BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF023B23

Length=577
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP10596.1|  unnamed protein product                                129   7e-31   Coffea canephora [robusta coffee]
ref|XP_009787672.1|  PREDICTED: BEL1-like homeodomain protein 1         124   2e-29   Nicotiana sylvestris
ref|XP_009628712.1|  PREDICTED: BEL1-like homeodomain protein 1         122   9e-29   Nicotiana tomentosiformis
ref|XP_011094236.1|  PREDICTED: BEL1-like homeodomain protein 1         120   1e-27   
gb|ACD39466.1|  BEL29 protein                                           105   4e-23   Solanum palustre
gb|EPS58511.1|  hypothetical protein M569_16303                         103   6e-23   Genlisea aurea
ref|XP_004228612.1|  PREDICTED: BEL1-like homeodomain protein 1         104   3e-22   Solanum lycopersicum
ref|XP_007204250.1|  hypothetical protein PRUPE_ppa002158mg             102   1e-21   
ref|XP_006348466.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    102   1e-21   Solanum tuberosum [potatoes]
ref|XP_008241058.1|  PREDICTED: BEL1-like homeodomain protein 1         102   1e-21   Prunus mume [ume]
ref|XP_008367359.1|  PREDICTED: BEL1-like homeodomain protein 1       99.0    3e-21   
gb|AAN03626.1|AF406702_1  BEL1-related homeotic protein 29              100   4e-21   Solanum tuberosum [potatoes]
ref|XP_006430060.1|  hypothetical protein CICLE_v10011201mg             101   4e-21   
gb|KDO70617.1|  hypothetical protein CISIN_1g005514mg                   100   5e-21   Citrus sinensis [apfelsine]
gb|KJB16539.1|  hypothetical protein B456_002G234900                    100   7e-21   Gossypium raimondii
gb|KHG01894.1|  BEL1-like homeodomain protein 1                         100   7e-21   Gossypium arboreum [tree cotton]
gb|ACD39469.1|  BEL29 protein                                         98.6    2e-20   Solanum etuberosum
ref|XP_006481599.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  99.0    2e-20   Citrus sinensis [apfelsine]
gb|KDP36113.1|  hypothetical protein JCGZ_08757                       99.0    2e-20   Jatropha curcas
ref|XP_010059079.1|  PREDICTED: BEL1-like homeodomain protein 1       98.6    3e-20   Eucalyptus grandis [rose gum]
ref|XP_009348973.1|  PREDICTED: BEL1-like homeodomain protein 1       98.6    3e-20   Pyrus x bretschneideri [bai li]
ref|XP_008391977.1|  PREDICTED: BEL1-like homeodomain protein 1       98.6    4e-20   
ref|XP_008360598.1|  PREDICTED: BEL1-like homeodomain protein 1       98.2    4e-20   
ref|XP_002524053.1|  bel1 homeotic protein, putative                  98.2    4e-20   Ricinus communis
ref|XP_011042587.1|  PREDICTED: BEL1-like homeodomain protein 1       97.4    7e-20   Populus euphratica
ref|XP_007027982.1|  BEL1-like homeodomain protein 1 isoform 1        97.1    9e-20   
ref|XP_010247184.1|  PREDICTED: BEL1-like homeodomain protein 1       97.4    9e-20   
ref|XP_006381943.1|  hypothetical protein POPTR_0006s21950g           97.1    1e-19   
ref|XP_008387112.1|  PREDICTED: BEL1-like homeodomain protein 1       97.1    1e-19   
ref|XP_011021429.1|  PREDICTED: BEL1-like homeodomain protein 1       95.9    3e-19   Populus euphratica
ref|XP_002299773.2|  hypothetical protein POPTR_0001s22430g           95.5    4e-19   Populus trichocarpa [western balsam poplar]
gb|KHG11905.1|  BEL1-like homeodomain protein 1                       95.1    5e-19   Gossypium arboreum [tree cotton]
gb|KHG11906.1|  BEL1-like homeodomain protein 1                       94.7    6e-19   Gossypium arboreum [tree cotton]
