIKC+ND + C PG PSI +TATNFCPPNFALP+DNGGWCNPPRPHFDLAMPM
Sbjct  81   LSCGACFEIKCANDPQWCHPGGPSILITATNFCPPNFALPSDNGGWCNPPRPHFDLAMPM  140

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV +RR+PCRK GGIRFT+NGFRYFNLVLVTNVAGAGDI KV VKGS 
Sbjct  141  FLKIAEYRAGIVPVAYRRVPCRKHGGIRFTINGFRYFNLVLVTNVAGAGDIVKVSVKGSN  200

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            T W+T+SRNWGQNW+++A LVGQ+LSFR+  SD R  TSWNVAPANWQFGQTF GKNFR
Sbjct  201  TGWLTMSRNWGQNWQSNAVLVGQALSFRITGSDHRTSTSWNVAPANWQFGQTFTGKNFR  259



>ref|XP_002313434.1| alpha-expansin 1 family protein [Populus trichocarpa]
 gb|EEE87389.1| alpha-expansin 1 family protein [Populus trichocarpa]
Length=262

 Score =   419 bits (1077),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 196/238 (82%), Positives = 220/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALSTALFNNGL
Sbjct  24   EARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGL  83

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC++D + C  G+PSI +TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  84   SCGACFEIKCADDPQWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  143

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA Y AGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +V VKGS+T
Sbjct  144  LKIAEYHAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVQVSVKGSKT  203

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A LVGQSLSFRVRASDRR  TSWN+ PA+WQFGQTF GKNFR
Sbjct  204  GWMSMSRNWGQNWQSNAVLVGQSLSFRVRASDRRSSTSWNIVPAHWQFGQTFTGKNFR  261



>gb|AAM22624.1|AF428177_1 expansin 10 precursor [Rumex palustris]
Length=258

 Score =   419 bits (1076),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 198/240 (83%), Positives = 220/240 (92%), Gaps = 1/240 (0%)
 Frame = -3

Query  720  AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  541
            +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGACG+GNLYSQGYGVN AALSTALFNN
Sbjct  18   SADARIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYSQGYGVNTAALSTALFNN  77

Query  540  GLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            G+SCGACFEIKC++D R C PGNPSI +TATNFCPPNFA P+DNGGWCNPP PHFDLAMP
Sbjct  78   GMSCGACFEIKCADDPRWCHPGNPSILITATNFCPPNFAEPSDNGGWCNPPLPHFDLAMP  137

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLKIA YRAGIVPV FRR+PCRK+GGIRFTVNGFRYFNLVL+TNVAGAGDI +V +KGS
Sbjct  138  MFLKIAEYRAGIVPVAFRRVPCRKRGGIRFTVNGFRYFNLVLITNVAGAGDIVRVSIKGS  197

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            R+ W+ +SRNWGQNW+++A LVGQSLSFRV ASDRR+ TSWNVAPA+WQFGQTF GKNFR
Sbjct  198  RSDWMPMSRNWGQNWQSNAVLVGQSLSFRVTASDRRKSTSWNVAPASWQFGQTFTGKNFR  257



>gb|AFZ78606.1| expansin protein [Populus tomentosa]
Length=262

 Score =   419 bits (1076),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 195/238 (82%), Positives = 221/238 (93%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAW+ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALSTALFNNGL
Sbjct  24   EARIPGVYSGGAWENAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGL  83

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCG+CFEIKC++D R C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  84   SCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  143

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +V VKGS+T
Sbjct  144  LKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVQVSVKGSKT  203

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A LVGQ+LSFRVRASDRR  TSWN+ PA+WQFGQTF GKNFR
Sbjct  204  GWMSMSRNWGQNWQSNAVLVGQTLSFRVRASDRRSSTSWNIVPAHWQFGQTFTGKNFR  261



>gb|AAM22626.1|AF428179_1 expansin 12 precursor [Rumex palustris]
Length=258

 Score =   419 bits (1076),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 198/240 (83%), Positives = 220/240 (92%), Gaps = 1/240 (0%)
 Frame = -3

Query  720  AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  541
            +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGACG+GNLYSQGYGVN AALSTALFNN
Sbjct  18   SADARIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYSQGYGVNTAALSTALFNN  77

Query  540  GLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            GLSCGACFEIKC++D R C PG+PSI +TATNFCPPNFA P+DNGGWCNPPRPHFDLAMP
Sbjct  78   GLSCGACFEIKCADDPRWCHPGSPSILITATNFCPPNFAEPSDNGGWCNPPRPHFDLAMP  137

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLK A YRAGIVPV FRR+PCRK+GGIRFTVNGFRYFNLVL+TNVAGAGDI +V +KGS
Sbjct  138  MFLKFAEYRAGIVPVAFRRVPCRKRGGIRFTVNGFRYFNLVLITNVAGAGDIVRVSIKGS  197

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            R+ W+ +SRNWGQNW+++A LVGQSLSFRV ASDRR+ TSWNVAPA+WQFGQTF GKNFR
Sbjct  198  RSDWMPMSRNWGQNWQSNAVLVGQSLSFRVTASDRRKSTSWNVAPASWQFGQTFTGKNFR  257



>ref|XP_007141864.1| hypothetical protein PHAVU_008G232200g [Phaseolus vulgaris]
 gb|ESW13858.1| hypothetical protein PHAVU_008G232200g [Phaseolus vulgaris]
Length=260

 Score =   419 bits (1076),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 220/240 (92%), Gaps = 1/240 (0%)
 Frame = -3

Query  720  AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  541
            +  ARIPGVY GGAW+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN+
Sbjct  20   SAEARIPGVYGGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNS  79

Query  540  GLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            GLSCGACFEIKC++D S C  G+PSI VTATNFCPPN+ALP+DNGGWCNPPRPHFDLAMP
Sbjct  80   GLSCGACFEIKCADDPSWCHAGSPSILVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMP  139

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLKIA YRAGIVPV++RR+PCRKQGG+RFT+NGFRYFNLVL+TNVAGAGD+ +  VKG+
Sbjct  140  MFLKIAEYRAGIVPVSYRRVPCRKQGGMRFTINGFRYFNLVLITNVAGAGDVVRTSVKGA  199

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            +T W+++SRNWGQNW+++A LVGQSLSFRV ASDRR  TSWN+ PANWQFGQTF GKNFR
Sbjct  200  KTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTSWNIVPANWQFGQTFTGKNFR  259



>gb|AEN70914.1| expansin [Gossypium trilobum]
Length=259

 Score =   419 bits (1076),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 219/239 (92%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALSTALFNNGL
Sbjct  21   EARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGL  80

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC++D + C  G+PSIF+TATNFCPPNFALPNDNGGWCNPPR HFDLAMPMF
Sbjct  81   SCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNFALPNDNGGWCNPPRTHFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI KV VKGSRT
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKVSVKGSRT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P++WQFGQTF GKNFR 
Sbjct  201  GWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSHWQFGQTFTGKNFRV  259



>ref|XP_004486999.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=257

 Score =   418 bits (1075),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 217/239 (91%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             +RIPG Y+GGAW+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN GL
Sbjct  19   ESRIPGNYNGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNKGL  78

Query  534  SCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPMF
Sbjct  79   SCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMF  138

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV FRR+PCRKQGGIRFTVNGFRYFNLVL++NVAGAGDI +  VKG+RT
Sbjct  139  LKIAEYRAGIVPVAFRRVPCRKQGGIRFTVNGFRYFNLVLISNVAGAGDIVRTYVKGTRT  198

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+ +SRNWGQNW+++A LVGQSLSFRV +SDRR  TSWN+AP NWQFGQTF GKNFR 
Sbjct  199  RWMPMSRNWGQNWQSNAVLVGQSLSFRVTSSDRRTSTSWNIAPHNWQFGQTFTGKNFRV  257



>gb|AFB77223.1| expansin 1 [Betula platyphylla]
Length=258

 Score =   418 bits (1075),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 196/242 (81%), Positives = 219/242 (90%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T V A+IPGVYSGGAWQ+AHATFYGG DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  17   TLVDAKIPGVYSGGAWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  76

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFEIKC+N+ + C  G+PSI +TATNFCPPN+ALP+DNGGWCNPPRPHFDLAM
Sbjct  77   NGLSCGACFEIKCANEPQWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAM  136

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI KV VKG
Sbjct  137  PMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKVSVKG  196

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W++LSRNWGQNW+++  L GQSLSFRV  SDRR  TSWN+ P++WQFGQTF GKNF
Sbjct  197  SKTEWMSLSRNWGQNWQSNVVLAGQSLSFRVTGSDRRTSTSWNIVPSDWQFGQTFTGKNF  256

Query  6    RA  1
            R 
Sbjct  257  RV  258



>gb|ADY68814.1| expansin [Gossypium barbadense]
 gb|ADY68816.1| expansin [Gossypium herbaceum subsp. africanum]
 gb|AEN70897.1| expansin [Gossypium darwinii]
 gb|AEN70899.1| expansin [Gossypium tomentosum]
 gb|AEN70903.1| expansin [Gossypium barbadense var. peruvianum]
 gb|AEN70905.1| expansin [Gossypium hirsutum subsp. latifolium]
 gb|AEN70909.1| expansin [Gossypium davidsonii]
 gb|AEN70910.1| expansin [Gossypium klotzschianum]
 gb|KJB20062.1| hypothetical protein B456_003G131000 [Gossypium raimondii]
Length=259

 Score =   418 bits (1075),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 219/239 (92%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALSTALFNNGL
Sbjct  21   EARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGL  80

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR HFDLAMPMF
Sbjct  81   SCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTHFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI KV VKGSRT
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKVSVKGSRT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PA+WQFGQTF GKNFR 
Sbjct  201  GWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFRV  259



>ref|NP_001242978.1| expansin-A4-like precursor [Glycine max]
 gb|AEV43316.1| expansin A5a [Glycine max]
Length=259

 Score =   418 bits (1074),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 217/239 (91%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V ARIPGVYS GAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN+G
Sbjct  20   VQARIPGVYSAGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNSG  79

Query  537  LSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM
Sbjct  80   LSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  139

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV +RR+PCRK GGIRFT+NGFRYFNLVL++NVAGAGDI +  VKG+R
Sbjct  140  FLKIAEYRAGIVPVAYRRVPCRKHGGIRFTINGFRYFNLVLISNVAGAGDIVRTYVKGTR  199

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            T W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWN+AP NWQFGQTF GKNFR
Sbjct  200  TGWMPMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNIAPPNWQFGQTFTGKNFR  258



>ref|XP_003552173.1| PREDICTED: expansin-A4 [Glycine max]
Length=258

 Score =   418 bits (1074),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 197/241 (82%), Positives = 218/241 (90%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
             A  ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  17   VATSARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  76

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFEIKC  D R C+PG+PSI +TATNFCPPNFALPNDNGGWCNPPRPHFDLAM
Sbjct  77   NGLSCGACFEIKCDQDPRWCNPGSPSILITATNFCPPNFALPNDNGGWCNPPRPHFDLAM  136

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV +RR+PCRK GGIRFT+NGFRYFNLVL+TNVAGAGDI +V +KG
Sbjct  137  PMFLKIAQYRAGIVPVAYRRVPCRKTGGIRFTINGFRYFNLVLITNVAGAGDIVRVSMKG  196

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W+++SRNWGQNW+++A LVGQ+LSFRV  SD+R  TSWNVAP NWQFGQTF GKNF
Sbjct  197  SKTAWMSMSRNWGQNWQSNAVLVGQALSFRVTGSDQRTSTSWNVAPPNWQFGQTFTGKNF  256

Query  6    R  4
            R
Sbjct  257  R  257



>ref|XP_004300427.1| PREDICTED: expansin-A6 [Fragaria vesca subsp. vesca]
Length=259

 Score =   418 bits (1074),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 198/241 (82%), Positives = 220/241 (91%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            +   ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+ AALSTALFN
Sbjct  18   SITEARIPGVYSGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVSTAALSTALFN  77

Query  543  NGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPRPHFDLAM
Sbjct  78   NGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHFDLAM  137

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVLV+NVAGAGDI +V VKG
Sbjct  138  PMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVSNVAGAGDIVRVSVKG  197

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            SRT W++LSRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ PANWQFGQTF GKNF
Sbjct  198  SRTGWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRSSTSWNIVPANWQFGQTFTGKNF  257

Query  6    R  4
            R
Sbjct  258  R  258



>gb|AAR09168.1| alpha-expansin 1 [Populus tremula x Populus tremuloides]
Length=262

 Score =   418 bits (1074),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 194/238 (82%), Positives = 221/238 (93%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+ AALSTALFNNGL
Sbjct  24   EARIPGVYSGGAWENAHATFYGGSDASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGL  83

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCG+CFEIKC++D R C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  84   SCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  143

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +V VKGS+T
Sbjct  144  LKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVQVSVKGSKT  203

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A LVGQ+LSFRVRASDRR  TSWN+ PA+WQFGQTF GKNFR
Sbjct  204  GWMSMSRNWGQNWQSNAVLVGQTLSFRVRASDRRSSTSWNIVPAHWQFGQTFTGKNFR  261



>gb|ADY68815.1| expansin [Gossypium barbadense]
 gb|ADY68819.1| expansin [Gossypium hirsutum]
 gb|AEN70892.1| expansin [Gossypium laxum]
 gb|AEN70894.1| expansin [Gossypium turneri]
 gb|AEN70896.1| expansin [Gossypium mustelinum]
 gb|AEN70898.1| expansin [Gossypium darwinii]
 gb|AEN70902.1| expansin [Gossypium barbadense var. brasiliense]
 gb|AEN70904.1| expansin [Gossypium barbadense var. peruvianum]
 gb|AEN70906.1| expansin [Gossypium hirsutum subsp. latifolium]
 gb|AEN70908.1| expansin [Gossypium harknessii]
 gb|AEN70911.1| expansin [Gossypium aridum]
 gb|AEN70912.1| expansin [Gossypium gossypioides]
 gb|AEN70913.1| expansin [Gossypium lobatum]
Length=259

 Score =   418 bits (1074),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 218/239 (91%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALSTALFNNGL
Sbjct  21   EARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGL  80

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC +D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR HFDLAMPMF
Sbjct  81   SCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTHFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI KV VKGSRT
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKVSVKGSRT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PA+WQFGQTF GKNFR 
Sbjct  201  GWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFRV  259



>ref|XP_010920576.1| PREDICTED: expansin-A4-like [Elaeis guineensis]
Length=260

 Score =   418 bits (1074),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 197/241 (82%), Positives = 218/241 (90%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T   ARIPGVY+GG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN
Sbjct  19   TLADARIPGVYAGGQWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFN  78

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
             GLSCGACFEIKC++D R C PG+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAM
Sbjct  79   EGLSCGACFEIKCADDPRWCHPGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAM  138

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+TNVA AGDI +V VKG
Sbjct  139  PMFLKIAQYRAGIVPVSYRRVPCRKSGGIRFTINGFQYFNLVLITNVASAGDIVRVSVKG  198

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            SRT W+ +SRNWGQNW+++A LVGQSLSFRV ASDRR  TSWN+ PANWQFGQTF GKNF
Sbjct  199  SRTGWMPMSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTSWNIVPANWQFGQTFAGKNF  258

Query  6    R  4
            R
Sbjct  259  R  259



>gb|AEN70893.1| expansin [Gossypium schwendimanii]
Length=259

 Score =   418 bits (1074),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 218/239 (91%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALSTALFNNGL
Sbjct  21   EARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGL  80

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC +D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR HFDLAMPMF
Sbjct  81   SCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTHFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI KV VKGSRT
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKVSVKGSRT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PA+WQFGQTF GKNFR 
Sbjct  201  GWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFRV  259



>gb|AEU08407.1| expansin 2 [Prunus salicina]
Length=260

 Score =   417 bits (1073),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 197/238 (83%), Positives = 220/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+ AALSTALFNNGL
Sbjct  22   EARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGL  81

Query  534  SCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA P+D+GGWCNPPRPHFDLAMPMF
Sbjct  82   SCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDDGGWCNPPRPHFDLAMPMF  141

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVLV+NVAGAGDI +V VKGS+T
Sbjct  142  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVSNVAGAGDIVRVSVKGSKT  201

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A LVGQSLSFRVR SDRR  TSWNV PANWQFGQTF GKNFR
Sbjct  202  GWMSMSRNWGQNWQSNAVLVGQSLSFRVRGSDRRTSTSWNVVPANWQFGQTFTGKNFR  259



>ref|XP_010685747.1| PREDICTED: expansin-A4 [Beta vulgaris subsp. vulgaris]
Length=261

 Score =   417 bits (1073),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 196/242 (81%), Positives = 220/242 (91%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T V ARIPG Y GG+WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  20   TLVDARIPGNYQGGSWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  79

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            +GLSCGACFE+KC+ND R C PG+PSI +TATNFCPPNFALPNDNGGWCNPPRPHFDLAM
Sbjct  80   SGLSCGACFELKCANDPRWCHPGSPSILITATNFCPPNFALPNDNGGWCNPPRPHFDLAM  139

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLK+A YRAGIVPV FRR+PCRK+GGIRFT+NGFRYFNLVLV+NVAGAGDI  V +KG
Sbjct  140  PMFLKLAQYRAGIVPVAFRRVPCRKRGGIRFTMNGFRYFNLVLVSNVAGAGDIVNVYIKG  199

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W+ +SRNWGQNW++++ LVGQSLSFRVR SD+R  TSWN+AP+NWQFGQTF GKNF
Sbjct  200  SKTNWMAMSRNWGQNWQSNSVLVGQSLSFRVRGSDKRSSTSWNIAPSNWQFGQTFTGKNF  259

Query  6    RA  1
            R 
Sbjct  260  RV  261



>ref|XP_003543517.1| PREDICTED: expansin-A4 [Glycine max]
Length=257

 Score =   417 bits (1073),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 216/239 (90%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN+G
Sbjct  18   VDARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNSG  77

Query  537  LSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPM
Sbjct  78   LSCGACFEIKCANDKQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPM  137

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV FRR+ CRK GGIRFT+NGFRYFNLVL++NVAGAGDI    VKGSR
Sbjct  138  FLKIAEYRAGIVPVAFRRVACRKHGGIRFTINGFRYFNLVLISNVAGAGDIVHAYVKGSR  197

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            T W+ +SRNWGQNW+++A LVGQ+LSFRV ASDRR  TSWN+ P+NWQFGQTF GKNFR
Sbjct  198  TGWMPMSRNWGQNWQSNAVLVGQALSFRVTASDRRSSTSWNIVPSNWQFGQTFTGKNFR  256



>gb|AEN70891.1| expansin [Gossypium thurberi]
Length=259

 Score =   417 bits (1073),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 219/239 (92%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALSTALFNNGL
Sbjct  21   EARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGL  80

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR HFDLAMPMF
Sbjct  81   SCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTHFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI KV VKGSRT
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKVSVKGSRT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P++WQFGQTF GKNFR 
Sbjct  201  GWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSHWQFGQTFTGKNFRV  259



>emb|CAN73252.1| hypothetical protein VITISV_027049 [Vitis vinifera]
Length=247

 Score =   417 bits (1071),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 195/238 (82%), Positives = 216/238 (91%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  9    EARIPGVYTGGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  68

Query  534  SCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFE+KC+ND   C  G+PSI +TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  69   SCGACFELKCANDPEWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  128

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI K  VKGS+T
Sbjct  129  LKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKASVKGSKT  188

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W++LSRNWGQNW+++A LVGQSLSFRV  SD R  TSWN+ P+NWQFGQTF GKNFR
Sbjct  189  GWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDHRTSTSWNIVPSNWQFGQTFSGKNFR  246



>gb|KJB55836.1| hypothetical protein B456_009G098800 [Gossypium raimondii]
Length=259

 Score =   417 bits (1072),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 196/238 (82%), Positives = 219/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   EARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR HFDLAMPMF
Sbjct  81   SCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRSHFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGD+ KV VKGSRT
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDLVKVSVKGSRT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PA+WQFGQTF GKNFR
Sbjct  201  GWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFR  258



>gb|ADY68817.1| expansin [Gossypium raimondii]
Length=259

 Score =   417 bits (1072),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 219/239 (92%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALSTALFNNGL
Sbjct  21   EARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGL  80

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR HFDLAMPMF
Sbjct  81   SCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTHFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYF+LVL++NVAGAGDI KV VKGSRT
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFDLVLISNVAGAGDIVKVSVKGSRT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PA+WQFGQTF GKNFR 
Sbjct  201  GWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFRV  259



>ref|XP_002283358.1| PREDICTED: expansin-A4 [Vitis vinifera]
 emb|CBI31662.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   417 bits (1072),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 195/238 (82%), Positives = 216/238 (91%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  20   EARIPGVYTGGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  79

Query  534  SCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFE+KC+ND   C  G+PSI +TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  80   SCGACFELKCANDPEWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  139

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI K  VKGS+T
Sbjct  140  LKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKASVKGSKT  199

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W++LSRNWGQNW+++A LVGQSLSFRV  SD R  TSWN+ P+NWQFGQTF GKNFR
Sbjct  200  GWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDHRTSTSWNIVPSNWQFGQTFSGKNFR  257



>gb|KHG20113.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=259

 Score =   417 bits (1072),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 196/238 (82%), Positives = 219/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   EARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR HFDLAMPMF
Sbjct  81   SCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRSHFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGD+ KV VKGSRT
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDLVKVSVKGSRT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PA+WQFGQTF GKNFR
Sbjct  201  GWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFR  258