ref|XP_011046419.1|  PREDICTED: BEL1-like homeodomain protein 1       94.4    8e-19   Populus euphratica
ref|XP_011003835.1|  PREDICTED: BEL1-like homeodomain protein 1       94.4    9e-19   Populus euphratica
ref|XP_006373820.1|  hypothetical protein POPTR_0016s07040g           94.4    1e-18   
ref|XP_010263012.1|  PREDICTED: BEL1-like homeodomain protein 1       94.4    1e-18   Nelumbo nucifera [Indian lotus]
gb|KHG12855.1|  BEL1-like homeodomain protein 1                       93.2    2e-18   Gossypium arboreum [tree cotton]
gb|KHG12856.1|  BEL1-like homeodomain protein 1                       92.8    3e-18   Gossypium arboreum [tree cotton]
gb|KHN10043.1|  BEL1-like homeodomain protein 1                       90.9    4e-18   Glycine soja [wild soybean]
ref|XP_011467196.1|  PREDICTED: BEL1-like homeodomain protein 1       90.9    1e-17   Fragaria vesca subsp. vesca
gb|KJB36260.1|  hypothetical protein B456_006G149100                  90.5    1e-17   Gossypium raimondii
ref|XP_003519115.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  90.5    2e-17   Glycine max [soybeans]
ref|XP_002266838.1|  PREDICTED: BEL1-like homeodomain protein 1       90.5    2e-17   Vitis vinifera
emb|CAN63083.1|  hypothetical protein VITISV_015358                   90.5    2e-17   Vitis vinifera
gb|KHN48417.1|  BEL1-like homeodomain protein 1                       88.6    4e-17   Glycine soja [wild soybean]
ref|XP_007145789.1|  hypothetical protein PHAVU_007G267900g           89.0    6e-17   Phaseolus vulgaris [French bean]
ref|XP_003535815.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  88.2    1e-16   Glycine max [soybeans]
gb|KJB62029.1|  hypothetical protein B456_009G396900                  87.8    1e-16   Gossypium raimondii
gb|EYU18114.1|  hypothetical protein MIMGU_mgv1a010011mg              84.0    5e-16   Erythranthe guttata [common monkey flower]
ref|XP_006854627.1|  hypothetical protein AMTR_s00030p00173920        85.9    7e-16   Amborella trichopoda
ref|XP_007132496.1|  hypothetical protein PHAVU_011G099100g           85.5    1e-15   Phaseolus vulgaris [French bean]
ref|XP_002275098.1|  PREDICTED: BEL1-like homeodomain protein 1       85.1    1e-15   Vitis vinifera
emb|CAN69527.1|  hypothetical protein VITISV_027380                   85.1    1e-15   Vitis vinifera
ref|XP_008442920.1|  PREDICTED: BEL1-like homeodomain protein 1       85.1    1e-15   Cucumis melo [Oriental melon]
ref|XP_004136516.1|  PREDICTED: BEL1-like homeodomain protein 1-like  83.2    6e-15   
ref|XP_004171976.1|  PREDICTED: BEL1-like homeodomain protein 1-like  83.2    6e-15   
gb|KHN33154.1|  BEL1-like homeodomain protein 1                       81.6    8e-15   Glycine soja [wild soybean]
ref|XP_010557975.1|  PREDICTED: BEL1-like homeodomain protein 1       82.8    8e-15   Tarenaya hassleriana [spider flower]
ref|XP_007015671.1|  BEL1 homeodomain 1, putative                     82.4    1e-14   
ref|XP_010543869.1|  PREDICTED: BEL1-like homeodomain protein 1 i...  81.6    2e-14   Tarenaya hassleriana [spider flower]
ref|XP_010107001.1|  BEL1-like homeodomain protein 1                  80.9    2e-14   
ref|XP_010543867.1|  PREDICTED: BEL1-like homeodomain protein 1 i...  81.6    2e-14   Tarenaya hassleriana [spider flower]
gb|AFK35661.1|  unknown                                               78.6    2e-14   Medicago truncatula
ref|XP_003521496.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  81.6    2e-14   Glycine max [soybeans]
gb|KHN08605.1|  BEL1-like homeodomain protein 1                       80.9    3e-14   Glycine soja [wild soybean]
ref|XP_003554466.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  80.9    3e-14   Glycine max [soybeans]
ref|XP_007162972.1|  hypothetical protein PHAVU_001G195800g           79.7    9e-14   Phaseolus vulgaris [French bean]
gb|KEH41936.1|  BEL1-related homeotic protein                         78.6    2e-13   Medicago truncatula
dbj|BAE71188.1|  BEL1-like homeodomain transcription factor           78.2    2e-13   Trifolium pratense [peavine clover]
ref|XP_008784116.1|  PREDICTED: BEL1-like homeodomain protein 1       77.0    5e-13   Phoenix dactylifera
ref|XP_007150022.1|  hypothetical protein PHAVU_005G119300g           77.0    6e-13   Phaseolus vulgaris [French bean]
ref|XP_010912386.1|  PREDICTED: BEL1-like homeodomain protein 1       75.1    2e-12   
ref|XP_004494251.1|  PREDICTED: BEL1-like homeodomain protein 1-like  74.7    3e-12   Cicer arietinum [garbanzo]
gb|KHN21192.1|  BEL1-like homeodomain protein 1                       73.6    8e-12   Glycine soja [wild soybean]
ref|XP_003540818.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  73.6    1e-11   Glycine max [soybeans]
gb|KEH29763.1|  BEL1-related homeotic protein                         72.4    2e-11   Medicago truncatula
gb|KEH24245.1|  BEL1-related homeotic protein                         72.0    3e-11   Medicago truncatula
emb|CBI24428.3|  unnamed protein product                              71.6    3e-11   Vitis vinifera
ref|XP_009629592.1|  PREDICTED: BEL1-like homeodomain protein 1       71.6    4e-11   Nicotiana tomentosiformis
gb|KJB35453.1|  hypothetical protein B456_006G115600                  71.6    4e-11   Gossypium raimondii
ref|XP_009778869.1|  PREDICTED: BEL1-like homeodomain protein 1       70.9    7e-11   Nicotiana sylvestris
gb|KHN17979.1|  BEL1-like homeodomain protein 1                       69.7    1e-10   Glycine soja [wild soybean]
ref|XP_003539486.1|  PREDICTED: BEL1-like homeodomain protein 1-like  69.7    1e-10   Glycine max [soybeans]
ref|XP_010521016.1|  PREDICTED: BEL1-like homeodomain protein 1       69.3    2e-10   Tarenaya hassleriana [spider flower]
ref|XP_010685441.1|  PREDICTED: BEL1-like homeodomain protein 1       69.3    2e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009420594.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...  68.6    4e-10   
ref|XP_003543416.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  67.8    6e-10   Glycine max [soybeans]
ref|XP_004497655.1|  PREDICTED: BEL1-like homeodomain protein 1-like  67.8    7e-10   Cicer arietinum [garbanzo]
gb|KJB55565.1|  hypothetical protein B456_009G082700                  66.2    2e-09   Gossypium raimondii
gb|KHF99976.1|  BEL1-like homeodomain protein 1                       66.2    2e-09   Gossypium arboreum [tree cotton]
gb|KJB09137.1|  hypothetical protein B456_001G125400                  65.5    4e-09   Gossypium raimondii
ref|XP_008799712.1|  PREDICTED: BEL1-like homeodomain protein 1       65.1    5e-09   Phoenix dactylifera
emb|CDX84171.1|  BnaC04g09330D                                        63.9    1e-08   
ref|XP_006494895.1|  PREDICTED: BEL1-like homeodomain protein 1-like  62.4    3e-08   Citrus sinensis [apfelsine]
emb|CDX75085.1|  BnaA05g08310D                                        62.4    3e-08   
gb|KDO46590.1|  hypothetical protein CISIN_1g005901mg                 62.4    3e-08   Citrus sinensis [apfelsine]
ref|XP_006424091.1|  hypothetical protein CICLE_v10027955mg           62.4    3e-08   Citrus clementina [clementine]