>ref|XP_002266625.1| PREDICTED: expansin-A6 [Vitis vinifera]
 emb|CAN65872.1| hypothetical protein VITISV_000251 [Vitis vinifera]
 emb|CBI30547.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   417 bits (1071),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 198/239 (83%), Positives = 219/239 (92%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            VHARIPGVY+ G W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN+G
Sbjct  19   VHARIPGVYTSGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNSG  78

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFEIKC+ND + C  G+PSIFVTATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPM
Sbjct  79   LSCGACFEIKCANDPKWCHSGSPSIFVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPM  138

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV FRR+ CRK GGIRFTVNGFRYFNLVLVTNVAGAGDI +V +KGS+
Sbjct  139  FLKIAEYRAGIVPVAFRRVSCRKSGGIRFTVNGFRYFNLVLVTNVAGAGDIVRVSIKGSK  198

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            T W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWNVAPANWQFGQTF G+NFR
Sbjct  199  TGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNVAPANWQFGQTFSGRNFR  257



>ref|XP_009787901.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=293

 Score =   418 bits (1075),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 194/238 (82%), Positives = 219/238 (92%), Gaps = 0/238 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T+V+A+I G Y+GG W TAHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALST LFN
Sbjct  18   TSVNAKISGNYAGGPWTTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTVLFN  77

Query  543  NGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            NGLSCGACFE+KC++ + C+PGNPSI VTATNFCPPN+ALPNDNGGWCNPPRPHFDLAMP
Sbjct  78   NGLSCGACFELKCTDQKWCTPGNPSILVTATNFCPPNYALPNDNGGWCNPPRPHFDLAMP  137

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLKIA YRAGIVPVN+RR+PCRKQGGIRFTVNGF YFNLVLVTNVAGAGDIQKV VKG+
Sbjct  138  MFLKIAEYRAGIVPVNYRRVPCRKQGGIRFTVNGFNYFNLVLVTNVAGAGDIQKVYVKGT  197

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKN  10
            +T WI ++RNWGQNW+T+A LVGQ+LSFRV ASDRR   S+++APANWQFGQTFQ ++
Sbjct  198  KTNWIAMNRNWGQNWQTNALLVGQALSFRVTASDRRSSASYDIAPANWQFGQTFQARD  255



>gb|AAT11859.2| expansin 1 [Mangifera indica]
Length=260

 Score =   417 bits (1071),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 221/240 (92%), Gaps = 1/240 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  21   VEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  80

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
             SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPM
Sbjct  81   FSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPM  140

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV++RR+PCR++GGIRFT+NGFRYFNLVL+ +VAG+GDI KV VKG+R
Sbjct  141  FLKIAEYRAGIVPVSYRRVPCRERGGIRFTINGFRYFNLVLIADVAGSGDIVKVSVKGTR  200

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            T W+++SRNWGQNW+++  LVGQ+LSFRVRASDRR  TSWN+ PANWQFGQTF GKNFR 
Sbjct  201  TGWMSMSRNWGQNWQSNTVLVGQALSFRVRASDRRSSTSWNIVPANWQFGQTFVGKNFRV  260



>gb|AEN70907.1| expansin [Gossypium armourianum]
Length=259

 Score =   416 bits (1070),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 218/239 (91%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALSTALFNNGL
Sbjct  21   EARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGL  80

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC +D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR HFDLAMPMF
Sbjct  81   SCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTHFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI KV VKGSRT
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKVSVKGSRT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P++WQFGQTF GKNFR 
Sbjct  201  GWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSHWQFGQTFTGKNFRV  259



>gb|AEN70901.1| expansin [Gossypium barbadense var. brasiliense]
Length=259

 Score =   416 bits (1070),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 196/238 (82%), Positives = 218/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALSTALFNNGL
Sbjct  21   EARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGL  80

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR HFDLAMPMF
Sbjct  81   SCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTHFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI K  VKGSRT
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKASVKGSRT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PA+WQFGQTF GKNFR
Sbjct  201  GWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFR  258



>gb|EYU18981.1| hypothetical protein MIMGU_mgv1a012125mg [Erythranthe guttata]
Length=260

 Score =   416 bits (1070),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 217/239 (91%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            + ARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  21   IEARIPGVYSGGGWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  80

Query  537  LSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
             SCGACFEIKC+N++  C  G+PSI VTATNFCPPN+ALPNDNGGWCNPPR HFDLAMPM
Sbjct  81   FSCGACFEIKCANEKQWCHAGSPSILVTATNFCPPNYALPNDNGGWCNPPRTHFDLAMPM  140

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPVNFRR+ CRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI ++ +KG+R
Sbjct  141  FLKIAEYRAGIVPVNFRRVACRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVRLSIKGTR  200

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            T W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+APANWQFGQTF GKNFR
Sbjct  201  TGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIAPANWQFGQTFVGKNFR  259



>ref|XP_009343581.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=261

 Score =   416 bits (1070),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 217/239 (91%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  22   VEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  81

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFEIKC+N  + C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPR HFDLAMPM
Sbjct  82   LSCGACFEIKCANQPQWCKSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRTHFDLAMPM  141

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV++RR+PCRKQGGIRFT+NG +YFNLVL+ NVAGAGDI KV VKG+ 
Sbjct  142  FLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNLVLIHNVAGAGDIVKVYVKGTN  201

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            TPW++LSRNWGQNW+++A LVGQSLSFRV ASDRR  TSWN+ P+NWQFGQTF GKNFR
Sbjct  202  TPWMSLSRNWGQNWQSNAILVGQSLSFRVTASDRRTSTSWNIVPSNWQFGQTFTGKNFR  260



>gb|ADY68818.1| expansin [Gossypium hirsutum]
Length=259

 Score =   416 bits (1070),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 218/239 (91%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY QGYGV+ AALSTALFNNGL
Sbjct  21   EARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYGQGYGVSTAALSTALFNNGL  80

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR HFDLAMPMF
Sbjct  81   SCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTHFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI KV VKGSRT
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKVSVKGSRT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PA+WQFGQTF GKNFR 
Sbjct  201  GWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFRV  259



>ref|XP_003538409.1| PREDICTED: expansin-A6 [Glycine max]
Length=258

 Score =   416 bits (1070),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 193/238 (81%), Positives = 217/238 (91%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             A+IPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG 
Sbjct  20   QAKIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGF  79

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC++D + C PGNPSIFVTATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  80   SCGACFEIKCTDDPKWCHPGNPSIFVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  139

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GG+RFT+NGFRYFNLVL+TNVAGAGDI +  VKGS+T
Sbjct  140  LKIAQYRAGIVPVSYRRVPCRKEGGMRFTINGFRYFNLVLITNVAGAGDIMRASVKGSKT  199

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A LVGQSLSFRV   DRR  TSWN+ P NWQFGQTF GKNFR
Sbjct  200  EWMSMSRNWGQNWQSNAVLVGQSLSFRVTGGDRRTSTSWNIVPRNWQFGQTFAGKNFR  257



>ref|XP_004490888.1| PREDICTED: expansin-A4-like [Cicer arietinum]
Length=260

 Score =   416 bits (1070),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 195/238 (82%), Positives = 218/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY+GGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN GL
Sbjct  22   EARIPGVYTGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNEGL  81

Query  534  SCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKCS+D + C  G+PSI VTATNFCPPN+A P+DNGGWCNPPRPHFDLAMPMF
Sbjct  82   SCGACFEIKCSDDPNWCHAGSPSILVTATNFCPPNYAQPSDNGGWCNPPRPHFDLAMPMF  141

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI K  VKGS++
Sbjct  142  LKIAQYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKTSVKGSKS  201

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A L+GQSLSFRV ASDRR  TSWN+ P+NWQFGQTF GKNFR
Sbjct  202  GWMSMSRNWGQNWQSNAILIGQSLSFRVTASDRRTSTSWNIVPSNWQFGQTFTGKNFR  259



>ref|XP_011077214.1| PREDICTED: expansin-A6-like [Sesamum indicum]
Length=259

 Score =   416 bits (1069),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 194/239 (81%), Positives = 218/239 (91%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V  RIPGVY+GGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  20   VECRIPGVYTGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  79

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
             SCGACFEIKC ++ + C PG+PSIF+TATNFCPPN+ALPNDNGGWCNPPR HFDLAMPM
Sbjct  80   FSCGACFEIKCRDEPQWCHPGSPSIFITATNFCPPNYALPNDNGGWCNPPRTHFDLAMPM  139

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV++RR+PC K+GGIRFT+NGFRYFNLVL++NVAGAGDI KV VKGSR
Sbjct  140  FLKIAEYRAGIVPVSYRRVPCHKKGGIRFTINGFRYFNLVLISNVAGAGDIMKVWVKGSR  199

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            T W+ +SRNWGQNW+++A LVGQSLSFRV+ASD R  T+WN+ P+NWQFGQTF GKNFR
Sbjct  200  TGWMAMSRNWGQNWQSNAVLVGQSLSFRVKASDHRSSTAWNIVPSNWQFGQTFTGKNFR  258



>ref|XP_006350774.1| PREDICTED: expansin-A6 [Solanum tuberosum]
Length=260

 Score =   416 bits (1069),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 217/239 (91%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGV++ GAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNN ALSTALFNNGL
Sbjct  22   EARIPGVFTAGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNGALSTALFNNGL  81

Query  534  SCGACFEIKCSN-DRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC N  + C PG+PSIF+TATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF
Sbjct  82   SCGACFEIKCDNYPQWCHPGSPSIFITATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  141

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            L IA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI  + +KGS+T
Sbjct  142  LHIAEYRAGIVPVVYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVSLSIKGSKT  201

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             WI++SRNWGQNW+T++ L GQSLSFRVRA DRR  TSWN+APA+WQFGQTF GKNFR 
Sbjct  202  NWISMSRNWGQNWQTNSVLFGQSLSFRVRAGDRRSSTSWNIAPAHWQFGQTFIGKNFRV  260



>ref|XP_006488339.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|KDO72838.1| hypothetical protein CISIN_1g046524mg [Citrus sinensis]
Length=259

 Score =   416 bits (1069),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 197/238 (83%), Positives = 220/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             AR+PG YSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   DARLPGDYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  534  SCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC+N+ + C  G+PSI VTATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  81   SCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVLVTNVAGAGDI +V VKGSRT
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLVLVTNVAGAGDILRVNVKGSRT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A LVGQSLSFRV+ASDRR  TSWN+ PANWQFGQTF GKNFR
Sbjct  201  GWMSMSRNWGQNWQSNAVLVGQSLSFRVKASDRRSSTSWNIVPANWQFGQTFVGKNFR  258



>ref|NP_001288899.1| expansin-A6 precursor [Brassica rapa]
 gb|AGM16348.1| alpha-expansin protein 6 [Brassica rapa]
Length=260

 Score =   416 bits (1069),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 195/241 (81%), Positives = 221/241 (92%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T   ARIPGVYSGG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  19   TISEARIPGVYSGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  78

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPRPHFDLAM
Sbjct  79   NGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRPHFDLAM  138

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVLVTNVAGAG+I ++ VKG
Sbjct  139  PMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLVTNVAGAGNIVRLSVKG  198

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            +RT W+++SRNWGQNW++++ LVGQSLSFRV ASDRR  TSWN+APA+WQFGQTF GKNF
Sbjct  199  TRTSWMSMSRNWGQNWQSNSVLVGQSLSFRVTASDRRSSTSWNIAPAHWQFGQTFTGKNF  258

Query  6    R  4
            R
Sbjct  259  R  259



>ref|XP_011042710.1| PREDICTED: expansin-A4-like [Populus euphratica]
Length=262

 Score =   416 bits (1069),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 194/238 (82%), Positives = 219/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAW+TAHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALSTALFNNGL
Sbjct  24   EARIPGVYSGGAWETAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGL  83

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC++D + C  G+PSI +TATNFCPPN+ALP+DNGGWC PPRPHFDLAMPMF
Sbjct  84   SCGACFEIKCADDPQWCHSGSPSILITATNFCPPNYALPSDNGGWCTPPRPHFDLAMPMF  143

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA Y AGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +V VKGS+T
Sbjct  144  LKIAEYHAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVQVSVKGSKT  203

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A LVGQSLSFRVRASDRR  TSWN+ PA+WQFGQTF GKNFR
Sbjct  204  GWMSMSRNWGQNWQSNAVLVGQSLSFRVRASDRRSSTSWNIVPAHWQFGQTFTGKNFR  261



>gb|AEN70900.1| expansin [Gossypium tomentosum]
Length=259

 Score =   416 bits (1069),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 217/239 (91%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAWQ AHAT YGGADASGTMGGACGYGNLYSQGYGV+ AALSTALFNNGL
Sbjct  21   EARIPGVYSGGAWQNAHATLYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGL  80

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC +D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR HFDLAMPMF
Sbjct  81   SCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTHFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI KV VKGSRT
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKVSVKGSRT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PA+WQFGQTF GKNFR 
Sbjct  201  GWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFRV  259



>ref|XP_009589397.1| PREDICTED: expansin-A4-like [Nicotiana tomentosiformis]
Length=261

 Score =   416 bits (1069),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 196/244 (80%), Positives = 218/244 (89%), Gaps = 3/244 (1%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            + V ARIPGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  18   SLVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  77

Query  543  NGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  373
            NGLSCGACFEIKC+ND   + C PG+PSI +TATNFCPPN+A PNDNGGWCNPPR HFDL
Sbjct  78   NGLSCGACFEIKCTNDPNWKWCLPGSPSILITATNFCPPNYAKPNDNGGWCNPPRSHFDL  137

Query  372  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  193
            AMPMFL IA YRAGIVPV +RRIPCRK+GGIRFT+NGFRYFNLVL+TNVAGAGDI KV V
Sbjct  138  AMPMFLNIAQYRAGIVPVTYRRIPCRKRGGIRFTINGFRYFNLVLITNVAGAGDIIKVWV  197

Query  192  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGK  13
            KGS+T WI+LSRNWGQNW+++A L  QSLSFRV+ASD R  TSWN+ P++WQFGQTF GK
Sbjct  198  KGSKTNWISLSRNWGQNWQSNAVLTAQSLSFRVKASDHRSSTSWNIVPSHWQFGQTFTGK  257

Query  12   NFRA  1
            NF+ 
Sbjct  258  NFKV  261



>gb|KHG29956.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=258

 Score =   416 bits (1069),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 195/242 (81%), Positives = 218/242 (90%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            TAV ARIPG YSGG WQ+AHATFYGG DASGTMGGACGYGNLYSQGYGV+ AALSTALFN
Sbjct  17   TAVEARIPGFYSGGEWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVSTAALSTALFN  76

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG SCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR HFDLAM
Sbjct  77   NGFSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRSHFDLAM  136

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL+TNVAGAGDI K  VKG
Sbjct  137  PMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLITNVAGAGDIVKASVKG  196

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P++WQFGQTF GKNF
Sbjct  197  SKTEWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSHWQFGQTFTGKNF  256

Query  6    RA  1
            R 
Sbjct  257  RV  258



>ref|NP_001233958.1| expansin precursor [Solanum lycopersicum]
 gb|AAC63088.1| expansin [Solanum lycopersicum]
 gb|AAQ12264.1| expansin 1 protein [Solanum lycopersicum]
Length=261

 Score =   416 bits (1069),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 196/241 (81%), Positives = 218/241 (90%), Gaps = 3/241 (1%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V  RIPGVYSGG+W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  20   VEGRIPGVYSGGSWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  79

Query  537  LSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            LSCGACFE+KC+N    + C PGNPSI +TATNFCPPN+ALPNDNGGWCNPPRPHFDLAM
Sbjct  80   LSCGACFELKCTNTPNWKWCLPGNPSILITATNFCPPNYALPNDNGGWCNPPRPHFDLAM  139

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLK+A YRAGIVPV +RRIPCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI KV VKG
Sbjct  140  PMFLKLAQYRAGIVPVTYRRIPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIIKVWVKG  199

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            ++T WI LSRNWGQNW+++A L GQSLSFRV+ASD R  TSWN+ P++WQFGQTF GKNF
Sbjct  200  TKTNWIPLSRNWGQNWQSNAVLTGQSLSFRVKASDHRSSTSWNMVPSHWQFGQTFIGKNF  259

Query  6    R  4
            +
Sbjct  260  K  260



>ref|XP_010528418.1| PREDICTED: expansin-A3 [Tarenaya hassleriana]
Length=264

 Score =   416 bits (1069),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 195/237 (82%), Positives = 219/237 (92%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLS
Sbjct  27   ARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLS  86

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFEIKC+ D + C+PGNPSIFVTATNFCPPNFA P+D+GGWCNPPR HFDLAMPMFL
Sbjct  87   CGACFEIKCTEDPKWCNPGNPSIFVTATNFCPPNFAQPSDDGGWCNPPRQHFDLAMPMFL  146

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV+FRR+PCRK+GGIRFT+NGFRYFNLVL+TNVAGAGD+ +  +KGS+T 
Sbjct  147  KIAQYRAGIVPVSFRRVPCRKKGGIRFTINGFRYFNLVLITNVAGAGDVVRASIKGSKTA  206

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W+++SRNWGQNW+++A  VGQSLSFRV ASDRR  TS+NVAPANWQFGQTF GKNFR
Sbjct  207  WMSMSRNWGQNWQSNAVFVGQSLSFRVTASDRRTSTSFNVAPANWQFGQTFSGKNFR  263



>gb|KCW65541.1| hypothetical protein EUGRSUZ_G02938 [Eucalyptus grandis]
Length=259

 Score =   416 bits (1068),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 195/242 (81%), Positives = 218/242 (90%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T   ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  18   TLAEARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  77

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG SCGACFEIKC+N+ + C  G+PSI VTATNFCPPN+ALPNDNGGWCNPPRPHFDLAM
Sbjct  78   NGFSCGACFEIKCANEPQWCHSGSPSILVTATNFCPPNYALPNDNGGWCNPPRPHFDLAM  137

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI K+ VKG
Sbjct  138  PMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDINKLWVKG  197

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W+++SRNWGQNW++++ L GQSLSFRV A DRR  TSWN+ P+NWQFGQTF GKNF
Sbjct  198  SKTGWMSMSRNWGQNWQSNSVLAGQSLSFRVTAGDRRTSTSWNIVPSNWQFGQTFTGKNF  257

Query  6    RA  1
            R 
Sbjct  258  RV  259



>ref|XP_009364387.1| PREDICTED: expansin-A4 [Pyrus x bretschneideri]
Length=260

 Score =   416 bits (1068),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 217/239 (91%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN  ALSTALFNNGL
Sbjct  22   EARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTGALSTALFNNGL  81

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKCSND R C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMF
Sbjct  82   SCGACFEIKCSNDPRWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMF  141

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +V VKG+RT
Sbjct  142  LKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVRVSVKGART  201

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ PANWQFGQTF GKNFR 
Sbjct  202  GWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIVPANWQFGQTFTGKNFRV  260



>ref|XP_003547326.1| PREDICTED: expansin-A4-like [Glycine max]
Length=256

 Score =   416 bits (1068),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 215/239 (90%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN+G
Sbjct  17   VEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNSG  76

Query  537  LSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPM
Sbjct  77   LSCGACFEIKCANDKQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPM  136

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV +RR+ CRK GGIRFT+NGFRYFNLVL++NVAGAGDI    VKGSR
Sbjct  137  FLKIAEYRAGIVPVAYRRVACRKHGGIRFTINGFRYFNLVLISNVAGAGDIVHAYVKGSR  196

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            T WI +SRNWGQNW+++A LVGQ+LSFRV ASDRR  TSWN+ P NWQF QTF GKNFR
Sbjct  197  TGWIAMSRNWGQNWQSNAVLVGQALSFRVTASDRRSSTSWNIVPPNWQFAQTFTGKNFR  255



>ref|XP_006424843.1| hypothetical protein CICLE_v10029094mg [Citrus clementina]
 gb|ESR38083.1| hypothetical protein CICLE_v10029094mg [Citrus clementina]
Length=259

 Score =   416 bits (1068),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 196/238 (82%), Positives = 220/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             AR+PG YSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   DARLPGDYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  534  SCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC+N+ + C  G+PSI VTATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  81   SCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVLVTNVAGAGDI +V VKGSRT
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLVLVTNVAGAGDILRVNVKGSRT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A L+GQSLSFRV+ASDRR  TSWN+ PANWQFGQTF GKNFR
Sbjct  201  GWMSMSRNWGQNWQSNAVLIGQSLSFRVKASDRRSSTSWNIVPANWQFGQTFVGKNFR  258



>gb|AAM47000.1|AF512542_1 alpha-expansin precursor [Gossypium hirsutum]
Length=264

 Score =   416 bits (1068),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 198/239 (83%), Positives = 220/239 (92%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V+ARIPGV++GGAW++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALS ALFNNG
Sbjct  25   VNARIPGVFTGGAWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSPALFNNG  84

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFEIKC+ND R C  G+PSI +TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPM
Sbjct  85   LSCGACFEIKCANDPRWCHSGSPSIIITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPM  144

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI KV VKG+ 
Sbjct  145  FLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKVKVKGTN  204

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            T W+++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS NVAPANWQFGQTF GKNFR
Sbjct  205  TNWMSMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSLNVAPANWQFGQTFTGKNFR  263



>gb|AEQ55271.1| expansin [Breonia chinensis]
 gb|AEQ55286.1| expansin [Breonia chinensis]
Length=258

 Score =   415 bits (1067),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 198/242 (82%), Positives = 220/242 (91%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T V+ARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN  ALSTALFN
Sbjct  17   TVVNARIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTGALSTALFN  76