emb|CDY40420.1|  BnaA04g20970D                                        62.0    4e-08   Brassica napus [oilseed rape]
ref|XP_004506223.1|  PREDICTED: BEL1-like homeodomain protein 1-like  62.0    5e-08   Cicer arietinum [garbanzo]
emb|CDX84585.1|  BnaA03g16450D                                        61.6    6e-08   
ref|XP_009141535.1|  PREDICTED: BEL1-like homeodomain protein 1       61.6    6e-08   
emb|CDX79646.1|  BnaC03g19820D                                        61.6    7e-08   
ref|XP_009133059.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...  61.6    7e-08   
ref|XP_003539151.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  61.2    1e-07   Glycine max [soybeans]
ref|XP_008230296.1|  PREDICTED: BEL1-like homeodomain protein 1       60.5    2e-07   Prunus mume [ume]
ref|XP_006293790.1|  hypothetical protein CARUB_v10022772mg           60.1    2e-07   
gb|KHN19925.1|  BEL1-like homeodomain protein 1                       60.1    2e-07   Glycine soja [wild soybean]
ref|XP_010507571.1|  PREDICTED: BEL1-like homeodomain protein 1       58.2    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006410764.1|  hypothetical protein EUTSA_v10016349mg           59.3    4e-07   
gb|AEW09250.1|  hypothetical protein UMN_1142_01                      55.5    4e-07   Pinus lambertiana
emb|CDP15553.1|  unnamed protein product                              58.9    5e-07   Coffea canephora [robusta coffee]
gb|AEW09251.1|  hypothetical protein UMN_1142_01                      55.1    5e-07   Pinus radiata
ref|XP_002881420.1|  hypothetical protein ARALYDRAFT_482564           58.9    5e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_007208166.1|  hypothetical protein PRUPE_ppa002583mg           58.5    6e-07   Prunus persica
gb|AAK43836.1|AF353094_1  BEL1-like homeodomain 1                     58.5    6e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181138.1|  BEL1-like homeodomain 1                             58.5    6e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010516801.1|  PREDICTED: BEL1-like homeodomain protein 1       57.4    7e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010505121.1|  PREDICTED: BEL1-like homeodomain protein 1       58.2    8e-07   Camelina sativa [gold-of-pleasure]
ref|XP_007150021.1|  hypothetical protein PHAVU_005G119300g           58.2    8e-07   Phaseolus vulgaris [French bean]
ref|XP_010509532.1|  PREDICTED: BEL1-like homeodomain protein 1       58.2    9e-07   Camelina sativa [gold-of-pleasure]
gb|AFB32720.1|  hypothetical protein 0_17161_01                       54.7    1e-06   Larix decidua
emb|CDY32069.1|  BnaC04g44970D                                        56.6    2e-06   Brassica napus [oilseed rape]
ref|XP_010093716.1|  BEL1-like homeodomain protein 1                  55.1    6e-06   
ref|XP_010089795.1|  BEL1-like homeodomain protein 1                  54.7    1e-05   Morus notabilis
gb|AFB32721.1|  hypothetical protein 0_17161_01                       50.4    4e-05   Pinus mugo [mountain pine]
gb|AEW08020.1|  hypothetical protein 0_17161_01                       50.1    6e-05   Pinus lambertiana
gb|ACC77468.1|  BEL1                                                  52.4    8e-05   Kalanchoe x houghtonii
gb|AEW08021.1|  hypothetical protein 0_17161_01                       49.3    1e-04   Pinus radiata
ref|XP_010931060.1|  PREDICTED: BEL1-like homeodomain protein 1       49.7    6e-04   Elaeis guineensis
gb|AFB32724.1|  hypothetical protein 0_17161_01                       47.0    9e-04   Pinus mugo [mountain pine]