Query  543  NGLSCGACFEIKCSN-DRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFE+KC+N  + C PGNPSIF+TATNFCPPNFALPNDNGGWCNPPRPHFDLAM
Sbjct  77   NGLSCGACFELKCANAPKWCLPGNPSIFITATNFCPPNFALPNDNGGWCNPPRPHFDLAM  136

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPVN+RR+PCRK+GGIRFTVNGFRYFNL+L+TNVAGAG++ +  VKG
Sbjct  137  PMFLKIAEYRAGIVPVNYRRVPCRKRGGIRFTVNGFRYFNLILITNVAGAGNVIRASVKG  196

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            +RT W+ LSRNWGQNW+++A L+GQ+LSFRV ASD R  TSWNVAP NWQFGQTF GKNF
Sbjct  197  TRTQWLPLSRNWGQNWQSNAQLIGQALSFRVTASDGRTSTSWNVAPPNWQFGQTFLGKNF  256

Query  6    RA  1
            R 
Sbjct  257  RV  258



>gb|AEN70895.1| expansin [Gossypium mustelinum]
Length=259

 Score =   415 bits (1067),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 218/239 (91%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALSTALFNNGL
Sbjct  21   EARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGL  80

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR  FDLAMPMF
Sbjct  81   SCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTRFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI KV VKGSRT
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKVSVKGSRT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PA+WQFGQTF GKNFR 
Sbjct  201  GWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFRV  259



>ref|XP_006435550.1| hypothetical protein CICLE_v10032484mg [Citrus clementina]
 ref|XP_006486470.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|ESR48790.1| hypothetical protein CICLE_v10032484mg [Citrus clementina]
 gb|KDO69285.1| hypothetical protein CISIN_1g024916mg [Citrus sinensis]
Length=260

 Score =   415 bits (1067),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 198/241 (82%), Positives = 218/241 (90%), Gaps = 1/241 (0%)
 Frame = -3

Query  720  AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  541
            +V ARIPGVY G AWQ+AHATFYGG DASGTMGGACGYGNLYSQGYGVN AALSTALFNN
Sbjct  20   SVDARIPGVYGGEAWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNN  79

Query  540  GLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            GLSCGACFEIKC+ND + C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPRPHFDLAMP
Sbjct  80   GLSCGACFEIKCANDPQWCHAGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRPHFDLAMP  139

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLK+A YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL+TNVAGAGDI K  VKGS
Sbjct  140  MFLKMAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLITNVAGAGDIVKASVKGS  199

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            RT W++LSRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ PANWQFGQTF GKNFR
Sbjct  200  RTGWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIVPANWQFGQTFTGKNFR  259

Query  3    A  1
             
Sbjct  260  V  260



>gb|AAK48848.1|AF350939_1 expansin [Prunus cerasus]
Length=260

 Score =   415 bits (1067),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 195/238 (82%), Positives = 219/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY+G AW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+ AALSTALFNNGL
Sbjct  22   EARIPGVYTGDAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGL  81

Query  534  SCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMF
Sbjct  82   SCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMF  141

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVLV+NVAGAGDI +V VKGS+T
Sbjct  142  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVSNVAGAGDIVRVSVKGSKT  201

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A LVGQSLSFRVR SDRR  TSWN+ PANWQFGQTF GKNFR
Sbjct  202  GWMSMSRNWGQNWQSNAVLVGQSLSFRVRGSDRRTSTSWNIVPANWQFGQTFTGKNFR  259



>ref|NP_181300.1| expansin-A3 [Arabidopsis thaliana]
 ref|XP_004253297.1| PREDICTED: expansin-A3 [Solanum lycopersicum]
 sp|O80932.1|EXPA3_ARATH RecName: Full=Expansin-A3; Short=AtEXPA3; AltName: Full=Alpha-expansin-3; 
Short=At-EXP3; Short=AtEx3; AltName: Full=Ath-ExpAlpha-1.9; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC23634.1| putative expansin [Arabidopsis thaliana]
 gb|AAL91271.1| At2g37640/F13M22.14 [Arabidopsis thaliana]
 gb|AAM67431.1| At2g37640/F13M22.14 [Arabidopsis thaliana]
 gb|AEC09429.1| expansin-A3 [Arabidopsis thaliana]
Length=262

 Score =   415 bits (1067),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 199/241 (83%), Positives = 216/241 (90%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            TA +A+IPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  21   TATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  80

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG SCGACFEIKC++D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLAM
Sbjct  81   NGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLAM  140

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKI  YRAGIVPV++RR+PCRK GGIRFTVNGFRYFNLVLVTNVAGAGDI  V VKG
Sbjct  141  PMFLKIGLYRAGIVPVSYRRVPCRKIGGIRFTVNGFRYFNLVLVTNVAGAGDINGVSVKG  200

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W+ +SRNWGQNW+++A L+GQSLSFRV ASDRR  TSWNVAPA WQFGQTF GKNF
Sbjct  201  SKTDWVRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTSWNVAPATWQFGQTFSGKNF  260

Query  6    R  4
            R
Sbjct  261  R  261



>ref|XP_008384848.1| PREDICTED: expansin-A4 [Malus domestica]
Length=260

 Score =   415 bits (1067),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 194/238 (82%), Positives = 218/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  22   EARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  81

Query  534  SCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFE+KC+ D S C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMF
Sbjct  82   SCGACFELKCAEDPSWCHAGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMF  141

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI KV VKG+RT
Sbjct  142  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKVSVKGART  201

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ PA+WQFGQTF GKNFR
Sbjct  202  GWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFR  259



>ref|XP_008343537.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=261

 Score =   415 bits (1067),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 217/239 (91%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  22   VEARIPGVYTGGAWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  81

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNFA P+D+GGWCNPPR HFDLAMPM
Sbjct  82   LSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQPSDDGGWCNPPRTHFDLAMPM  141

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV++RR+PCRKQGGIRFT+NG +YFNLVL+ NVAGAGDI KV VKG+ 
Sbjct  142  FLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNLVLIHNVAGAGDIVKVYVKGTN  201

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            TPW++LSRNWGQNW+++A LVGQSLSFRV ASDRR  TSWN+ P+NWQFGQTF GKNFR
Sbjct  202  TPWMSLSRNWGQNWQSNAILVGQSLSFRVTASDRRTSTSWNIVPSNWQFGQTFTGKNFR  260



>ref|XP_010106493.1| hypothetical protein L484_025251 [Morus notabilis]
 gb|EXC10669.1| hypothetical protein L484_025251 [Morus notabilis]
Length=258

 Score =   415 bits (1066),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 193/238 (81%), Positives = 217/238 (91%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY+GG+W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGV+ AALSTALFNNGL
Sbjct  20   EARIPGVYTGGSWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGL  79

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC+ND + C  G+PSI +TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPMF
Sbjct  80   SCGACFEIKCANDPKWCHSGSPSILITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMF  139

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +  VKGS+T
Sbjct  140  LKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVRTSVKGSKT  199

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+ +SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PANWQFGQTF GKNFR
Sbjct  200  GWMLMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPANWQFGQTFTGKNFR  257



>ref|XP_008784594.1| PREDICTED: expansin-A4-like [Phoenix dactylifera]
Length=260

 Score =   415 bits (1066),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 196/241 (81%), Positives = 216/241 (90%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T   ARIPGVY+GG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN
Sbjct  19   TLADARIPGVYAGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFN  78

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            +GLSCGACFEIKC  + R C PG+PSI +TATNFCPPN+ALP+DNGGWCNPPRPHFDLAM
Sbjct  79   DGLSCGACFEIKCGEEPRWCHPGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAM  138

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV++RR+PCRK GGIRFT+NGF YFNLVL+TNVAGAGDI +V VKG
Sbjct  139  PMFLKIAQYRAGIVPVSYRRVPCRKAGGIRFTINGFEYFNLVLITNVAGAGDIVRVSVKG  198

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            SRT W+ +SRNWGQNW+++A LVGQSLSFRV ASDRR  TSWN+ PANWQFGQTF GKNF
Sbjct  199  SRTGWMPMSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTSWNIVPANWQFGQTFAGKNF  258

Query  6    R  4
            R
Sbjct  259  R  259



>ref|XP_009353647.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
 ref|XP_009349875.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
Length=260

 Score =   415 bits (1066),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 194/239 (81%), Positives = 218/239 (91%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  22   EARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  81

Query  534  SCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFE+KC++D S C  G PSIF+TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMF
Sbjct  82   SCGACFELKCADDPSWCHAGGPSIFITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMF  141

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +V VKGSRT
Sbjct  142  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVRVSVKGSRT  201

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ PA+WQFGQTF GKNFR 
Sbjct  202  DWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFRV  260



>ref|NP_001234761.1| expansin18 precursor [Solanum lycopersicum]
 emb|CAA06271.2| expansin18 [Solanum lycopersicum]
Length=260

 Score =   415 bits (1066),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 216/239 (90%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGV++ GAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNN ALSTALFNNGL
Sbjct  22   EARIPGVFTAGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNGALSTALFNNGL  81

Query  534  SCGACFEIKCSN-DRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC N  + C PG+PSIF+TATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF
Sbjct  82   SCGACFEIKCDNYPQWCHPGSPSIFITATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  141

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            L IA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI  + +KGS+T
Sbjct  142  LHIAEYRAGIVPVVYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVSLSIKGSKT  201

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             WI++SRNWGQNW+T++ L GQSLSFRVRA DRR  TSWN+ PA+WQFGQTF GKNFR 
Sbjct  202  NWISMSRNWGQNWQTNSVLFGQSLSFRVRAGDRRSSTSWNITPAHWQFGQTFVGKNFRV  260



>ref|XP_004143121.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004166197.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN47143.1| hypothetical protein Csa_6G190340 [Cucumis sativus]
Length=258

 Score =   415 bits (1066),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 218/240 (91%), Gaps = 1/240 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            + ARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN G
Sbjct  19   IEARIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNKG  78

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
             SCGACFEIKC+ND R C  G+PSI +TATNFCPPN+ALPNDNGGWCNPPR HFDLAMPM
Sbjct  79   QSCGACFEIKCANDPRWCHSGSPSILITATNFCPPNYALPNDNGGWCNPPRSHFDLAMPM  138

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI +V VKG+R
Sbjct  139  FLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVRVSVKGTR  198

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            T W++L+RNWGQNW+++A LVGQ+LSFRV  SDRR  TSWN+APA+WQFGQTF GKNFR 
Sbjct  199  TGWMSLTRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNIAPAHWQFGQTFTGKNFRV  258



>emb|CDY31742.1| BnaA04g16780D [Brassica napus]
Length=260

 Score =   415 bits (1066),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 194/241 (80%), Positives = 221/241 (92%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T   ARIPGVYSGG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  19   TISEARIPGVYSGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  78

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPRPHFDLAM
Sbjct  79   NGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRPHFDLAM  138

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVLVTNVAGAG+I ++ VKG
Sbjct  139  PMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLVTNVAGAGNIVRLSVKG  198

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            +RT W+++SRNWGQNW++++ LVGQ+LSFRV ASDRR  TSWN+APA+WQFGQTF GKNF
Sbjct  199  TRTSWMSMSRNWGQNWQSNSVLVGQALSFRVTASDRRSSTSWNIAPAHWQFGQTFMGKNF  258

Query  6    R  4
            R
Sbjct  259  R  259



>ref|XP_010067412.1| PREDICTED: expansin-A4 [Eucalyptus grandis]
Length=307

 Score =   416 bits (1070),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 195/242 (81%), Positives = 218/242 (90%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T   ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  66   TLAEARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  125

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG SCGACFEIKC+N+ + C  G+PSI VTATNFCPPN+ALPNDNGGWCNPPRPHFDLAM
Sbjct  126  NGFSCGACFEIKCANEPQWCHSGSPSILVTATNFCPPNYALPNDNGGWCNPPRPHFDLAM  185

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI K+ VKG
Sbjct  186  PMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDINKLWVKG  245

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W+++SRNWGQNW++++ L GQSLSFRV A DRR  TSWN+ P+NWQFGQTF GKNF
Sbjct  246  SKTGWMSMSRNWGQNWQSNSVLAGQSLSFRVTAGDRRTSTSWNIVPSNWQFGQTFTGKNF  305

Query  6    RA  1
            R 
Sbjct  306  RV  307



>ref|XP_010043542.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
 ref|XP_010043543.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
 gb|KCW85556.1| hypothetical protein EUGRSUZ_B02355 [Eucalyptus grandis]
Length=260

 Score =   415 bits (1066),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 196/238 (82%), Positives = 218/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  22   DARIPGVYSGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  81

Query  534  SCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC+ND + C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMF
Sbjct  82   SCGACFEIKCANDPTWCHSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMF  141

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVL++NVAGAGDI +V VKG+RT
Sbjct  142  LKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLISNVAGAGDIVRVSVKGART  201

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A L GQ+LSFRV ASDRR  TSWN+ PA WQFGQTF GKNFR
Sbjct  202  GWMSMSRNWGQNWQSNAVLAGQALSFRVTASDRRSSTSWNMVPAGWQFGQTFTGKNFR  259



>emb|CDP06606.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   414 bits (1065),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 196/241 (81%), Positives = 220/241 (91%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T V+AR+PG YSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  17   TVVNARLPGAYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  76

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            +GLSCGACFE+KC++D + C PG+PSIF+TATNFCPPNFALPNDNGGWCNPPRPHFDLAM
Sbjct  77   DGLSCGACFELKCADDPKWCLPGSPSIFITATNFCPPNFALPNDNGGWCNPPRPHFDLAM  136

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPVNFRR+PCRK+GGIRFTV+GFRYFNLVL+TNVAGAG++ +  VKG
Sbjct  137  PMFLKIAQYRAGIVPVNFRRVPCRKRGGIRFTVDGFRYFNLVLITNVAGAGNVMRASVKG  196

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            +RT W+ LSRNWGQNW+++A L GQ+LSFRV  SDRR  TSWNVAP NWQFGQTF GKNF
Sbjct  197  TRTQWLPLSRNWGQNWQSNAQLAGQALSFRVTTSDRRTSTSWNVAPPNWQFGQTFVGKNF  256

Query  6    R  4
            R
Sbjct  257  R  257



>ref|XP_010111457.1| hypothetical protein L484_021280 [Morus notabilis]
 gb|EXC30980.1| hypothetical protein L484_021280 [Morus notabilis]
Length=263

 Score =   414 bits (1065),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 196/238 (82%), Positives = 219/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARI GVY+G  W +AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  25   DARIGGVYTGSPWDSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  84

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCG+CFE+KC  D + C PG+PSIF+TATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF
Sbjct  85   SCGSCFELKCDGDPKWCHPGSPSIFITATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  144

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAG+I +V VKGS+T
Sbjct  145  LKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGNIVQVGVKGSKT  204

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A LVGQ+LSFRVRASDRR  TSWN+APANWQFGQTF GKNFR
Sbjct  205  GWLSMSRNWGQNWQSNAVLVGQALSFRVRASDRRSSTSWNIAPANWQFGQTFTGKNFR  262



>emb|CDX77222.1| BnaC04g40170D [Brassica napus]
Length=260

 Score =   414 bits (1065),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 194/242 (80%), Positives = 220/242 (91%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T   ARIPGVYSGG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  19   TISEARIPGVYSGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  78

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPRPHFDLAM
Sbjct  79   NGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRPHFDLAM  138

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVLVTNVAGAG+I ++ VKG
Sbjct  139  PMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLVTNVAGAGNIVRLSVKG  198

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            +RT WI++SRNWGQNW++++ LVGQ+LSFRV ASDRR  TSWN+AP +WQFGQTF GKNF
Sbjct  199  TRTSWISMSRNWGQNWQSNSVLVGQALSFRVTASDRRSSTSWNIAPTHWQFGQTFMGKNF  258

Query  6    RA  1
            R 
Sbjct  259  RV  260



>gb|KJB78839.1| hypothetical protein B456_013G022200 [Gossypium raimondii]
Length=258

 Score =   414 bits (1064),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 196/242 (81%), Positives = 217/242 (90%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
              V ARIPGVYS GAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  17   VTVEARIPGVYSDGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  76

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG SCGACFEIKC N  + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR HFDLAM
Sbjct  77   NGFSCGACFEIKCVNQPQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRSHFDLAM  136

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL+TNVAG+GDI K  VKG
Sbjct  137  PMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLITNVAGSGDIVKASVKG  196

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+AP+NWQFGQTF GKNF
Sbjct  197  SKTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIAPSNWQFGQTFTGKNF  256

Query  6    RA  1
            R 
Sbjct  257  RV  258



>ref|XP_008464122.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=258

 Score =   414 bits (1064),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 217/240 (90%), Gaps = 1/240 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            + ARIPGVYSGG WQ+AHATFYGGADASGTMGGACGYGNLYSQGYGVN AALSTALFN G
Sbjct  19   IDARIPGVYSGGPWQSAHATFYGGADASGTMGGACGYGNLYSQGYGVNTAALSTALFNKG  78

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
             SCGACFEIKC+ND R C  G+PSI +TATNFCPPN+ALPNDNGGWCNPPR HFDLAMPM
Sbjct  79   QSCGACFEIKCANDPRWCHSGSPSILITATNFCPPNYALPNDNGGWCNPPRSHFDLAMPM  138

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI +V VKG+R
Sbjct  139  FLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVRVSVKGTR  198

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            T W++L+RNWGQNW+++A LVGQ+LSFRV  SDRR  TSWN+ PA+WQFGQTF GKNFR 
Sbjct  199  TGWMSLTRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFRV  258



>emb|CBI16120.3| unnamed protein product [Vitis vinifera]
Length=277

 Score =   414 bits (1065),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 194/238 (82%), Positives = 217/238 (91%), Gaps = 1/238 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            + V A+IPG YSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  17   SLVQAKIPGAYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  76

Query  543  NGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFE+KC+ND + C  G+PSI +TATNFCPPN+ALP+DNGGWCNPPRPHFDLAM
Sbjct  77   NGLSCGACFELKCANDPTWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAM  136

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV FRR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI +  VKG
Sbjct  137  PMFLKIAEYRAGIVPVAFRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVRASVKG  196

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGK  13
            S+T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+APA+WQFGQTF GK
Sbjct  197  SKTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIAPAHWQFGQTFSGK  254



>gb|KEH39447.1| expansin A10 [Medicago truncatula]
Length=260

 Score =   414 bits (1063),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 218/240 (91%), Gaps = 1/240 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V ARIPGVY+GGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  21   VDARIPGVYNGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  80

Query  537  LSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCG+CFE+KC+ND+  C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPM
Sbjct  81   LSCGSCFELKCANDKQWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPM  140

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV FRR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +  VKG++
Sbjct  141  FLKIAEYRAGIVPVAFRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVRTYVKGTQ  200

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            T W+ +SRNWGQNW++++ LVGQ+LSFRV  SDRR  TSWN+AP NWQFGQTF GKNFR 
Sbjct  201  TGWMPMSRNWGQNWQSNSVLVGQALSFRVTGSDRRTSTSWNIAPHNWQFGQTFTGKNFRV  260



>ref|XP_004492358.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=258

 Score =   414 bits (1063),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 196/241 (81%), Positives = 215/241 (89%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
             A  ARIPG YSGG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  17   VATTARIPGFYSGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  76

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCG+CFEIKC  D R C+PGNPSI +TATNFCPPNFA P+DNGGWCNPPRPHFDLAM
Sbjct  77   NGLSCGSCFEIKCDQDPRWCNPGNPSILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAM  136

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL+TNVAGAGDI +V VKG
Sbjct  137  PMFLKIAQYRAGIVPVAYRRVPCRKKGGIRFTINGFRYFNLVLITNVAGAGDIIRVSVKG  196

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            + T W+++SRNWGQNW+++A  VGQ+LSFRV  SDRR  TSWNVAP NWQFGQTF GKNF
Sbjct  197  TNTAWMSMSRNWGQNWQSNAVFVGQALSFRVTGSDRRTSTSWNVAPPNWQFGQTFSGKNF  256

Query  6    R  4
            R
Sbjct  257  R  257



>ref|XP_006410954.1| hypothetical protein EUTSA_v10017095mg [Eutrema salsugineum]
 dbj|BAJ34443.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52407.1| hypothetical protein EUTSA_v10017095mg [Eutrema salsugineum]
Length=263

 Score =   414 bits (1063),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 216/240 (90%), Gaps = 1/240 (0%)
 Frame = -3

Query  720  AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  541
            A +A+IPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNN
Sbjct  23   ATNAKIPGVYTGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNN  82

Query  540  GLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            G SCGACFEIKC++D R C PGNPSIFVTATNFCPPNFA P+D+GGWCNPPR HFDLAMP
Sbjct  83   GFSCGACFEIKCTDDPRWCVPGNPSIFVTATNFCPPNFAQPSDDGGWCNPPREHFDLAMP  142

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLKI  YRAGIVPV++RR+PCRK GGIRFTVNGFRYFNLVL+TNVAGAGDI  V VKGS
Sbjct  143  MFLKIGLYRAGIVPVSYRRVPCRKLGGIRFTVNGFRYFNLVLITNVAGAGDITGVSVKGS  202

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            +T W+ +SRNWGQNW+++A L+GQSLSFRV ASDRR  TSWNVAPA WQFGQTF GKNFR
Sbjct  203  KTDWVRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTSWNVAPATWQFGQTFSGKNFR  262



>ref|XP_008802710.1| PREDICTED: expansin-A4 [Phoenix dactylifera]
Length=258

 Score =   413 bits (1062),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 193/237 (81%), Positives = 218/237 (92%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPGVYSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV+ AALSTALFN+GLS
Sbjct  21   ARIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVDTAALSTALFNDGLS  80

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFEIKC+++ + C  G+PSIF+TATNFCPPN+ALP+D+GGWCNPPRPHFDLAMPMFL
Sbjct  81   CGACFEIKCADEPQWCHSGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLAMPMFL  140

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+TNVAGAGDI +  VKGSRT 
Sbjct  141  KIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFKYFNLVLITNVAGAGDIMRASVKGSRTG  200

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W+ LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PANWQFGQTF GKNFR
Sbjct  201  WMPLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPANWQFGQTFAGKNFR  257



>ref|XP_009349313.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
Length=260

 Score =   413 bits (1062),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 193/238 (81%), Positives = 218/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  22   EARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  81

Query  534  SCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFE+KC++D S C  G PSIF+TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMF
Sbjct  82   SCGACFELKCADDPSWCHAGGPSIFITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMF  141

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +V VKG+RT
Sbjct  142  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVRVSVKGART  201

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ PA+WQFGQTF GKNFR
Sbjct  202  DWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFR  259



>ref|XP_011027216.1| PREDICTED: expansin-A4 [Populus euphratica]
Length=258

 Score =   413 bits (1061),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 194/242 (80%), Positives = 218/242 (90%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  17   TLVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  76

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            +GLSCGACFEIKC ND + C  G+PSI +TATNFCPPN+ALP+DNGGWCNPPRPHFDLAM
Sbjct  77   SGLSCGACFEIKCGNDPQWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAM  136

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV++RR+PCRK+GGIRF +NG RYFNLVL+TNVAGAGDI KV VKG
Sbjct  137  PMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFQINGHRYFNLVLITNVAGAGDIVKVSVKG  196

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWNV P+NWQF QTF GKNF
Sbjct  197  SKTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNVVPSNWQFSQTFVGKNF  256

Query  6    RA  1
            R 
Sbjct  257  RV  258



>ref|XP_002881524.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002881525.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57783.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57784.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   413 bits (1061),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 198/241 (82%), Positives = 216/241 (90%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            TA +A+IPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  21   TASNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  80

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG SCGACFEIKC++D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLAM
Sbjct  81   NGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLAM  140

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKI  YRAGIVPV++RR+PCRK GGIRFTVNGFRYFNLVLVTNVAGAGDI  V VKG
Sbjct  141  PMFLKIGLYRAGIVPVSYRRVPCRKIGGIRFTVNGFRYFNLVLVTNVAGAGDINGVSVKG  200

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W+ +SRNWGQNW+++A L+GQSLSFRV ASDRR  TSWNVAP+ WQFGQTF GKNF
Sbjct  201  SKTDWVRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTSWNVAPSTWQFGQTFSGKNF  260

Query  6    R  4
            R
Sbjct  261  R  261



>ref|XP_010690765.1| PREDICTED: expansin-A4 [Beta vulgaris subsp. vulgaris]
Length=258

 Score =   413 bits (1061),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 194/242 (80%), Positives = 220/242 (91%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            + +HAR PGVYS G WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  17   SLIHARYPGVYSRGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  76

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            +G SCGACFE+KC++D R C PG+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAM
Sbjct  77   SGQSCGACFELKCADDPRWCHPGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAM  136

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV FRR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGD+  V VKG
Sbjct  137  PMFLKIAEYRAGIVPVAFRRVPCRKKGGIRFTINGFRYFNLVLISNVAGAGDLVSVSVKG  196

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            SRT W++LSRNWGQNW+++A LVGQSLSFRV ASDRR  TS N+AP+NWQFGQTF G+NF
Sbjct  197  SRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTSLNIAPSNWQFGQTFIGRNF  256

Query  6    RA  1
            R 
Sbjct  257  RV  258



>ref|XP_009772489.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=257

 Score =   412 bits (1060),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 188/240 (78%), Positives = 219/240 (91%), Gaps = 0/240 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            TA +A++PGVY+GG WQ+AHATFYGG DASGTMGGACGYGNLYS GYGVNNAALSTALFN
Sbjct  17   TAANAKVPGVYTGGPWQSAHATFYGGEDASGTMGGACGYGNLYSAGYGVNNAALSTALFN  76

Query  543  NGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            NGLSCGACFEI+C++ + C+PGNPSIFVT TNFCPPN+ALPNDNGGWCNPPRPHFDLA P
Sbjct  77   NGLSCGACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNYALPNDNGGWCNPPRPHFDLAEP  136

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLK A YRAGIVPV +RR+PC+K GGIRFT+NGF YFN+V+VTNVAGAGDIQKV VKG+
Sbjct  137  MFLKFAQYRAGIVPVTYRRVPCKKSGGIRFTINGFNYFNMVIVTNVAGAGDIQKVFVKGT  196

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             T W+ +SRNWGQNW+++A LVGQ+LSF+V+ASD R VT++NVAP+NWQFGQT++ KNFR
Sbjct  197  NTKWMAMSRNWGQNWQSNAQLVGQALSFKVKASDHRYVTTYNVAPSNWQFGQTYEAKNFR  256



>ref|XP_011031225.1| PREDICTED: expansin-A4-like [Populus euphratica]
Length=258

 Score =   412 bits (1060),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 195/238 (82%), Positives = 217/238 (91%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY+G AWQ+AHATFYGG DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  20   EARIPGVYTGAAWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  79

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC+N+ + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  80   SCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  139

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK GGIRFT+NG RYFNLVL+TNVAGAGDI KV VKGSRT
Sbjct  140  LKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGHRYFNLVLITNVAGAGDIVKVSVKGSRT  199

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWNV P+NWQFGQTF GKNFR
Sbjct  200  GWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNVVPSNWQFGQTFAGKNFR  257



>ref|XP_010521846.1| PREDICTED: expansin-A6 [Tarenaya hassleriana]
Length=259

 Score =   412 bits (1060),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 193/239 (81%), Positives = 217/239 (91%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG 
Sbjct  21   EARIPGVYGGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGF  80

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
             CGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  81   RCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVLVTNVAGAGD+ +V VKGSRT
Sbjct  141  LKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGDVVRVSVKGSRT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+AP++WQFGQTF GKNFR 
Sbjct  201  GWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRSSTSWNIAPSHWQFGQTFVGKNFRV  259



>ref|XP_010517036.1| PREDICTED: expansin-A3 [Camelina sativa]
Length=262

 Score =   412 bits (1060),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 198/242 (82%), Positives = 216/242 (89%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            TA +A+IPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  21   TATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  80

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG SCGACFEIKC++D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLAM
Sbjct  81   NGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLAM  140

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKI  YRAGIVPV++RR+PCRK GGIRFTVNGFRYFNLVLVTNVAGAGDI  V VKG
Sbjct  141  PMFLKIGLYRAGIVPVSYRRVPCRKIGGIRFTVNGFRYFNLVLVTNVAGAGDINGVSVKG  200

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W+ +SRNWGQNW+++A L+GQSLSFRV ASDRR  TSWNVAP +WQFGQTF GKNF
Sbjct  201  SKTDWVRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTSWNVAPPSWQFGQTFSGKNF  260

Query  6    RA  1
            R 
Sbjct  261  RV  262



>ref|XP_002312101.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
 gb|EEE89468.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
Length=258

 Score =   412 bits (1060),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 195/238 (82%), Positives = 217/238 (91%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY+G AWQ+AHATFYGG DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  20   EARIPGVYTGAAWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  79

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC+N+ + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  80   SCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  139

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK GGIRFT+NG RYFNLVL+TNVAGAGDI KV VKGSRT
Sbjct  140  LKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGHRYFNLVLITNVAGAGDIVKVSVKGSRT  199

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWNV P+NWQFGQTF GKNFR
Sbjct  200  GWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNVVPSNWQFGQTFAGKNFR  257



>ref|XP_002315218.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
 gb|EEF01389.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
Length=258

 Score =   412 bits (1059),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 194/242 (80%), Positives = 218/242 (90%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  17   TLVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  76

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFEIKC ND + C  G+PSI +TATNFCPPN+ALP+DNGGWCNPPRPHFDLAM
Sbjct  77   NGLSCGACFEIKCGNDPQWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAM  136

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            P+FLKIA YRAGIVPV++RR+PCRK+GGIRF +NG RYFNLVL+TNVAGAGDI KV VKG
Sbjct  137  PVFLKIAEYRAGIVPVSYRRVPCRKRGGIRFQINGHRYFNLVLITNVAGAGDIVKVSVKG  196

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWNV P+NWQF QTF GKNF
Sbjct  197  SKTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNVVPSNWQFSQTFVGKNF  256

Query  6    RA  1
            R 
Sbjct  257  RV  258



>ref|XP_010505357.1| PREDICTED: expansin-A3-like [Camelina sativa]
Length=262

 Score =   412 bits (1058),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 197/242 (81%), Positives = 216/242 (89%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            TA +A+IPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  21   TATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  80

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG SCGACFEIKC++D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLAM
Sbjct  81   NGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLAM  140

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKI  YRAGIVPV++RR+PCRK GGIRFTVNGFRYFNLVLVTNVAGAGDI  V VKG
Sbjct  141  PMFLKIGLYRAGIVPVSYRRVPCRKIGGIRFTVNGFRYFNLVLVTNVAGAGDINGVSVKG  200

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            ++T W+ +SRNWGQNW+++A L+GQSLSFRV ASDRR  TSWNVAP +WQFGQTF GKNF
Sbjct  201  TKTEWVRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTSWNVAPPSWQFGQTFSGKNF  260

Query  6    RA  1
            R 
Sbjct  261  RV  262



>ref|XP_007150329.1| hypothetical protein PHAVU_005G144500g [Phaseolus vulgaris]
 gb|ESW22323.1| hypothetical protein PHAVU_005G144500g [Phaseolus vulgaris]
Length=256

 Score =   411 bits (1057),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 192/239 (80%), Positives = 216/239 (90%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  17   VDARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  76

Query  537  LSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPM
Sbjct  77   LSCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPM  136

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV +RR+ C K GGIRFT+NGFRYFNLVL++NVAGAGD+    VKG+R
Sbjct  137  FLKIAEYRAGIVPVAYRRVACMKHGGIRFTINGFRYFNLVLISNVAGAGDLVHAYVKGTR  196

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            + W+ +SRNWGQNW+++A LVGQ+LSFRV ASDRR  TSWN+AP +WQFGQTF GKNFR
Sbjct  197  SGWMPMSRNWGQNWQSNAVLVGQALSFRVTASDRRSSTSWNIAPPHWQFGQTFTGKNFR  255



>gb|KFK32246.1| hypothetical protein AALP_AA6G217100 [Arabis alpina]
Length=257

 Score =   411 bits (1056),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 191/240 (80%), Positives = 219/240 (91%), Gaps = 1/240 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
              ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  18   TEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  77

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
             SCGACFE+KC++D + C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPM
Sbjct  78   YSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPM  137

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVLVTNVAGAG+I ++ VKG+R
Sbjct  138  FLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLVTNVAGAGNIVRLSVKGTR  197

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            T W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+APA+WQFGQTF GKNFR 
Sbjct  198  TSWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIAPAHWQFGQTFMGKNFRV  257



>gb|EYU41729.1| hypothetical protein MIMGU_mgv1a012073mg [Erythranthe guttata]
Length=262

 Score =   411 bits (1056),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 197/243 (81%), Positives = 217/243 (89%), Gaps = 3/243 (1%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T+  ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  19   TSAQARIPGVYAGGPWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  78

Query  543  NGLSCGACFEIKCS---NDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  373
            NGLSCGACFEIKC    + + C+PG+PSI VTATNFCPPNFALPNDNGGWCNPPR HFDL
Sbjct  79   NGLSCGACFEIKCDAAQDSKWCNPGSPSILVTATNFCPPNFALPNDNGGWCNPPRTHFDL  138

Query  372  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  193
            AMPMFLKIA YRAGIVPVNFRRIPCRKQGG+RFT+NGFRYFNLVLVTNVAGAGDI +V +
Sbjct  139  AMPMFLKIAQYRAGIVPVNFRRIPCRKQGGMRFTINGFRYFNLVLVTNVAGAGDIVRVSI  198

Query  192  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGK  13
            KG+ T WI++SRNWGQNW+++A LVGQ+LSFRV A DRR  TS NVAP +WQFGQTF  K
Sbjct  199  KGTNTQWISMSRNWGQNWQSNAVLVGQALSFRVTAGDRRTSTSINVAPPHWQFGQTFTAK  258

Query  12   NFR  4
            NFR
Sbjct  259  NFR  261



>ref|XP_009409516.1| PREDICTED: expansin-A6-like [Musa acuminata subsp. malaccensis]
Length=261

 Score =   411 bits (1056),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 192/237 (81%), Positives = 215/237 (91%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPGVY+GG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTAL+N+GL 
Sbjct  24   ARIPGVYTGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALYNDGLR  83

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFEIKC++D R C  GNPSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFL
Sbjct  84   CGACFEIKCADDPRWCKGGNPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFL  143

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV+FRR+PCRK GGIRFT+NGF+YFNLVL+TNVAGAGDI +  VKG+R+ 
Sbjct  144  KIAEYRAGIVPVSFRRVPCRKSGGIRFTINGFQYFNLVLITNVAGAGDIVRASVKGTRSG  203

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            WI +SRNWGQNW+++A LVGQSLSFRV  SD R  TSWN+APA+WQFGQTF GKNFR
Sbjct  204  WIAMSRNWGQNWQSNAVLVGQSLSFRVTGSDHRTSTSWNIAPASWQFGQTFSGKNFR  260



>ref|XP_002881024.1| ATEXPA6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57283.1| ATEXPA6 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   410 bits (1055),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 192/239 (80%), Positives = 217/239 (91%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG 
Sbjct  19   EARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGF  78

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFE+KC++D R C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMF
Sbjct  79   SCGACFELKCASDPRWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMF  138

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV+FRR+PCRK+GGIRFT+NGFRYFNLVLVTNVAG G+I ++ VKG+ T
Sbjct  139  LKIAEYRAGIVPVSFRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGVGNIVRLGVKGTHT  198

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+APANWQFGQTF GKNFR 
Sbjct  199  SWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRSSTSWNIAPANWQFGQTFMGKNFRV  257



>ref|XP_009357738.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
 ref|XP_009357739.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=261

 Score =   411 bits (1056),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 193/239 (81%), Positives = 215/239 (90%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  22   VDARIPGVYTGGAWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  81

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPR HFDLAMPM
Sbjct  82   LSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRTHFDLAMPM  141

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV++RR+PCRKQGGIRFT+NG +YFNLVL+ NVAGAGDI K  VKG+ 
Sbjct  142  FLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNLVLIHNVAGAGDIVKAYVKGTN  201

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            TPW++LSRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ P+NWQFGQTF GKNFR
Sbjct  202  TPWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQTFTGKNFR  260



>gb|ABO32367.1| expansin [Litchi chinensis]
Length=256

 Score =   410 bits (1055),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 217/239 (91%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
            +A+IPGVY+GG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  18   NAKIPGVYTGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  77

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFE+KC  D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLAMPMF
Sbjct  78   SCGACFELKCVADPRWCLPGNPSILVTATNFCPPNFAQPSDDGGWCNPPRTHFDLAMPMF  137

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI KV VKGS+T
Sbjct  138  LKIAQYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKVSVKGSKT  197

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+T+SRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWNVA +NWQFGQTF GKNFR 
Sbjct  198  GWLTMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNVAKSNWQFGQTFVGKNFRV  256



>gb|KHG24991.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=260

 Score =   410 bits (1055),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 192/238 (81%), Positives = 217/238 (91%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG 
Sbjct  22   EARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGF  81

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  82   SCGACFEIKCASDPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  141

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAG+G+I K  VKGSRT
Sbjct  142  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGSGNIVKASVKGSRT  201

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++  LVGQSLSFRV  SDRR  TSWN+ PA+WQFGQTF GKNFR
Sbjct  202  GWMSMSRNWGQNWQSNVVLVGQSLSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFR  259



>gb|AAP48989.1| expansin [Sambucus nigra]
Length=256

 Score =   410 bits (1054),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 193/241 (80%), Positives = 215/241 (89%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            + V ARIPG Y GGAW++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  15   SVVEARIPGNYGGGAWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  74

Query  543  NGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
             G SCGACFEIKC+ND + C  G+PSI VTATNFCPPN+ALPNDNGGWCNPPR HFDLAM
Sbjct  75   KGESCGACFEIKCANDPNWCHSGSPSIMVTATNFCPPNYALPNDNGGWCNPPRTHFDLAM  134

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV +RR+PCRKQGG+RFT+NGFRYFNLVL++NVAGAGDI +V VKG
Sbjct  135  PMFLKIAEYRAGIVPVAYRRVPCRKQGGVRFTINGFRYFNLVLISNVAGAGDIVRVSVKG  194

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            SRT W+++SRNWGQNW+++  LVGQSLSFRV  SDRR  TSWN+ PANWQFGQTF GKNF
Sbjct  195  SRTGWMSMSRNWGQNWQSNTVLVGQSLSFRVTGSDRRTSTSWNIVPANWQFGQTFTGKNF  254

Query  6    R  4
            R
Sbjct  255  R  255



>ref|XP_006409928.1| hypothetical protein EUTSA_v10017116mg [Eutrema salsugineum]
 gb|ESQ51381.1| hypothetical protein EUTSA_v10017116mg [Eutrema salsugineum]
Length=260

 Score =   410 bits (1054),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 192/243 (79%), Positives = 223/243 (92%), Gaps = 2/243 (1%)
 Frame = -3

Query  723  TAVH-ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALF  547
            TA++ ARIPGVY+GG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALF
Sbjct  18   TAIYEARIPGVYNGGGWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALF  77

Query  546  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLA  370
            NNG SCGACFE+KC++D + C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPRPHFDLA
Sbjct  78   NNGFSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHFDLA  137

Query  369  MPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVK  190
            MPMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVLVTNVAGAG+I ++ VK
Sbjct  138  MPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLVTNVAGAGNIVRLSVK  197

Query  189  GSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKN  10
            G+RT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+APA+WQFGQTF GKN
Sbjct  198  GTRTSWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIAPAHWQFGQTFMGKN  257

Query  9    FRA  1
            FR 
Sbjct  258  FRV  260



>emb|CAA04385.1| Expansin [Brassica napus]
Length=260

 Score =   410 bits (1054),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 191/242 (79%), Positives = 219/242 (90%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T   ARIPGVYSGG W+TAHATFYGG+DASGTMG ACGYGNLY++GYGVN AALSTALFN
Sbjct  19   TISEARIPGVYSGGGWETAHATFYGGSDASGTMGSACGYGNLYTKGYGVNTAALSTALFN  78

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPRPHFDLAM
Sbjct  79   NGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRPHFDLAM  138

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVLVTNVAGAG+I ++ VKG
Sbjct  139  PMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLVTNVAGAGNIVRLSVKG  198

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            +RT WI++SRNWGQNW++++ LVGQ+LSFRV ASDRR  TSWN+AP +WQFGQTF GKNF
Sbjct  199  TRTSWISMSRNWGQNWQSNSVLVGQALSFRVTASDRRSSTSWNIAPTHWQFGQTFMGKNF  258

Query  6    RA  1
            R 
Sbjct  259  RV  260



>ref|XP_008357089.1| PREDICTED: expansin-A6 [Malus domestica]
Length=260

 Score =   410 bits (1054),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 194/239 (81%), Positives = 215/239 (90%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY+GGAWQ AHATFYGG+DASGTM GACGYGNLYSQGYGVN  ALSTALFNNGL
Sbjct  22   EARIPGVYTGGAWQGAHATFYGGSDASGTMXGACGYGNLYSQGYGVNTGALSTALFNNGL  81

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKCSND R C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMF
Sbjct  82   SCGACFEIKCSNDPRWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMF  141

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +V VKG+ T
Sbjct  142  LKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVRVSVKGAGT  201

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ PANWQFGQTF GKNFR 
Sbjct  202  GWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIVPANWQFGQTFTGKNFRV  260



>gb|ABK93541.1| unknown [Populus trichocarpa]
Length=258

 Score =   410 bits (1053),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 194/238 (82%), Positives = 216/238 (91%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY+G AWQ+AHATFYGG DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  20   EARIPGVYTGAAWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  79

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC+N+ + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  80   SCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  139

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK GGIRFT+NG RYFNLVL+TNVAGAGDI KV VKG RT
Sbjct  140  LKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGHRYFNLVLITNVAGAGDIVKVSVKGCRT  199

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWNV P+NWQFGQTF GKNFR
Sbjct  200  GWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNVVPSNWQFGQTFAGKNFR  257



>ref|XP_009380637.1| PREDICTED: expansin-A4 [Musa acuminata subsp. malaccensis]
Length=262

 Score =   410 bits (1054),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 191/238 (80%), Positives = 215/238 (90%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN+GL
Sbjct  24   DARIPGVYTGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNDGL  83

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC++D R C  G+PSIF+TATNFCPPN+ALP+D+GGWCNPPRPHFDLAMPMF
Sbjct  84   SCGACFEIKCADDPRWCKGGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLAMPMF  143

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+TNVAGAGDI +  VKGSRT
Sbjct  144  LKIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFQYFNLVLITNVAGAGDIIRATVKGSRT  203

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+ +SRNWGQNW+++A LVGQSLSFRV  SD R  TSWN+APA WQFGQTF GKNFR
Sbjct  204  GWMPMSRNWGQNWQSNAALVGQSLSFRVTGSDHRTSTSWNIAPATWQFGQTFSGKNFR  261



>gb|KHN17924.1| Expansin-A3 [Glycine soja]
Length=307

 Score =   412 bits (1058),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 190/233 (82%), Positives = 215/233 (92%), Gaps = 1/233 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             A+IPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG 
Sbjct  20   QAKIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGF  79

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC++D + C PGNPSIFVTATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  80   SCGACFEIKCTDDPKWCHPGNPSIFVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  139

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GG+RFT+NGFRYFNLVL+TNVAGAGDI +  VKGS+T
Sbjct  140  LKIAQYRAGIVPVSYRRVPCRKEGGMRFTINGFRYFNLVLITNVAGAGDIMRASVKGSKT  199

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQ  19
             W+++SRNWGQNW+++A LVGQSLSFRV ASDRR  TSWN+ PANWQFGQT +
Sbjct  200  EWMSMSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTSWNIVPANWQFGQTLE  252



>ref|XP_009610453.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=257

 Score =   409 bits (1052),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 186/240 (78%), Positives = 218/240 (91%), Gaps = 0/240 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T  +A++PGVY+ G W++AHATFYGGADASGTMGGACGYGNLYS GYGVNNAALSTALFN
Sbjct  17   TGANAKVPGVYTSGPWESAHATFYGGADASGTMGGACGYGNLYSAGYGVNNAALSTALFN  76

Query  543  NGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            NGLSCGACFEI+C++ + C+PGNPSIFVT TNFCPPN+ALPNDNGGWCNPPRPHFDLA P
Sbjct  77   NGLSCGACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNYALPNDNGGWCNPPRPHFDLAEP  136

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLK A YRAGIVPV +RR+PC+K GGIRFT+NGF YFN+V+VTNVAGAGDIQKV VKG+
Sbjct  137  MFLKFAQYRAGIVPVTYRRVPCKKSGGIRFTINGFNYFNMVIVTNVAGAGDIQKVFVKGT  196

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             T W+ +SRNWGQNW+++A LVGQ+LSF+V+ASD R VT++NVAP+NWQFGQT++ KNFR
Sbjct  197  NTKWMAMSRNWGQNWQSNAQLVGQALSFKVKASDHRYVTTYNVAPSNWQFGQTYEAKNFR  256



>ref|XP_010033123.1| PREDICTED: expansin-A4 [Eucalyptus grandis]
 gb|KCW52678.1| hypothetical protein EUGRSUZ_J02048 [Eucalyptus grandis]
Length=263

 Score =   410 bits (1053),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 192/238 (81%), Positives = 215/238 (90%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPG+Y+GG WQ+AHATFYGGADASGTMGGACGYGNLYSQGYGVN AALSTALFNNG 
Sbjct  25   EARIPGIYTGGPWQSAHATFYGGADASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGF  84

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC+ND + C  G+ SIFVTATNFCPPN+A P+DNGGWCNPPRPHFDLAMPMF
Sbjct  85   SCGACFEIKCANDPQWCHSGSSSIFVTATNFCPPNYAQPSDNGGWCNPPRPHFDLAMPMF  144

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +V VKGSRT
Sbjct  145  LKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVRVSVKGSRT  204

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ PA WQFGQTF GKNFR
Sbjct  205  GWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIVPAGWQFGQTFTGKNFR  262



>ref|XP_002309061.1| expansin family protein [Populus trichocarpa]
 gb|ABK94860.1| unknown [Populus trichocarpa]
 gb|EEE92584.1| expansin family protein [Populus trichocarpa]
Length=260

 Score =   410 bits (1053),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 197/238 (83%), Positives = 215/238 (90%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
            HARIPGV++GG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  22   HARIPGVFTGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  81

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC++D R C+PGNPSI VTATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMF
Sbjct  82   SCGACFEIKCADDPRWCNPGNPSILVTATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMF  141

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV  RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI  V +KGS T
Sbjct  142  LKIAQYRAGIVPVAHRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVNVWIKGSET  201

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A LVGQSLSFRVR SD R  TS NVA  NWQFGQTF GKNFR
Sbjct  202  DWMSMSRNWGQNWQSNAVLVGQSLSFRVRGSDGRTSTSKNVASPNWQFGQTFTGKNFR  259



>ref|XP_007205748.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
 gb|EMJ06947.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
Length=258

 Score =   409 bits (1052),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 191/240 (80%), Positives = 218/240 (91%), Gaps = 1/240 (0%)
 Frame = -3

Query  720  AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  541
            A +ARIPGVY+GG W+ AHATFYGG+DASGTMGGACGYGNLYS+GYGVN AALSTALFNN
Sbjct  18   AANARIPGVYTGGPWEGAHATFYGGSDASGTMGGACGYGNLYSEGYGVNTAALSTALFNN  77

Query  540  GLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            GLSCGACFEIKC +D + C PGNPSIF+TATNFCPPN+ALPND+GGWCNPPR HFDLAMP
Sbjct  78   GLSCGACFEIKCGDDPKWCHPGNPSIFITATNFCPPNYALPNDDGGWCNPPRTHFDLAMP  137

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFL+IA Y+AGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVL+TNVAGAGDI +V VKG+
Sbjct  138  MFLQIAEYKAGIVPVSFRRVPCRKEGGVRFTINGFRYFNLVLITNVAGAGDIVRVSVKGA  197

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             T W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWNVAP +WQFGQTF GKNFR
Sbjct  198  NTEWMPMSRNWGQNWQSNADLVGQTLSFRVTGSDRRTSTSWNVAPGHWQFGQTFSGKNFR  257



>gb|ABO30976.2| alpha expansin protein 1 [Calotropis procera]
Length=260

 Score =   409 bits (1052),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 196/243 (81%), Positives = 218/243 (90%), Gaps = 2/243 (1%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS-QGYGVNNAALSTALF  547
              + ARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYS   YGVN AALSTALF
Sbjct  18   VGIQARIPGVYSGGTWQRAHATFYGGSDASGTMGGACGYGNLYSPNEYGVNTAALSTALF  77

Query  546  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLA  370
            NNGLSCGACFEIKC+N+ + C PG+PSIF+TATNFCPPNFALPNDNGGWCNPPRPHFDLA
Sbjct  78   NNGLSCGACFEIKCANEPQWCHPGSPSIFITATNFCPPNFALPNDNGGWCNPPRPHFDLA  137

Query  369  MPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVK  190
            MPMFL+IA YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVL++NVAGAGDI +V VK
Sbjct  138  MPMFLRIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLISNVAGAGDIVRVSVK  197

Query  189  GSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKN  10
            G+RT W+++SRNWGQNW+++A LVGQSLSFRV  SDR   TSWN+ PANWQFGQTF GKN
Sbjct  198  GTRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVPGSDRPPSTSWNIVPANWQFGQTFVGKN  257

Query  9    FRA  1
            FR 
Sbjct  258  FRV  260



>dbj|BAC67194.1| expansin [Pyrus communis]
Length=261

 Score =   409 bits (1051),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 192/239 (80%), Positives = 214/239 (90%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V ARIPGVY+G AWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  22   VDARIPGVYTGAAWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  81

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPR HFDLAMPM
Sbjct  82   LSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRTHFDLAMPM  141

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV++RR+PCRKQGGIRFT+NG +YFNLVL+ NVAGAGDI K  VKG+ 
Sbjct  142  FLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNLVLIHNVAGAGDIVKAYVKGTN  201

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            TPW++LSRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ P+NWQFGQTF GKNFR
Sbjct  202  TPWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQTFTGKNFR  260



>ref|XP_011019858.1| PREDICTED: expansin-A6 [Populus euphratica]
Length=260

 Score =   409 bits (1051),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 216/239 (90%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
            HARIPGV++GG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  22   HARIPGVFTGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  81

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC++D R C+PGNPSIFVTATNFCPPNFA  +DNGGWCNPPRPHFDLAMPMF
Sbjct  82   SCGACFEIKCADDPRWCNPGNPSIFVTATNFCPPNFAQASDNGGWCNPPRPHFDLAMPMF  141

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV  RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI  V +KGS+T
Sbjct  142  LKIAQYRAGIVPVAHRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVNVWIKGSKT  201

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+++SRNWGQNW+++A LVGQSLSFRVR SD R  TS NVA  NWQFGQTF GKNFR 
Sbjct  202  DWMSMSRNWGQNWQSNAVLVGQSLSFRVRGSDGRTSTSKNVASPNWQFGQTFTGKNFRV  260



>ref|XP_008777004.1| PREDICTED: expansin-A4-like [Phoenix dactylifera]
Length=258

 Score =   409 bits (1051),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 195/237 (82%), Positives = 215/237 (91%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARI GVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN G S
Sbjct  21   ARILGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNEGQS  80

Query  531  CGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFEIKC++D S C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFL
Sbjct  81   CGACFEIKCADDPSWCHRGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFL  140

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+TNVAGAGDI +V VKGSRT 
Sbjct  141  KIAEYRAGIVPVSYRRVPCRKPGGIRFTINGFQYFNLVLITNVAGAGDIVRVSVKGSRTG  200

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W+ LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWNV PANWQFGQTF GKNFR
Sbjct  201  WMPLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTATSWNVVPANWQFGQTFAGKNFR  257



>ref|XP_006339024.1| PREDICTED: expansin-A3-like [Solanum tuberosum]
Length=257

 Score =   409 bits (1051),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 183/241 (76%), Positives = 219/241 (91%), Gaps = 0/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T V +++ GVY+ G WQ+AHATFYGG+DASGTMGGACGYGNLYS GYGVNNAALST LFN
Sbjct  17   TTVDSKVRGVYTAGPWQSAHATFYGGSDASGTMGGACGYGNLYSTGYGVNNAALSTVLFN  76

Query  543  NGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            +GLSCGACFEIKC++++ C+PGNPSIFVT TNFCPPN+ALPNDNGGWCNPPRPHFDL+MP
Sbjct  77   SGLSCGACFEIKCTDEKWCNPGNPSIFVTGTNFCPPNYALPNDNGGWCNPPRPHFDLSMP  136

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            +FL+IA YRAGIVPV +RR+PC+KQ GIRFT+NGF YFN+++VTNVAGAGDIQ+V VKG+
Sbjct  137  VFLQIAQYRAGIVPVTYRRVPCKKQEGIRFTINGFNYFNMIIVTNVAGAGDIQQVQVKGT  196

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             T WI +SRNWGQNW+++A L GQ+LSF+V+ SDRR VTS+NVAP+NWQFGQT+QGKN+R
Sbjct  197  NTKWIIMSRNWGQNWQSNALLTGQALSFKVKTSDRRYVTSYNVAPSNWQFGQTYQGKNYR  256

Query  3    A  1
             
Sbjct  257  V  257



>emb|CAA59470.1| orf [Pisum sativum]
Length=258

 Score =   409 bits (1051),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 193/237 (81%), Positives = 213/237 (90%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPGVY+GG W +AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLS
Sbjct  21   ARIPGVYTGGPWTSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLS  80

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFE+KC  D R C+PGNPSI +TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMFL
Sbjct  81   CGACFELKCDQDPRWCNPGNPSILITATNFCPPNFAEPSDNGGWCNPPRPHFDLAMPMFL  140

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV +RR+PCRK GGIRFT+NGFRYFNLVL+TNVAGAGDI +V VKG+ T 
Sbjct  141  KIAQYRAGIVPVAYRRVPCRKAGGIRFTINGFRYFNLVLITNVAGAGDIVRVSVKGTNTA  200

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W+T+SRNWGQNW+++A  VGQ+LSFRV  SDRR  TSWNVAP +WQFGQTF GKNFR
Sbjct  201  WMTMSRNWGQNWQSNAVFVGQALSFRVTGSDRRTSTSWNVAPPHWQFGQTFTGKNFR  257



>gb|AAV85475.1| expansin [Populus tomentosa]
Length=258

 Score =   409 bits (1050),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 192/238 (81%), Positives = 216/238 (91%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY+G  WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  20   EARIPGVYTGADWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  79

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC+N+ + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  80   SCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  139

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCR+ GGIRFT+NG RYFNLVL+TNVAGAGD+ KV VKGSRT
Sbjct  140  LKIAEYRAGIVPVSYRRVPCREPGGIRFTINGHRYFNLVLITNVAGAGDLVKVSVKGSRT  199

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWNV P NWQFGQTF GKNFR
Sbjct  200  GWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNVVPPNWQFGQTFAGKNFR  257



>ref|XP_008387765.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=258

 Score =   409 bits (1050),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 217/240 (90%), Gaps = 1/240 (0%)
 Frame = -3

Query  720  AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  541
            A  ARIPGVY+GGAW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNN
Sbjct  18   AABARIPGVYTGGAWEGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNN  77

Query  540  GLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            GLSCGACFEIKC +D R C PGNPSIFVTATNFCPPNFA P+D+GGWCNPPR HFDLAMP
Sbjct  78   GLSCGACFEIKCGDDPRWCHPGNPSIFVTATNFCPPNFAQPSDDGGWCNPPRTHFDLAMP  137

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLKIA Y+AGIVPV++RR+PCRKQGG+RFT+NGFRYFNLVL+TNVAGAGDI +V VKG+
Sbjct  138  MFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRYFNLVLITNVAGAGDIVRVSVKGA  197

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             T W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS NVAPA+WQFGQTF GKNFR
Sbjct  198  NTGWMPMSRNWGQNWQSNADLVGQTLSFRVTGSDRRTSTSLNVAPAHWQFGQTFTGKNFR  257



>gb|KJB08889.1| hypothetical protein B456_001G111100 [Gossypium raimondii]
Length=260

 Score =   409 bits (1050),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 191/238 (80%), Positives = 216/238 (91%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG 
Sbjct  22   EARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGF  81

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  82   SCGACFEIKCASDPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  141

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAG+G+I K  VKGSRT
Sbjct  142  LKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGSGNIVKASVKGSRT  201

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++ RNWGQNW+++  LVGQSLSFRV  SDRR  TSWN+ PA+WQFGQTF GKNFR
Sbjct  202  GWMSMGRNWGQNWQSNVVLVGQSLSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFR  259



>ref|NP_001288852.1| expansin-A3 precursor [Brassica rapa]
 gb|AGM16345.1| alpha-expansin protein 3 [Brassica rapa]
 emb|CDX91376.1| BnaC04g07740D [Brassica napus]
Length=263

 Score =   409 bits (1051),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 193/241 (80%), Positives = 215/241 (89%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T  +A+IPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  22   TVTNAKIPGVYTGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  81

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG SCGACFE+KC++D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLAM
Sbjct  82   NGFSCGACFELKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLAM  141

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKI  YRAGIVPV++RR+PCRK GGIRFT+NGFRYFNLVLVTNVAGAGDI  V VKG
Sbjct  142  PMFLKIGLYRAGIVPVSYRRVPCRKLGGIRFTINGFRYFNLVLVTNVAGAGDINGVSVKG  201

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W+ +SRNWGQNW+++A L+GQ+LSFRV ASDRR  TSWNVAP +WQFGQTF GKNF
Sbjct  202  SKTDWVRMSRNWGQNWQSNAVLIGQALSFRVTASDRRSSTSWNVAPPSWQFGQTFSGKNF  261

Query  6    R  4
            R
Sbjct  262  R  262



>ref|XP_010557251.1| PREDICTED: expansin-A6-like [Tarenaya hassleriana]
Length=259

 Score =   409 bits (1050),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 191/239 (80%), Positives = 216/239 (90%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
             ARIPGVY GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+ AALSTALFNNG 
Sbjct  21   EARIPGVYRGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGY  80

Query  534  SCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
             CGACFEIKC+ND + C  G+PSIF+TATNFCPPNFALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  81   RCGACFEIKCANDPTWCHSGSPSIFITATNFCPPNFALPSDNGGWCNPPRPHFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            L+IA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL+TNVAGAGDI +V VKGSRT
Sbjct  141  LRIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLITNVAGAGDIVRVSVKGSRT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ P++WQFGQT+ GKNFR 
Sbjct  201  GWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIVPSHWQFGQTYVGKNFRV  259



>ref|XP_006480833.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|KDO51152.1| hypothetical protein CISIN_1g025025mg [Citrus sinensis]
Length=259

 Score =   409 bits (1050),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 192/238 (81%), Positives = 219/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
            +A+IPGV++GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   NAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFE+KC  D + C+PGNP+I +TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMF
Sbjct  81   SCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LK+A YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVLVTNVAGAGDI +V VKG+ T
Sbjct  141  LKLAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGDIVRVSVKGANT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWNVAPANWQFGQTF GKNFR
Sbjct  201  QWLSMSRNWGQNWQSNAQLVGQALSFRVTGSDRRTSTSWNVAPANWQFGQTFSGKNFR  258



>gb|AIE54285.1| expansin [Nicotiana tabacum]
Length=257

 Score =   409 bits (1050),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 185/240 (77%), Positives = 218/240 (91%), Gaps = 0/240 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T  +A++PGVY+ G W++AHATFYGGADASGTMGGACGYGNLYS GYGVNNAALSTALFN
Sbjct  17   TGANAKVPGVYTSGPWESAHATFYGGADASGTMGGACGYGNLYSAGYGVNNAALSTALFN  76

Query  543  NGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            NGLSCGACFEI+C++ + C+PGNPSIFVT TNFCPPN+ALPNDNGGWCNPPRPHFDLA P
Sbjct  77   NGLSCGACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNYALPNDNGGWCNPPRPHFDLAEP  136

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLK A YRAGIVPV +RR+PC+K GGI+FT+NGF YFN+V+VTNVAGAGDIQKV VKG+
Sbjct  137  MFLKFAQYRAGIVPVTYRRVPCKKSGGIKFTINGFNYFNMVIVTNVAGAGDIQKVFVKGT  196

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             T W+ +SRNWGQNW+++A LVGQ+LSF+V+ASD R VT++NVAP+NWQFGQT++ KNFR
Sbjct  197  NTKWMAMSRNWGQNWQSNAQLVGQALSFKVKASDHRYVTTYNVAPSNWQFGQTYEAKNFR  256



>ref|XP_003552064.1| PREDICTED: expansin-A4 [Glycine max]
Length=258

 Score =   409 bits (1050),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 195/241 (81%), Positives = 218/241 (90%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
             A  ARIPGV++GGAWQ AHATFYGG DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  17   VATSARIPGVFNGGAWQGAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  76

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFEIKC  D R C+PG+PSI +TATNFCPPNFALP+DNGGWCNPPRPHFDLAM
Sbjct  77   NGLSCGACFEIKCDQDPRWCNPGSPSIVITATNFCPPNFALPSDNGGWCNPPRPHFDLAM  136

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA Y+AGIVPV++RR+PCRK GGIRFT+NGFRYFNLVL+TNVAGAGDI +V VKG
Sbjct  137  PMFLKIAQYKAGIVPVSYRRVPCRKVGGIRFTINGFRYFNLVLITNVAGAGDIARVSVKG  196

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W ++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWNVAP++W+FGQTF GKNF
Sbjct  197  SKTGWNSMSRNWGQNWQSNANLVGQALSFRVTGSDRRTSTSWNVAPSHWKFGQTFTGKNF  256

Query  6    R  4
            R
Sbjct  257  R  257



>ref|XP_006429095.1| hypothetical protein CICLE_v10012518mg [Citrus clementina]
 gb|ESR42335.1| hypothetical protein CICLE_v10012518mg [Citrus clementina]
Length=259

 Score =   409 bits (1050),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 192/238 (81%), Positives = 219/238 (92%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
            +A+IPGV++GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   NAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFE+KC  D + C+PGNP+I +TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMF
Sbjct  81   SCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMF  140

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LK+A YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVLVTNVAGAGDI +V VKG+ T
Sbjct  141  LKLAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGDIVRVSVKGANT  200

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWNVAPANWQFGQTF GKNFR
Sbjct  201  QWLSMSRNWGQNWQSNAQLVGQALSFRVTGSDRRTSTSWNVAPANWQFGQTFSGKNFR  258



>ref|XP_006846223.1| hypothetical protein AMTR_s00012p00230920 [Amborella trichopoda]
 gb|ERN07898.1| hypothetical protein AMTR_s00012p00230920 [Amborella trichopoda]
Length=258

 Score =   408 bits (1049),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 191/237 (81%), Positives = 217/237 (92%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPGVYSG  W++AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN+GLS
Sbjct  21   ARIPGVYSGSDWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNSGLS  80

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFL
Sbjct  81   CGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFL  140

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV++RR+ CRK GGIRFT+NGFRYFNLVL++NVAGAGDI KV VKGSRT 
Sbjct  141  KIAEYRAGIVPVSYRRVSCRKPGGIRFTINGFRYFNLVLISNVAGAGDIVKVWVKGSRTG  200

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W+++SRNWGQNW++++ LVGQ+LSFRV +SDRR  TSWNV PANWQFGQTF GKNFR
Sbjct  201  WMSMSRNWGQNWQSNSILVGQALSFRVTSSDRRTSTSWNVVPANWQFGQTFTGKNFR  257



>ref|XP_010937609.1| PREDICTED: expansin-A4 [Elaeis guineensis]
Length=260

 Score =   408 bits (1049),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 191/237 (81%), Positives = 215/237 (91%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPGVY+G +WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN+GLS
Sbjct  23   ARIPGVYTGESWQKAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNDGLS  82

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFEIKC++D + C  G PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFL
Sbjct  83   CGACFEIKCADDPQWCHHGGPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFL  142

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+TNVAGAGDI +V VKGS T 
Sbjct  143  KIAQYRAGIVPVSYRRVPCRKSGGIRFTINGFKYFNLVLITNVAGAGDIVRVSVKGSHTG  202

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W+ +SRNWGQNW+++A LVGQSLSFRV ASD R+ TSWN+ PANWQFGQTF GKNFR
Sbjct  203  WMPMSRNWGQNWQSNAVLVGQSLSFRVTASDHRRSTSWNIVPANWQFGQTFAGKNFR  259



>emb|CDY47883.1| BnaA07g14280D [Brassica napus]
Length=260

 Score =   408 bits (1049),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 191/242 (79%), Positives = 217/242 (90%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T    RIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  19   TITEGRIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  78

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPRPHFDLAM
Sbjct  79   NGYSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRPHFDLAM  138

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV+FRR+PCRK GG+RFT+NGFRYFNLVLVTNVAG G+I ++ VKG
Sbjct  139  PMFLKIAEYRAGIVPVSFRRVPCRKIGGMRFTINGFRYFNLVLVTNVAGVGNIVRLSVKG  198

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            +RT W+T+SRNWGQNW++++ LVGQ+LSFRV  SDRR  TSWN+APA+WQFGQTF GKNF
Sbjct  199  TRTSWMTMSRNWGQNWQSNSVLVGQALSFRVTGSDRRSSTSWNIAPAHWQFGQTFMGKNF  258

Query  6    RA  1
            R 
Sbjct  259  RV  260



>emb|CDX74942.1| BnaA05g06880D [Brassica napus]
Length=263

 Score =   408 bits (1049),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 192/241 (80%), Positives = 215/241 (89%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T  +A+IPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  22   TVTNAKIPGVYTGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  81

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG SCGACFE+KC++D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLAM
Sbjct  82   NGFSCGACFELKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLAM  141

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKI  YRAGIVPV++RR+PCRK GGIRFT+NGFRYFNL+LVTNVAGAGDI  V VKG
Sbjct  142  PMFLKIGLYRAGIVPVSYRRVPCRKLGGIRFTINGFRYFNLILVTNVAGAGDINGVSVKG  201

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W+ +SRNWGQNW+++A L+GQ+LSFRV ASDRR  TSWNVAP +WQFGQTF GKNF
Sbjct  202  SKTDWVRMSRNWGQNWQSNAVLIGQALSFRVTASDRRSSTSWNVAPPSWQFGQTFSGKNF  261

Query  6    R  4
            R
Sbjct  262  R  262



>ref|XP_008371813.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=261

 Score =   408 bits (1048),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 191/239 (80%), Positives = 215/239 (90%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN+G
Sbjct  22   VDARIPGVYTGGAWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNSG  81

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNFA P+D+GGWCNPPR HFDLAMPM
Sbjct  82   LSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQPSDDGGWCNPPRTHFDLAMPM  141

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV++RR+PCRKQGGIRFT+NG +YFNLVL+ NVAGAGDI K  VKG+ 
Sbjct  142  FLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNLVLIHNVAGAGDIVKAYVKGTN  201

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            TPW++LSRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ P+NWQFGQTF GKNFR
Sbjct  202  TPWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQTFTGKNFR  260



>ref|XP_004249536.1| PREDICTED: expansin-A6-like [Solanum lycopersicum]
Length=257

 Score =   408 bits (1048),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 182/241 (76%), Positives = 219/241 (91%), Gaps = 0/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T V +++ GVY+ G WQ+AHATFYGG+DASGTMGGACGYGNLYS GYGVNNAALST LFN
Sbjct  17   TIVESKVRGVYTAGPWQSAHATFYGGSDASGTMGGACGYGNLYSTGYGVNNAALSTVLFN  76

Query  543  NGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            +GLSCGACFEIKC++++ C+PGNPSIFVT TNFCPPN+ALPNDNGGWCNPPRPHFDL+MP
Sbjct  77   SGLSCGACFEIKCTDEKWCNPGNPSIFVTGTNFCPPNYALPNDNGGWCNPPRPHFDLSMP  136

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            +FL+IA YRAGIVPV +RR+PC+KQGGIRFT+NGF YFN+++VTNVAGAGDIQ+V VKG+
Sbjct  137  VFLQIAQYRAGIVPVTYRRVPCKKQGGIRFTINGFNYFNMIIVTNVAGAGDIQQVQVKGT  196

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             T WI +SRNWGQNW+++A L GQ+LSF+V+ SD R VTS+NVAP+NWQFGQT++GKN+R
Sbjct  197  NTKWIIMSRNWGQNWQSNAMLTGQALSFKVKTSDHRYVTSYNVAPSNWQFGQTYEGKNYR  256

Query  3    A  1
             
Sbjct  257  V  257



>ref|XP_006294816.1| hypothetical protein CARUB_v10023867mg [Capsella rubella]
 gb|EOA27714.1| hypothetical protein CARUB_v10023867mg [Capsella rubella]
Length=262

 Score =   408 bits (1048),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 197/241 (82%), Positives = 213/241 (88%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            TA  A+I GVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  21   TASDAKIAGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  80

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG SCGACFEIKC++D R C PGNPSI VTATNFCPPNFA  +DNGGWCNPPR HFDLAM
Sbjct  81   NGYSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQASDNGGWCNPPREHFDLAM  140

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKI  YRAGIVPV++RR+PCRK GGIRFTVNGFRYFNLVLVTNVAGAGDI  V VKG
Sbjct  141  PMFLKIGLYRAGIVPVSYRRVPCRKVGGIRFTVNGFRYFNLVLVTNVAGAGDINGVSVKG  200

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W+ +SRNWGQNW+++A L+GQSLSFRV ASDRR  TSWNVAP +WQFGQTF GKNF
Sbjct  201  SKTDWVRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTSWNVAPPSWQFGQTFSGKNF  260

Query  6    R  4
            R
Sbjct  261  R  261



>gb|KFK36651.1| alpha-expansin 4 [Arabis alpina]
Length=261

 Score =   407 bits (1047),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 193/241 (80%), Positives = 215/241 (89%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            TA +A+IPGVY+GG WQ AHATFYGGADASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  20   TASNAKIPGVYTGGPWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVNTAALSTALFN  79

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFE+KC++D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLAM
Sbjct  80   NGLSCGACFEMKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLAM  139

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKI  YRAGIVPV++RR+PCRK GGIRFTVNGF+YFNLVLVTNVAGAGD+  V +KG
Sbjct  140  PMFLKIGIYRAGIVPVSYRRVPCRKLGGIRFTVNGFKYFNLVLVTNVAGAGDLTGVSIKG  199

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W+ +SRNWGQNW+++A  +GQSLSFRV ASD R  TSWNVAP +WQFGQTF GKNF
Sbjct  200  SKTDWVRMSRNWGQNWQSNAVFIGQSLSFRVTASDHRSSTSWNVAPPSWQFGQTFSGKNF  259

Query  6    R  4
            R
Sbjct  260  R  260



>ref|XP_007132063.1| hypothetical protein PHAVU_011G063800g [Phaseolus vulgaris]
 gb|ESW04057.1| hypothetical protein PHAVU_011G063800g [Phaseolus vulgaris]
Length=259

 Score =   407 bits (1046),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 198/240 (83%), Positives = 219/240 (91%), Gaps = 1/240 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V ARIPG+YSGGAW++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  20   VEARIPGIYSGGAWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  79

Query  537  LSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPM
Sbjct  80   LSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPM  139

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV FRR+PCRK GGIRFTVNGFRYFNLVLV+NVAGAGDI ++ VKGSR
Sbjct  140  FLKIAEYRAGIVPVAFRRVPCRKHGGIRFTVNGFRYFNLVLVSNVAGAGDIVRIYVKGSR  199

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            T W+ +SRNWGQNW+++A LVGQ+LSFRV +SD R  TSWN+AP +WQFGQTF GKNFR 
Sbjct  200  TGWMPMSRNWGQNWQSNAVLVGQALSFRVTSSDSRTSTSWNIAPPHWQFGQTFTGKNFRV  259



>ref|XP_011094866.1| PREDICTED: expansin-A6 [Sesamum indicum]
Length=262

 Score =   407 bits (1045),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 196/243 (81%), Positives = 216/243 (89%), Gaps = 3/243 (1%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T   ARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  19   TCSDARIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  78

Query  543  NGLSCGACFEIKCS---NDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  373
            NGLSCGACFEIKC    + + C+PG+PSI VTATNFCPPN+ALPNDNGGWCNPPR HFDL
Sbjct  79   NGLSCGACFEIKCDAAQDPKWCNPGSPSILVTATNFCPPNYALPNDNGGWCNPPREHFDL  138

Query  372  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  193
            AMPMFLKIA Y AGIVPVNFRRIPCRKQGGIRFT+NGFRYFNLVLVTNV GAGDI ++ +
Sbjct  139  AMPMFLKIAQYSAGIVPVNFRRIPCRKQGGIRFTINGFRYFNLVLVTNVGGAGDIVRLSI  198

Query  192  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGK  13
            KG+ T W+ +SRNWGQNW+++A +VGQ+LSFRV ASD R+ TS NVAPANWQFGQTF GK
Sbjct  199  KGANTQWLPMSRNWGQNWQSNADIVGQALSFRVTASDGRKSTSMNVAPANWQFGQTFVGK  258

Query  12   NFR  4
            NFR
Sbjct  259  NFR  261



>gb|EPS67093.1| hypothetical protein M569_07682, partial [Genlisea aurea]
Length=261

 Score =   407 bits (1045),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 213/240 (89%), Gaps = 3/240 (1%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
            HARIPGVY+G  W++AHATFYGGADASGTMGGACGYGNLYSQGYGVN AALSTALFN GL
Sbjct  21   HARIPGVYAGTGWESAHATFYGGADASGTMGGACGYGNLYSQGYGVNTAALSTALFNTGL  80

Query  534  SCGACFEIKCS---NDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            SCGACFEI+C    + R CSPG PSI VTATNFCPPN+ALP+D GGWCNPPRPHFDLAMP
Sbjct  81   SCGACFEIRCDESQDGRWCSPGRPSISVTATNFCPPNYALPSDKGGWCNPPRPHFDLAMP  140

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLKIA YRAGIV VNFRRIPCRK GGIRFTVNGFRYFNLVL+TNVAGAGDI +  VKG+
Sbjct  141  MFLKIAEYRAGIVAVNFRRIPCRKAGGIRFTVNGFRYFNLVLITNVAGAGDIVRASVKGT  200

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            RT W+ +SRNWGQNW+++A LVGQ+LSFRV ASDRR  TS +VAPA+WQFGQTF G+NFR
Sbjct  201  RTEWMPMSRNWGQNWQSNAILVGQALSFRVAASDRRTTTSIDVAPADWQFGQTFVGRNFR  260



>ref|XP_010111142.1| hypothetical protein L484_010756 [Morus notabilis]
 gb|EXC30507.1| hypothetical protein L484_010756 [Morus notabilis]
Length=258

 Score =   407 bits (1045),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 188/239 (79%), Positives = 216/239 (90%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V A+IPG Y GG+WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  19   VDAKIPGNYGGGSWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  78

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFEIKC+ND + C  G+PSI VTATNFCPPN+ALPNDNGGWCNPPR HFDLAMPM
Sbjct  79   LSCGACFEIKCANDPQWCHSGSPSILVTATNFCPPNYALPNDNGGWCNPPRSHFDLAMPM  138

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV +RR+PCRKQGG+RFT+NGF+YFNLVL+TNVAGAGDI +  VKGS+
Sbjct  139  FLKIAEYRAGIVPVTYRRVPCRKQGGVRFTINGFKYFNLVLITNVAGAGDIVRASVKGSK  198

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            T W+++SRNWGQNW++++ LVGQSLSFR+  SDRR  T+WN+ P++WQFGQTF GKNFR
Sbjct  199  TGWMSMSRNWGQNWQSNSVLVGQSLSFRITGSDRRTSTAWNIVPSHWQFGQTFTGKNFR  257



>ref|XP_004154408.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004173564.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN65728.1| hypothetical protein Csa_1G522540 [Cucumis sativus]
Length=259

 Score =   407 bits (1045),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 194/237 (82%), Positives = 216/237 (91%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPG+YSGG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLS
Sbjct  22   ARIPGIYSGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLS  81

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFEIKC+ND R C  G+PSI +TATNFCPPNFALP+DNGGWCNPPRPHFDLAMPMFL
Sbjct  82   CGACFEIKCANDPRWCHSGSPSIVITATNFCPPNFALPSDNGGWCNPPRPHFDLAMPMFL  141

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV +RR+ CRK GGIRFT++GFRYFNLVLVTNVAGAGDI KV VKG+RT 
Sbjct  142  KIAEYRAGIVPVAYRRVGCRKPGGIRFTIHGFRYFNLVLVTNVAGAGDIVKVSVKGTRTG  201

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W+++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS NVAP++WQFGQTF GKNFR
Sbjct  202  WMSMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSINVAPSDWQFGQTFTGKNFR  258



>ref|XP_010534508.1| PREDICTED: expansin-A4 [Tarenaya hassleriana]
Length=261

 Score =   406 bits (1044),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 191/237 (81%), Positives = 215/237 (91%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPG+YSG AWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG S
Sbjct  24   ARIPGIYSGSAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFS  83

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPR HFDLAMPMFL
Sbjct  84   CGACFEIKCANDPQWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRAHFDLAMPMFL  143

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVP+++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  VKGSRT 
Sbjct  144  KIAEYRAGIVPISYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRASVKGSRTG  203

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P++WQFGQTF GKNFR
Sbjct  204  WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSSWQFGQTFVGKNFR  260



>ref|XP_008457477.1| PREDICTED: expansin-A4-like [Cucumis melo]
Length=259

 Score =   406 bits (1043),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 193/237 (81%), Positives = 216/237 (91%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPGVYSGG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLS
Sbjct  22   ARIPGVYSGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLS  81

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFEIKC+ND R C  G+PSI +TATNFCPPNFALP+DNGGWCNPPRPHFDLAMPMFL
Sbjct  82   CGACFEIKCANDPRWCHSGSPSIVITATNFCPPNFALPSDNGGWCNPPRPHFDLAMPMFL  141

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV +RR+ CRK GGIRFT++GFRYFNLVL+TNVAGAGDI KV VKG+RT 
Sbjct  142  KIAEYRAGIVPVAYRRVACRKPGGIRFTIHGFRYFNLVLITNVAGAGDIVKVSVKGTRTG  201

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W+++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS NVAP++WQFGQTF G+NFR
Sbjct  202  WMSMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSINVAPSDWQFGQTFTGRNFR  258



>ref|XP_008799850.1| PREDICTED: expansin-A6-like [Phoenix dactylifera]
Length=260

 Score =   406 bits (1043),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 191/237 (81%), Positives = 214/237 (90%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN+G S
Sbjct  23   ARIPGVYTGGPWQQAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNDGQS  82

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFEIKC  D + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFL
Sbjct  83   CGACFEIKCGEDLKWCHHGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFL  142

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVLVTNVAGAGDI ++ VKGSRT 
Sbjct  143  KIAEYRAGIVPVSYRRVPCRKPGGIRFTINGFKYFNLVLVTNVAGAGDIVRLSVKGSRTG  202

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W+ +SRNWGQNW+++A LVGQSLSFR+ ASDRR  TSWN+ PA+WQFGQTF GKNFR
Sbjct  203  WMPMSRNWGQNWQSNAVLVGQSLSFRLTASDRRTSTSWNIVPAHWQFGQTFAGKNFR  259



>ref|XP_009124371.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A6 [Brassica rapa]
Length=260

 Score =   406 bits (1043),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 190/242 (79%), Positives = 216/242 (89%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T    RIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  19   TITEGRIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  78

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG SCGACFE+ C++D + C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPRPHFDLAM
Sbjct  79   NGYSCGACFELXCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRPHFDLAM  138

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV+FRR+PCRK GG+RFT+NGFRYFNLVLVTNVAG G+I ++ VKG
Sbjct  139  PMFLKIAEYRAGIVPVSFRRVPCRKIGGMRFTINGFRYFNLVLVTNVAGVGNIVRLSVKG  198

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            +RT W+T+SRNWGQNW++++ LVGQ+LSFRV  SDRR  TSWN+APA+WQFGQTF GKNF
Sbjct  199  TRTSWMTMSRNWGQNWQSNSVLVGQALSFRVTGSDRRSSTSWNIAPAHWQFGQTFMGKNF  258

Query  6    RA  1
            R 
Sbjct  259  RV  260



>ref|XP_002463623.1| hypothetical protein SORBIDRAFT_01g003120 [Sorghum bicolor]
 gb|EER90621.1| hypothetical protein SORBIDRAFT_01g003120 [Sorghum bicolor]
Length=262

 Score =   406 bits (1043),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 191/239 (80%), Positives = 212/239 (89%), Gaps = 3/239 (1%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPGVY GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALSTALFN GLS
Sbjct  23   ARIPGVYGGGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNEGLS  82

Query  531  CGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            CGACFE+KC N    R C PG+PSI VTATNFCPPN+ALP+D+GGWCNPPRPHFDLAMPM
Sbjct  83   CGACFELKCENQPGWRWCRPGSPSILVTATNFCPPNYALPSDDGGWCNPPRPHFDLAMPM  142

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FL IA YRAGIVPV++RR+PCRK GG+RFT+NGFRYFNLVL+TNVAGAGDI +  VK S 
Sbjct  143  FLHIAEYRAGIVPVSYRRVPCRKSGGVRFTINGFRYFNLVLITNVAGAGDIVRASVKASS  202

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            T W+T+SRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWN AP NWQFGQTF+GKNFR
Sbjct  203  TGWLTMSRNWGQNWQSNAILVGQALSFRVTGSDRRTSTSWNAAPRNWQFGQTFEGKNFR  261



>ref|XP_010922313.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A4-like [Elaeis guineensis]
Length=258

 Score =   405 bits (1040),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 189/237 (80%), Positives = 214/237 (90%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPGVYS G WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN+G+S
Sbjct  21   ARIPGVYSSGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNDGMS  80

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+D+GGWCNPP PHFDLAMPMFL
Sbjct  81   CGACFEIKCADDPQWCHSGSPSIFITATNFCPPNYALPSDDGGWCNPPXPHFDLAMPMFL  140

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+TNVAGAGDI +  VKGSRT 
Sbjct  141  KIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFQYFNLVLITNVAGAGDIVRASVKGSRTG  200

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W+ +SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PANWQFGQTF GKNFR
Sbjct  201  WMPMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPANWQFGQTFAGKNFR  257



>ref|XP_006411198.1| hypothetical protein EUTSA_v10017119mg [Eutrema salsugineum]
 gb|ESQ52651.1| hypothetical protein EUTSA_v10017119mg [Eutrema salsugineum]
Length=258

 Score =   405 bits (1040),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 190/238 (80%), Positives = 214/238 (90%), Gaps = 1/238 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            A+IPGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTALFNNG+S
Sbjct  21   AKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMS  80

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFE+KC+ND + C  G+PSI +TATNFCPPN A P+DNGGWCNPPR HFDLAMP+FL
Sbjct  81   CGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSDNGGWCNPPRAHFDLAMPVFL  140

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  VKGSRT 
Sbjct  141  KIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTSVKGSRTG  200

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+NWQFGQTF GKNFR 
Sbjct  201  WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQTFVGKNFRV  258



>gb|KJB46593.1| hypothetical protein B456_007G376300 [Gossypium raimondii]
Length=293

 Score =   406 bits (1044),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 198/272 (73%), Positives = 224/272 (82%), Gaps = 32/272 (12%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMG--------------------------  622
            T+V+A+IPGVYS G+W+TAHATFYGG+DASGTMG                          
Sbjct  21   TSVNAKIPGVYSTGSWETAHATFYGGSDASGTMGISQITLPSPPSKSHIFMTLHLIVFFF  80

Query  621  -----GACGYGNLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFV  460
                 GACGYGNLYSQGYGVN AALSTALFNNGLSCGACFEIKC++D R C PG+PSIFV
Sbjct  81   CCFLGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCASDPRWCHPGSPSIFV  140

Query  459  TATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGI  280
            TATNFCPPNFALP+DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK GGI
Sbjct  141  TATNFCPPNFALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKHGGI  200

Query  279  RFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSF  100
            RFTVNGFRYFNLVL+TNVAGAGD+ KV +KG++T W+++SRNWGQNW+++A L+GQ+LSF
Sbjct  201  RFTVNGFRYFNLVLITNVAGAGDLVKVSIKGTKTGWMSMSRNWGQNWQSNAVLIGQALSF  260

Query  99   RVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            RV  SD+R  TSWNVAP NWQFGQTF GKNFR
Sbjct  261  RVTGSDKRTSTSWNVAPPNWQFGQTFTGKNFR  292



>gb|KEH22886.1| expansin-A1-like protein [Medicago truncatula]
Length=258

 Score =   405 bits (1040),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 212/240 (88%), Gaps = 1/240 (0%)
 Frame = -3

Query  720  AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  541
            A  ARIPGVYSGG W +AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNN
Sbjct  18   ATTARIPGVYSGGPWTSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNN  77

Query  540  GLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            GLSCGACFE+KC  D R C+PGNPSI +TATNFCPPNFA P+DNGGWCNPPRPHFDLAMP
Sbjct  78   GLSCGACFELKCDQDPRWCNPGNPSILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMP  137

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLKIA YRAGIVPV +RR+PCRK GGIRFT+NGFRYFNLVLVTNVAGAGDI +V VKG+
Sbjct  138  MFLKIAQYRAGIVPVAYRRVPCRKAGGIRFTINGFRYFNLVLVTNVAGAGDIIRVSVKGT  197

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             T W+ +SRNWGQNW+++A  VGQ+LSFRV  SDRR  TS N+AP +WQFGQTF GKNFR
Sbjct  198  NTAWMPMSRNWGQNWQSNAVFVGQALSFRVTGSDRRTSTSMNIAPPHWQFGQTFTGKNFR  257



>gb|AAF32410.1|AF230277_1 alpha-expansin 2 [Triphysaria versicolor]
Length=262

 Score =   405 bits (1040),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 193/243 (79%), Positives = 214/243 (88%), Gaps = 3/243 (1%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T+  ARIPG+YSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  19   TSAQARIPGIYSGGPWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  78

Query  543  NGLSCGACFEIKCS---NDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  373
            NGLSCGACFEI+C    + + C+PG PSI VTATNFCPPNFA P+DNGGWCNPPR HFDL
Sbjct  79   NGLSCGACFEIRCDMAQDGKWCNPGTPSILVTATNFCPPNFAQPSDNGGWCNPPRTHFDL  138

Query  372  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  193
            AMPMFLKIA YRAGIVPVN+RRIPCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI +V +
Sbjct  139  AMPMFLKIAQYRAGIVPVNYRRIPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVRVSI  198

Query  192  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGK  13
            KG+ T W+++SRNWGQNW+++  LVGQ+LSFRV ASD R   S NVAPA+WQFGQTF GK
Sbjct  199  KGTNTQWVSMSRNWGQNWQSNIVLVGQALSFRVTASDHRSSASMNVAPAHWQFGQTFTGK  258

Query  12   NFR  4
            NFR
Sbjct  259  NFR  261



>emb|CDY07024.1| BnaA04g22910D [Brassica napus]
Length=258

 Score =   404 bits (1039),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 190/241 (79%), Positives = 215/241 (89%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T   A+IPGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTALFN
Sbjct  17   TLTDAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFN  76

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            +G+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNFA  +DNGGWCNPPR HFDLAM
Sbjct  77   SGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPRAHFDLAM  136

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            P+FLKIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  VKG
Sbjct  137  PVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTSVKG  196

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            SRT W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+NWQFGQTF GKNF
Sbjct  197  SRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQTFVGKNF  256

Query  6    R  4
            R
Sbjct  257  R  257



>ref|XP_007133996.1| hypothetical protein PHAVU_010G010200g [Phaseolus vulgaris]
 gb|ESW05990.1| hypothetical protein PHAVU_010G010200g [Phaseolus vulgaris]
Length=258

 Score =   404 bits (1039),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 192/241 (80%), Positives = 215/241 (89%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
             A +ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  17   VATNARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  76

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NGLSCGACFEIKC  D R C+PG PSI +TATNFCPPN ALP+DNGGWCNPPRPHFDLAM
Sbjct  77   NGLSCGACFEIKCDQDPRWCNPGRPSIIITATNFCPPNLALPSDNGGWCNPPRPHFDLAM  136

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV++RR+ CRK GGIRF +NGFRYFNLVL++NVAGAGDI +V VKG
Sbjct  137  PMFLKIAQYRAGIVPVSYRRVACRKAGGIRFMINGFRYFNLVLISNVAGAGDIVRVSVKG  196

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S++ W ++SRNWGQNW+++A LVGQ+LSFRV   DRR  TSWNVAP++WQFGQTF GKNF
Sbjct  197  SKSGWNSMSRNWGQNWQSNANLVGQALSFRVTGGDRRTSTSWNVAPSHWQFGQTFTGKNF  256

Query  6    R  4
            R
Sbjct  257  R  257



>dbj|BAC67193.1| expansin [Pyrus communis]
Length=258

 Score =   404 bits (1038),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 215/240 (90%), Gaps = 1/240 (0%)
 Frame = -3

Query  720  AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  541
            A +ARIPGVY+GG+W+ AHATFYGG DASGTMGGACGYGNLYSQGYGVN AALSTALFNN
Sbjct  18   AANARIPGVYTGGSWEGAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNN  77

Query  540  GLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            GLSCGACFEIKC +D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLAMP
Sbjct  78   GLSCGACFEIKCGDDPRWCHPGNPSILVTATNFCPPNFAQPSDDGGWCNPPRTHFDLAMP  137

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLKIA Y+AGIVPV++RR+PCRKQGG+RFT+NGFRYFNLVL+TNVAGAGDI +V VKG 
Sbjct  138  MFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRYFNLVLITNVAGAGDIVRVSVKGG  197

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             T W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS NVAPA+WQFGQTF GKNFR
Sbjct  198  NTGWMPMSRNWGQNWQSNADLVGQTLSFRVTGSDRRTSTSHNVAPADWQFGQTFTGKNFR  257



>ref|XP_007163413.1| hypothetical protein PHAVU_001G232600g [Phaseolus vulgaris]
 gb|ESW35407.1| hypothetical protein PHAVU_001G232600g [Phaseolus vulgaris]
Length=258

 Score =   404 bits (1038),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 188/241 (78%), Positives = 216/241 (90%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T   A+IPG +SGG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  17   TPSQAKIPGAFSGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  76

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG SCGACF+IKC++D + C PGNPSIFVTATNFCPPN+ALP+DNGGWCNPPRPHFDLAM
Sbjct  77   NGFSCGACFQIKCTHDPKWCLPGNPSIFVTATNFCPPNYALPSDNGGWCNPPRPHFDLAM  136

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            PMFLKIA YRAGIVPV++RR+ CRK+GG+RFT+NGFRYFNL+L+TNV GAGDI +  +KG
Sbjct  137  PMFLKIAQYRAGIVPVSYRRVGCRKEGGMRFTMNGFRYFNLILITNVGGAGDIVRASLKG  196

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            SR+ W+++SRNWGQNW+++  LVGQSLSFRV  SDRR  TSWN+ P+NWQFGQTF GKNF
Sbjct  197  SRSGWMSMSRNWGQNWQSNTVLVGQSLSFRVTGSDRRSSTSWNIVPSNWQFGQTFLGKNF  256

Query  6    R  4
            R
Sbjct  257  R  257



>emb|CDY07642.1| BnaA03g18690D [Brassica napus]
Length=258

 Score =   404 bits (1037),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 189/242 (78%), Positives = 215/242 (89%), Gaps = 1/242 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T   A+IPGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTALFN
Sbjct  17   TLTDAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFN  76

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            NG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNFA  +DNGGWCNPPR HFDLAM
Sbjct  77   NGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPREHFDLAM  136

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            P+FLKIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  VKG
Sbjct  137  PVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTSVKG  196

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            S+T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSW++ P+NWQFGQTF GKNF
Sbjct  197  SKTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWSIVPSNWQFGQTFVGKNF  256

Query  6    RA  1
            R 
Sbjct  257  RV  258



>gb|AAL31477.1|AF319472_1 alpha-expansin 6 precursor [Cucumis sativus]
Length=259

 Score =   404 bits (1037),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 193/237 (81%), Positives = 215/237 (91%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPG+YSGG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLS
Sbjct  22   ARIPGIYSGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLS  81

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFEIKC+ND R C  G+PSI +TATNFCPPNFALP+DNGGWCNPPRPHFDLAMPMFL
Sbjct  82   CGACFEIKCANDPRWCHSGSPSIVITATNFCPPNFALPSDNGGWCNPPRPHFDLAMPMFL  141

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV +RR+ CRK GGIRFT++GFRYFNLVLVTNVAGAGDI KV VKG+RT 
Sbjct  142  KIAEYRAGIVPVAYRRVGCRKPGGIRFTIHGFRYFNLVLVTNVAGAGDIVKVSVKGTRTG  201

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W+++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS N AP++WQFGQTF GKNFR
Sbjct  202  WMSMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSINGAPSDWQFGQTFTGKNFR  258



>ref|XP_009419260.1| PREDICTED: expansin-A7-like [Musa acuminata subsp. malaccensis]
Length=258

 Score =   403 bits (1036),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 190/240 (79%), Positives = 212/240 (88%), Gaps = 1/240 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V  RIPG Y+G  WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN G
Sbjct  19   VLGRIPGAYTGSPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALSTALFNEG  78

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
             SCGACFEIKC++D R C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHFDL+MPM
Sbjct  79   QSCGACFEIKCADDLRWCHGGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLSMPM  138

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV++RR+PCRK GGIRFT+NGF YFNLVL+TNVAGAGDI +  VKGSR
Sbjct  139  FLKIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFNYFNLVLITNVAGAGDIIRASVKGSR  198

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            T W+ +SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+NWQFGQTFQGKNFR 
Sbjct  199  TGWMPMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQTFQGKNFRV  258



>emb|CDY20467.1| BnaC04g05770D [Brassica napus]
Length=256

 Score =   403 bits (1035),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 189/237 (80%), Positives = 214/237 (90%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            A+IPGVYSGGAW+TAHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTALFNNG+S
Sbjct  19   AKIPGVYSGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMS  78

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFE+KC+ND + C  G+PSI +TATNFCPPNFA  +DNGGWCNPPR HFDLAMP+FL
Sbjct  79   CGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPRAHFDLAMPVFL  138

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  VKGSRT 
Sbjct  139  KIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTSVKGSRTG  198

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+NWQFGQTF GKNFR
Sbjct  199  WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQTFVGKNFR  255



>ref|XP_009341751.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=258

 Score =   403 bits (1035),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 192/240 (80%), Positives = 215/240 (90%), Gaps = 1/240 (0%)
 Frame = -3

Query  720  AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  541
            A +ARIPGVY+GG W+ AHATFYGG DASGTMGGACGYGNLYSQGYGVN AALSTALFNN
Sbjct  18   AANARIPGVYTGGPWEGAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNN  77

Query  540  GLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            GLSCGACFE+KC +D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLAMP
Sbjct  78   GLSCGACFELKCGDDPRWCHPGNPSILVTATNFCPPNFAQPSDDGGWCNPPRTHFDLAMP  137

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFLKIA Y+AGIVPV++RR+PCRKQGG+RFT+NGFRYFNLVL+TNVAGAGDI +V VKG+
Sbjct  138  MFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRYFNLVLITNVAGAGDIVRVSVKGA  197

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             T W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS NVAPA+WQFGQTF GKNFR
Sbjct  198  NTGWMPMSRNWGQNWQSNADLVGQTLSFRVTGSDRRTSTSHNVAPADWQFGQTFTGKNFR  257



>ref|XP_010931278.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A7 [Elaeis guineensis]
Length=258

 Score =   402 bits (1034),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 189/237 (80%), Positives = 215/237 (91%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARI GV++GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN+G S
Sbjct  21   ARIMGVFTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNDGQS  80

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFEIKC ++ + C PG+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFL
Sbjct  81   CGACFEIKCVDEPQWCHPGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFL  140

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+TNVAGAGDI +V VKGSRT 
Sbjct  141  KIAEYRAGIVPVSYRRVPCRKPGGIRFTINGFQYFNLVLITNVAGAGDIVRVSVKGSRTG  200

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W+ +SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PANWQFGQTF GKNF+
Sbjct  201  WMPMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTTTSWNIVPANWQFGQTFAGKNFQ  257



>emb|CAH18933.1| expansin [Pyrus communis]
Length=258

 Score =   402 bits (1034),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 192/238 (81%), Positives = 214/238 (90%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
            +ARIPGVY+GG W+ AHATFYGG DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  20   NARIPGVYTGGPWEGAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  79

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC +D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLAMPMF
Sbjct  80   SCGACFEIKCGDDPRWCHPGNPSILVTATNFCPPNFAQPSDDGGWCNPPRTHFDLAMPMF  139

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA Y+AGIVPV++RR+PCRKQGG+RFT+NGFRYFNLVL+TNVAGAGDI +V VKG+ T
Sbjct  140  LKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRYFNLVLITNVAGAGDIVRVSVKGANT  199

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS NVAPA+WQFGQTF GKNFR
Sbjct  200  GWMPMSRNWGQNWQSNADLVGQTLSFRVTGSDRRTSTSHNVAPADWQFGQTFTGKNFR  257



>ref|XP_006288496.1| hypothetical protein CARUB_v10001761mg [Capsella rubella]
 gb|EOA21394.1| hypothetical protein CARUB_v10001761mg [Capsella rubella]
Length=258

 Score =   402 bits (1034),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 190/239 (79%), Positives = 213/239 (89%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            VHARIPGVY+GG W  AHATFYGGADASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  19   VHARIPGVYTGGPWVNAHATFYGGADASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  78

Query  537  LSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCG+CFE+KC ND   C PGNPSI +TATNFCPPNFA  +DNGGWCNPPR HFDLAMPM
Sbjct  79   LSCGSCFELKCINDPGWCLPGNPSILITATNFCPPNFAQASDNGGWCNPPREHFDLAMPM  138

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FL IA Y+AGIVPV++RRIPCRK+GGIRFT+NGF++FNLVLVTNVAGAGD++KV VKG+ 
Sbjct  139  FLSIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKFFNLVLVTNVAGAGDVRKVSVKGTN  198

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            T W+ LSRNWGQNW+++A LVGQSLSFRV+ SD R  TS N+AP+NWQFGQT+ GKNFR
Sbjct  199  TQWLDLSRNWGQNWQSNAVLVGQSLSFRVKTSDGRSSTSNNIAPSNWQFGQTYSGKNFR  257



>ref|XP_010532011.1| PREDICTED: expansin-A4-like [Tarenaya hassleriana]
Length=261

 Score =   402 bits (1034),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 189/237 (80%), Positives = 214/237 (90%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPGVYSGGAWQ+AHATFYGG DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG S
Sbjct  24   ARIPGVYSGGAWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFS  83

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFEIKC++D + C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPR HFDLAMPMFL
Sbjct  84   CGACFEIKCADDPQWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRAHFDLAMPMFL  143

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            K+A YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  VKGS+T 
Sbjct  144  KLAEYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRASVKGSKTG  203

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W+++SRNWGQNW+++A L GQSLSFRV  SDRR  TSWN+ P++WQFGQTF GKNFR
Sbjct  204  WMSMSRNWGQNWQSNAVLAGQSLSFRVTGSDRRSSTSWNIVPSHWQFGQTFVGKNFR  260



>ref|XP_009388613.1| PREDICTED: expansin-A7 [Musa acuminata subsp. malaccensis]
Length=258

 Score =   402 bits (1034),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 186/237 (78%), Positives = 213/237 (90%), Gaps = 1/237 (0%)
 Frame = -3

Query  708  RIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  529
            RIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN G SC
Sbjct  22   RIPGVYTGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALSTALFNEGQSC  81

Query  528  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  352
            G+CFEIKC++D R C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDL+MPMFLK
Sbjct  82   GSCFEIKCADDPRWCHGGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLSMPMFLK  141

Query  351  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  172
            IA YRAGIVPV+FRR+PCRK GGIRFT+NGF+YFNLVL+TNVAGAGD+ +  VKGSRT W
Sbjct  142  IAEYRAGIVPVSFRRVPCRKSGGIRFTINGFQYFNLVLITNVAGAGDLVRASVKGSRTEW  201

Query  171  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            + +SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+ W+FGQTF+GKNFR 
Sbjct  202  MPMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSTWEFGQTFEGKNFRV  258



>ref|XP_009141827.1| PREDICTED: expansin-A4-like [Brassica rapa]
Length=258

 Score =   402 bits (1033),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 189/241 (78%), Positives = 214/241 (89%), Gaps = 1/241 (0%)
 Frame = -3

Query  723  TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  544
            T   A+IPGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTALFN
Sbjct  17   TLTDAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFN  76

Query  543  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  367
            +G+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNFA  +DNGGWCNPPR HFDLAM
Sbjct  77   SGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPRAHFDLAM  136

Query  366  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  187
            P+FLKIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNL L+TNVAGAGDI +  VKG
Sbjct  137  PVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLFLITNVAGAGDIVRTSVKG  196

Query  186  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNF  7
            SRT W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+NWQFGQTF GKNF
Sbjct  197  SRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQTFVGKNF  256

Query  6    R  4
            R
Sbjct  257  R  257



>emb|CDY24952.1| BnaC03g22200D [Brassica napus]
Length=258

 Score =   402 bits (1033),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 189/237 (80%), Positives = 213/237 (90%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTALFNNG+S
Sbjct  21   ARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMS  80

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFE+KC+ND + C  G+PSI +TATNFCPPNFA  +DNGGWCNPPR HFDLAMP+FL
Sbjct  81   CGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPREHFDLAMPVFL  140

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV++RR+PCRK+GGIRFT+NG +YFNLVL+TNVAGAGDI +  VKGSRT 
Sbjct  141  KIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHQYFNLVLITNVAGAGDIVRTSVKGSRTG  200

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+NWQFGQTF GKNFR
Sbjct  201  WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQTFVGKNFR  257



>gb|ACT67493.1| expansin A1 [Raphanus sativus]
Length=258

 Score =   402 bits (1033),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 188/237 (79%), Positives = 214/237 (90%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            A+IPGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTALFN+G+S
Sbjct  21   AKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGMS  80

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFE+KC+ND + C  G+PSI +TATNFCPPNFA  +DNGGWCNPPR HFDLAMP+FL
Sbjct  81   CGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPRAHFDLAMPVFL  140

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  VKGSRT 
Sbjct  141  KIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTSVKGSRTG  200

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+NWQFGQT+ GKNFR
Sbjct  201  WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQTYVGKNFR  257



>ref|XP_009143296.1| PREDICTED: expansin-A4-like [Brassica rapa]
Length=256

 Score =   402 bits (1033),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 188/237 (79%), Positives = 214/237 (90%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            A+IPGVYSGGAW+TAHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTALFNNG+S
Sbjct  19   AKIPGVYSGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMS  78

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFE+KC+ND + C  G+PSI +TATNFCPPNFA  +DNGGWCNPPR HFDLAMP+FL
Sbjct  79   CGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPRAHFDLAMPVFL  138

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  VKG+RT 
Sbjct  139  KIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTSVKGTRTG  198

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+NWQFGQTF GKNFR
Sbjct  199  WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQTFVGKNFR  255



>ref|NP_181500.1| expansin A4 [Arabidopsis thaliana]
 sp|O48818.1|EXPA4_ARATH RecName: Full=Expansin-A4; Short=AtEXPA4; AltName: Full=Alpha-expansin-4; 
Short=At-EXP4; Short=AtEx4; AltName: Full=Ath-ExpAlpha-1.6; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK95263.1|AF410277_1 At2g39700/F17A14.7 [Arabidopsis thaliana]
 gb|AAB97125.1| putative expansin [Arabidopsis thaliana]
 gb|AAL32761.1| putative expansin [Arabidopsis thaliana]
 gb|AAM13337.1| putative expansin [Arabidopsis thaliana]
 gb|AEC09708.1| expansin A4 [Arabidopsis thaliana]
Length=257

 Score =   402 bits (1032),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 188/237 (79%), Positives = 213/237 (90%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPG+YSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTALFNNG+S
Sbjct  20   ARIPGIYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMS  79

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFE+KC+ND + C  G+PSI +TATNFCPPN A P+DNGGWCNPPR HFDLAMP+FL
Sbjct  80   CGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSDNGGWCNPPREHFDLAMPVFL  139

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  VKGSRT 
Sbjct  140  KIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRASVKGSRTG  199

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W++LSRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWN+ P+NWQFGQTF GKNFR
Sbjct  200  WMSLSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNMVPSNWQFGQTFVGKNFR  256



>ref|XP_002881669.1| ATEXPA4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57928.1| ATEXPA4 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   401 bits (1031),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 189/237 (80%), Positives = 212/237 (89%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPGVYSG AWQ AHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTALFNNG+S
Sbjct  20   ARIPGVYSGSAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMS  79

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFE+KC+ND + C  G+PSI +TATNFCPPN A P+DNGGWCNPPR HFDLAMP+FL
Sbjct  80   CGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSDNGGWCNPPREHFDLAMPVFL  139

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  VKGSRT 
Sbjct  140  KIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRASVKGSRTG  199

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+NWQFGQTF GKNFR
Sbjct  200  WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNMVPSNWQFGQTFVGKNFR  256



>ref|XP_004981242.1| PREDICTED: expansin-A7-like [Setaria italica]
Length=262

 Score =   401 bits (1031),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 191/238 (80%), Positives = 210/238 (88%), Gaps = 3/238 (1%)
 Frame = -3

Query  708  RIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  529
            RIPGVY GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALSTALFN G SC
Sbjct  24   RIPGVYGGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNEGQSC  83

Query  528  GACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            GACFEIKC N    R C PG+PSI VTATNFCPPN+ALP+D+GGWCNPPRPHFDLAMPMF
Sbjct  84   GACFEIKCENQPGWRWCHPGSPSILVTATNFCPPNYALPSDDGGWCNPPRPHFDLAMPMF  143

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            L IA YRAGIVPV++RR+PCRK GGIRFT+NGFRYFNLVL+TNVAGAGDI +  VKGS T
Sbjct  144  LHIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFRYFNLVLITNVAGAGDIVRASVKGSGT  203

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+ +SRNWGQNW+++A LVG +LSFRV  SDRR  TSWN AP NWQFGQTF+GKNFR
Sbjct  204  GWLPMSRNWGQNWQSNAILVGDALSFRVTGSDRRTSTSWNAAPRNWQFGQTFEGKNFR  261



>ref|XP_009381075.1| PREDICTED: expansin-A7-like [Musa acuminata subsp. malaccensis]
Length=258

 Score =   401 bits (1030),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 186/237 (78%), Positives = 213/237 (90%), Gaps = 1/237 (0%)
 Frame = -3

Query  708  RIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  529
            RIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALF+ G SC
Sbjct  22   RIPGVYTGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFDEGQSC  81

Query  528  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  352
            GACFEIKC++D R C PG+PSIF+TATNFCPPN+AL  DNGGWCNPPRPHFDL+MPMFLK
Sbjct  82   GACFEIKCADDPRWCHPGSPSIFITATNFCPPNYALAPDNGGWCNPPRPHFDLSMPMFLK  141

Query  351  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  172
            IA YRAGIVPV++RR+PCR+ GGIRFT+NGF+YFNLVL+TNVAGAGDI +  VKGSRT W
Sbjct  142  IAEYRAGIVPVSYRRVPCRRSGGIRFTINGFQYFNLVLITNVAGAGDIVRASVKGSRTGW  201

Query  171  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            + +SRNWGQNW+++A LVGQ LSFRV  SDRR  TSWN+ P+NWQFGQTF+GKN+RA
Sbjct  202  MPMSRNWGQNWQSNAVLVGQPLSFRVTGSDRRTSTSWNIVPSNWQFGQTFEGKNYRA  258



>ref|XP_009409019.1| PREDICTED: expansin-A4-like [Musa acuminata subsp. malaccensis]
Length=257

 Score =   401 bits (1030),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 186/239 (78%), Positives = 214/239 (90%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V ARIPG+Y+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN G
Sbjct  18   VTARIPGLYAGGQWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALSTALFNEG  77

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
             SCGACFEIKC+ D + C  G+PSIF+TATNFCPPN+ALP+D+GGWCNPPRPHFDL+MPM
Sbjct  78   QSCGACFEIKCAGDPQWCHGGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLSMPM  137

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV++RR+PCR+ GGIRFT+NGF+YFNLVL+TNVAGAGDI +  VKGSR
Sbjct  138  FLKIAEYRAGIVPVSYRRVPCRRSGGIRFTINGFKYFNLVLITNVAGAGDIVRASVKGSR  197

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            T W+ +SRNWGQNW+++A LVGQSLSFR+  SDRR  TSWN+ P+NWQFGQTF+GKNFR
Sbjct  198  TGWMPMSRNWGQNWQSNAVLVGQSLSFRLTGSDRRTSTSWNIVPSNWQFGQTFEGKNFR  256



>dbj|BAH36862.1| alpha expansin [Rosa hybrid cultivar]
Length=258

 Score =   401 bits (1030),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 188/238 (79%), Positives = 215/238 (90%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
            +ARIPG Y+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  20   NARIPGPYTGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  79

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEI+C +D R C+PG PSIFVTATNFCPPNFA P+DNGGWCNPPR HFDLAMPMF
Sbjct  80   SCGACFEIRCGDDPRWCTPGKPSIFVTATNFCPPNFAQPSDNGGWCNPPRTHFDLAMPMF  139

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA Y+AGIVPV++RR+PCRK+GGIRFT+NG +YFNLVL+TNVAGAGD+  V VKG+ T
Sbjct  140  LKIAEYKAGIVPVSYRRVPCRKRGGIRFTINGHKYFNLVLITNVAGAGDVVSVSVKGTNT  199

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+ +SRNWGQNW++++ LVGQ+LSFRVR SDRR  T++NVAPANWQFGQT+ GKNFR
Sbjct  200  GWMPMSRNWGQNWQSNSVLVGQALSFRVRGSDRRSSTTYNVAPANWQFGQTYSGKNFR  257



>ref|XP_006294843.1| hypothetical protein CARUB_v10023894mg [Capsella rubella]
 gb|EOA27741.1| hypothetical protein CARUB_v10023894mg [Capsella rubella]
Length=257

 Score =   401 bits (1030),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 188/237 (79%), Positives = 213/237 (90%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTALFNNG+S
Sbjct  20   ARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMS  79

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFE+KC+ND + C  G+PSI +TATNFCPPN A P+DNGGWCNPPR HFDLAMP+FL
Sbjct  80   CGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSDNGGWCNPPREHFDLAMPVFL  139

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNL+L+TNVAGAGDI +  VKGSRT 
Sbjct  140  KIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLILITNVAGAGDIVRANVKGSRTG  199

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W++LSRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWN+ P+NWQFGQTF GKNFR
Sbjct  200  WMSLSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNMVPSNWQFGQTFVGKNFR  256



>dbj|BAE06067.1| expansin [Sagittaria pygmaea]
Length=266

 Score =   401 bits (1031),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 190/240 (79%), Positives = 210/240 (88%), Gaps = 1/240 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V AR+PGVYSG  WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN G
Sbjct  27   VDARVPGVYSGSEWQQAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALSTALFNQG  86

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFEIKC+ND + C  G PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPM
Sbjct  87   LSCGACFEIKCANDPQWCHGGGPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPM  146

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV +RR+PCRK GGIRFT+NG RYFNLVL+TNVAGAGDI +V VKG++
Sbjct  147  FLKIAQYRAGIVPVQYRRVPCRKSGGIRFTINGHRYFNLVLITNVAGAGDIVRVSVKGTK  206

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            T W+ +SRNWGQNW+++A LVGQ+LSFRV  SD R  TSWNV PANW FGQTF GKNFR 
Sbjct  207  TGWMPMSRNWGQNWQSNAVLVGQALSFRVTGSDHRTSTSWNVVPANWNFGQTFSGKNFRV  266



>ref|NP_001288961.1| expansin-A4 precursor [Brassica rapa]
 gb|AGM16346.1| alpha-expansin protein 4 [Brassica rapa]
Length=258

 Score =   400 bits (1029),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 188/237 (79%), Positives = 213/237 (90%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTALFNNG+S
Sbjct  21   ARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMS  80

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFE+KC+ND + C  G+PSI +TATNFCPPNFA  +DNGGWCNPPR HFDLAMP+FL
Sbjct  81   CGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPREHFDLAMPVFL  140

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  VKGS+T 
Sbjct  141  KIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTSVKGSKTG  200

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSW++ P+NWQFGQTF GKNFR
Sbjct  201  WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWSIVPSNWQFGQTFVGKNFR  257



>emb|CDY69611.1| BnaCnng64440D [Brassica napus]
Length=258

 Score =   400 bits (1029),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 188/237 (79%), Positives = 213/237 (90%), Gaps = 1/237 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTALFNNG+S
Sbjct  21   ARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMS  80

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFE+KC+ND + C  G+PSI +TATNFCPPNFA  +DNGGWCNPPR HFDLAMP+FL
Sbjct  81   CGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPREHFDLAMPVFL  140

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  VKGS+T 
Sbjct  141  KIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTSVKGSKTG  200

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSW++ P+NWQFGQTF GKNFR
Sbjct  201  WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWSIVPSNWQFGQTFVGKNFR  257



>gb|ACA05164.1| expansin 1 [Dimocarpus longan]
Length=256

 Score =   400 bits (1028),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 191/239 (80%), Positives = 212/239 (89%), Gaps = 1/239 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
            +A+IPGVY+G  W++ HATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN+GL
Sbjct  18   NAKIPGVYTGSPWESGHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNSGL  77

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFE+KC  D R C PGNPSI VTATNFCPPNFA P+DNGGWCNPPR HFDLAMPMF
Sbjct  78   SCGACFELKCVADPRWCLPGNPSILVTATNFCPPNFAQPSDNGGWCNPPRTHFDLAMPMF  137

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
              IA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI KV VKGS T
Sbjct  138  FAIAQYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKVSVKGSNT  197

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
             W+T+SRNWGQNW+++A L+GQ+LSFRV  SDRR  TSWNVA +NWQFGQTF GKNFR 
Sbjct  198  GWLTMSRNWGQNWQSNAVLLGQALSFRVTGSDRRTSTSWNVAKSNWQFGQTFIGKNFRV  256



>ref|XP_008240857.1| PREDICTED: expansin-A6-like [Prunus mume]
Length=258

 Score =   400 bits (1028),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 188/240 (78%), Positives = 215/240 (90%), Gaps = 1/240 (0%)
 Frame = -3

Query  720  AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  541
            A +ARI G  +GG W+ AHATFYGG+DASGTMGGACGYGNLYS+GYGVN AALSTALFNN
Sbjct  18   AANARIRGFDTGGPWEGAHATFYGGSDASGTMGGACGYGNLYSEGYGVNTAALSTALFNN  77

Query  540  GLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  364
            GLSCGACFEIKC +D + C PGNPSIF+TATNFCPPN+ALPND+GGWCNPPR HFDLAMP
Sbjct  78   GLSCGACFEIKCGDDPKWCHPGNPSIFITATNFCPPNYALPNDDGGWCNPPRTHFDLAMP  137

Query  363  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  184
            MFL+IA Y+AGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVL+TNVAGAGDI +V VKG+
Sbjct  138  MFLQIAEYKAGIVPVSFRRVPCRKEGGVRFTINGFRYFNLVLITNVAGAGDIVRVSVKGA  197

Query  183  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             T W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWNVAP +WQFGQTF GKNFR
Sbjct  198  NTEWMPMSRNWGQNWQSNADLVGQTLSFRVTGSDRRTSTSWNVAPGHWQFGQTFSGKNFR  257



>ref|XP_002878036.1| ATEXPA16 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54295.1| ATEXPA16 [Arabidopsis lyrata subsp. lyrata]
Length=260

 Score =   400 bits (1028),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 189/238 (79%), Positives = 211/238 (89%), Gaps = 1/238 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            A IPGVYSGG+WQTAHATFYGG DASGTMGGACGYGNLYSQGYG N AALSTALFN+G S
Sbjct  23   AGIPGVYSGGSWQTAHATFYGGNDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGQS  82

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFEIKC ND + C PGNPS+FVTATNFCPPN A P+DNGGWCNPPR HFDLAMP+FL
Sbjct  83   CGACFEIKCVNDPKWCHPGNPSVFVTATNFCPPNLAQPSDNGGWCNPPRSHFDLAMPVFL  142

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVP+++RR+ CRK GGIRFT+NG RYFNLVL+TNVAGAGDI +  VKGS+T 
Sbjct  143  KIAEYRAGIVPISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDILRTSVKGSKTG  202

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            W++L+RNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+AP+NWQFGQTF GKNFR 
Sbjct  203  WMSLTRNWGQNWQSNAVLVGQSLSFRVTTSDRRTSTSWNIAPSNWQFGQTFVGKNFRV  260



>ref|XP_009398502.1| PREDICTED: expansin-A7-like [Musa acuminata subsp. malaccensis]
Length=258

 Score =   400 bits (1028),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 186/236 (79%), Positives = 212/236 (90%), Gaps = 1/236 (0%)
 Frame = -3

Query  708  RIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  529
            RIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN G SC
Sbjct  22   RIPGVYTGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNEGQSC  81

Query  528  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  352
            GACFEIKC+ D + C  G+PSIF+TATNFCPPN+ALP+D+GGWCNPPRPHFDLAMP FLK
Sbjct  82   GACFEIKCAEDPQWCHRGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLAMPAFLK  141

Query  351  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  172
            IA YRAGIVPV+FRR+PCRK GGIRFT++GF+YFNLVL+TNVAGAGDI +V VKGSRT W
Sbjct  142  IAEYRAGIVPVSFRRVPCRKSGGIRFTIHGFKYFNLVLITNVAGAGDIVRVSVKGSRTGW  201

Query  171  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            + +SRNWGQNW+++A LVG+SLSFRV  SDRR  TSWN+ P+ WQFGQTF+GKNFR
Sbjct  202  MPMSRNWGQNWQSNAVLVGESLSFRVTGSDRRTSTSWNIVPSTWQFGQTFEGKNFR  257



>gb|ABN09939.1| expansin A4 [Musa acuminata AAA Group]
Length=258

 Score =   399 bits (1026),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 186/236 (79%), Positives = 211/236 (89%), Gaps = 1/236 (0%)
 Frame = -3

Query  708  RIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  529
            RIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN G SC
Sbjct  22   RIPGVYTGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNEGQSC  81

Query  528  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  352
            GACFEIKC+ D + C  G+PSIF+TATNFCPPN+ALP+D+GGWCNPPRPHFDLAMP FLK
Sbjct  82   GACFEIKCAEDPQWCHRGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLAMPAFLK  141

Query  351  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  172
            IA YRAGIVPV+FRR+PCRK GGIRFT++GF+YFNLVL+TNVAGAGDI +  VKGSRT W
Sbjct  142  IAEYRAGIVPVSFRRVPCRKSGGIRFTIHGFKYFNLVLITNVAGAGDIVRASVKGSRTGW  201

Query  171  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            + +SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+ WQFGQTF+GKNFR
Sbjct  202  MPMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSTWQFGQTFEGKNFR  257



>ref|XP_010414459.1| PREDICTED: expansin-A6-like [Camelina sativa]
Length=257

 Score =   399 bits (1026),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 220/240 (92%), Gaps = 1/240 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            + ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  18   IEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  77

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
             SCGACFE+KC++D R C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPRPHFDLAMPM
Sbjct  78   FSCGACFELKCASDPRWCHSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPM  137

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV+FRR+PCRK+GGIRFT+NGFRYFNLVLVTNVAGAG+I ++ VKG+ 
Sbjct  138  FLKIAEYRAGIVPVSFRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGNIVRLGVKGTH  197

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            T W+++SRNWGQNW++++ LVGQSLSFRV +SDRR  TSWN+APANWQFGQTF GKNFR 
Sbjct  198  TSWMSMSRNWGQNWQSNSVLVGQSLSFRVTSSDRRSSTSWNIAPANWQFGQTFMGKNFRV  257



>ref|XP_010558331.1| PREDICTED: expansin-A9 [Tarenaya hassleriana]
Length=268

 Score =   400 bits (1027),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 189/239 (79%), Positives = 211/239 (88%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V A+IPGVYSGG W  AHATFYGGADASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  28   VDAKIPGVYSGGPWIDAHATFYGGADASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  87

Query  537  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFE+KC +D R C PGNPSI +TATNFCPPNFA  +DNGGWCNPPR HFDLAMPM
Sbjct  88   LSCGACFELKCIDDPRWCLPGNPSILITATNFCPPNFAQASDNGGWCNPPREHFDLAMPM  147

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLK+A Y+AGIVPV++RR+PCRK+GGIRFT+NGF+YFNLVLVTNVAGAGD+ KV VKG+ 
Sbjct  148  FLKLAQYKAGIVPVSYRRVPCRKKGGIRFTINGFKYFNLVLVTNVAGAGDVVKVSVKGTN  207

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            T WIT+SRNWGQNW+++A LVGQ+LSFRV  SD R   S N+AP +WQFGQTF GKNFR
Sbjct  208  TEWITMSRNWGQNWQSNAVLVGQALSFRVTTSDGRSSASKNIAPPSWQFGQTFSGKNFR  266



>ref|XP_004505858.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=257

 Score =   399 bits (1026),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 218/240 (91%), Gaps = 1/240 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V ARIPG+YSGG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  18   VEARIPGLYSGGQWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  77

Query  537  LSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM
Sbjct  78   LSCGACFEIKCANDREWCHSGSPSIFITATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  137

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FLKIA YRAGIVPV FRR+PCRK GGIRFTVNGFRYFNLVL++NVAGAGDI +  VKG+R
Sbjct  138  FLKIAEYRAGIVPVAFRRVPCRKHGGIRFTVNGFRYFNLVLISNVAGAGDIVRAYVKGTR  197

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            T W+ LSRNWGQNW+++A LVGQSLSFRV +SDRR  TSWN+AP +WQFGQTF GKNFR 
Sbjct  198  TGWMPLSRNWGQNWQSNAVLVGQSLSFRVSSSDRRSSTSWNIAPPSWQFGQTFTGKNFRV  257



>ref|XP_004302749.1| PREDICTED: expansin-A6 [Fragaria vesca subsp. vesca]
Length=260

 Score =   399 bits (1025),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 189/238 (79%), Positives = 213/238 (89%), Gaps = 1/238 (0%)
 Frame = -3

Query  714  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  535
            +ARIPG Y+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  22   NARIPGPYTGGPWQEAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  81

Query  534  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  358
            SCGACFEIKC +D R C+ G PSIFVTATNFCPPNFA P+DNGGWCNPPR HFDLAMPMF
Sbjct  82   SCGACFEIKCGDDPRWCTAGKPSIFVTATNFCPPNFAQPSDNGGWCNPPRTHFDLAMPMF  141

Query  357  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  178
            LKIA Y+AGIVPV++RR+PC K+GGIRFT+NG +YFNLVLVTNVAGAGDI  V VKG+ T
Sbjct  142  LKIAEYKAGIVPVSYRRVPCVKKGGIRFTINGHKYFNLVLVTNVAGAGDIVSVSVKGTNT  201

Query  177  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
             W+ +SRNWGQNW++++ LVGQ+LSFRVR SDRR  T++NVAPANWQFGQT+ GKNFR
Sbjct  202  GWMPMSRNWGQNWQSNSVLVGQALSFRVRGSDRRSSTTYNVAPANWQFGQTYSGKNFR  259



>ref|XP_010505648.1| PREDICTED: expansin-A4 [Camelina sativa]
Length=257

 Score =   399 bits (1024),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 187/238 (79%), Positives = 212/238 (89%), Gaps = 1/238 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPGVYSG +WQ AHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTALFNNG+S
Sbjct  20   ARIPGVYSGSSWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMS  79

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFE+KC+ND + C  G+PSI +TATNFCPPN A P+DNGGWCNPPR HFDLAMP+FL
Sbjct  80   CGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSDNGGWCNPPREHFDLAMPVFL  139

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNL+L+TNVAGAGDI +  VKGSRT 
Sbjct  140  KIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLILITNVAGAGDIVRANVKGSRTG  199

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+NWQFGQTF GKNFR 
Sbjct  200  WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNMVPSNWQFGQTFVGKNFRV  257



>ref|XP_010452058.1| PREDICTED: expansin-A9-like [Camelina sativa]
Length=258

 Score =   399 bits (1024),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 188/239 (79%), Positives = 213/239 (89%), Gaps = 1/239 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V+A+IPGVY+GG W  AHATFYGGADASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  19   VNAKIPGVYNGGPWINAHATFYGGADASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  78

Query  537  LSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCG+CFE+KC ND   C PGNPSI +TATNFCPPNFA  +DNGGWCNPPR HFDLAMPM
Sbjct  79   LSCGSCFELKCVNDPGWCLPGNPSILITATNFCPPNFAQASDNGGWCNPPREHFDLAMPM  138

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FL IA Y+AGIVPV++RRIPCRK+GGIRFT+NGF++FNLVLVTNVAGAGD++KV VKG+ 
Sbjct  139  FLSIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKFFNLVLVTNVAGAGDVRKVSVKGTN  198

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFR  4
            T W+ LSRNWGQNW+++A LVGQSLSFRV+ SD R  TS N+AP+NWQFGQT+ GKNFR
Sbjct  199  TQWLDLSRNWGQNWQSNAVLVGQSLSFRVKTSDGRSSTSNNIAPSNWQFGQTYSGKNFR  257



>ref|XP_010517323.1| PREDICTED: expansin-A4-like [Camelina sativa]
Length=257

 Score =   399 bits (1024),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 187/238 (79%), Positives = 212/238 (89%), Gaps = 1/238 (0%)
 Frame = -3

Query  711  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  532
            ARIPGVYSG +WQ AHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTALFNNG+S
Sbjct  20   ARIPGVYSGSSWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMS  79

Query  531  CGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  355
            CGACFE+KC+ND + C  G+PSI +TATNFCPPN A P+DNGGWCNPPR HFDLAMP+FL
Sbjct  80   CGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSDNGGWCNPPREHFDLAMPVFL  139

Query  354  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  175
            KIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNL+L+TNVAGAGDI +  VKGSRT 
Sbjct  140  KIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLILITNVAGAGDIVRANVKGSRTG  199

Query  174  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+NWQFGQTF GKNFR 
Sbjct  200  WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNMVPSNWQFGQTFVGKNFRV  257



>ref|XP_010423881.1| PREDICTED: expansin-A9-like [Camelina sativa]
Length=258

 Score =   399 bits (1024),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 188/240 (78%), Positives = 213/240 (89%), Gaps = 1/240 (0%)
 Frame = -3

Query  717  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  538
            V+A+IPGVY+GG W  AHATFYGGADASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  19   VNAKIPGVYNGGPWVNAHATFYGGADASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  78

Query  537  LSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  361
            LSCG+CFE+KC ND   C PGNPSI +TATNFCPPNFA  +DNGGWCNPPR HFDLAMPM
Sbjct  79   LSCGSCFELKCVNDPGWCLPGNPSILITATNFCPPNFAQASDNGGWCNPPREHFDLAMPM  138

Query  360  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSR  181
            FL IA Y+AGIVPV++RRIPCRK+GGIRFT+NGF++FNLVLVTNVAGAGD++KV VKG+ 
Sbjct  139  FLSIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKFFNLVLVTNVAGAGDVRKVSVKGTN  198

Query  180  TPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPANWQFGQTFQGKNFRA  1
            T W+ LSRNWGQNW+++A LVGQSLSFRV+ SD R  TS N+AP+NWQFGQT+ GKNFR 
Sbjct  199  TQWLDLSRNWGQNWQSNAVLVGQSLSFRVKTSDGRSSTSNNIAPSNWQFGQTYSGKNFRV  258



Lambda      K        H        a         alpha
   0.313    0.136    0.414    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1287001441440