>emb|CDP10596.1| unnamed protein product [Coffea canephora]
Length=680

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 78/105 (74%), Gaps = 8/105 (8%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVV  407
            SYP+ ++GRF++EQFP PYS N VSLTLGL H ENLS  +   H NFLPN   Q+GRGV 
Sbjct  580  SYPIAEIGRFSSEQFPGPYSGNGVSLTLGLPHCENLS--ISGPHQNFLPNQNIQLGRGVE  637

Query  406  IGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            IG  EAND   G+ TPT +H TSV +N NIQNRKRF AQLLPDFV
Sbjct  638  IG--EAND-YGGLGTPTSSHSTSVYENINIQNRKRFAAQLLPDFV  679



>ref|XP_009787672.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009787673.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009787674.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
Length=707

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 79/108 (73%), Gaps = 11/108 (10%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNA-VSLTLGLQHSENLSAAMFATHHNFLPN-----QMGR  416
            SYP+ ++GRF+TEQF  PYST+  VSLTLGL HSENLS  M ATHH+FLP      QMGR
Sbjct  604  SYPIGEIGRFSTEQFSAPYSTSGTVSLTLGLPHSENLS--MSATHHSFLPIPTQSIQMGR  661

Query  415  GVVIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            GV IGEA   +    + TPT AH TSV +NFNIQNRKRF A LLPDFV
Sbjct  662  GVEIGEA---NEFGSLNTPTSAHSTSVYENFNIQNRKRFAAPLLPDFV  706



>ref|XP_009628712.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009628714.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009628715.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
Length=700

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 80/109 (73%), Gaps = 12/109 (11%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNA-VSLTLGLQHSENLSAAMFATHHNFLPN-----QMGR  416
            SYP+ ++GRF+TEQF  PYST+  VSLTLGL HSENLS  M ATHH+FLP      QMGR
Sbjct  596  SYPIGEIGRFSTEQFSAPYSTSGTVSLTLGLPHSENLS--MSATHHSFLPIPTQSIQMGR  653

Query  415  GVV-IGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            GVV IGEA   +    + TPT AH TSV +NFNIQNRKRF A LLPDFV
Sbjct  654  GVVEIGEA---NEFGSLNTPTSAHSTSVYENFNIQNRKRFAAPLLPDFV  699



>ref|XP_011094236.1| PREDICTED: BEL1-like homeodomain protein 1 [Sesamum indicum]
Length=710

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 72/105 (69%), Gaps = 8/105 (8%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVV  407
            SYP+ ++GRF TEQF  PYS N VSLTLGL H ENLS  M   H  FLP+   Q+GRGV 
Sbjct  610  SYPIGELGRFGTEQFQAPYSGNGVSLTLGLPHCENLS--MSGAHQTFLPSQSIQLGRGVE  667

Query  406  IGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            IG  E ND   GM T T  H T+V DN NIQNRKRF AQLLPDFV
Sbjct  668  IG--ETND-FGGMNTQTNTHSTNVYDNINIQNRKRFAAQLLPDFV  709



>gb|ACD39466.1| BEL29 protein [Solanum palustre]
Length=516

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 75/110 (68%), Gaps = 12/110 (11%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNA-VSLTLGLQHSENLSAAMFATHHNFLPN-----QMGR  416
            +YP+ ++ RF+TEQF  PYST   VSLTLGL H+ENLS  M ATHH+FLP      Q+GR
Sbjct  410  AYPIGEIARFSTEQFSAPYSTGGTVSLTLGLPHNENLS--MSATHHSFLPIPTQNIQIGR  467

Query  415  G-VVIGEAEANDXVAGMTTPTXAHPTS-VXDNFNIQNRKRFPAQLLPDFV  272
            G   IGE   N     + TPT AH TS V +NFNIQNRKRF A LLPDFV
Sbjct  468  GGAEIGEP--NHEFGSLNTPTSAHSTSSVYENFNIQNRKRFAAPLLPDFV  515



>gb|EPS58511.1| hypothetical protein M569_16303, partial [Genlisea aurea]
Length=298

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 70/111 (63%), Gaps = 11/111 (10%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHS--ENLSAAMFATHH---NFLPN---QM  422
            SYPM ++GR+T EQFP  YS N VSLTLGL HS  ENL       HH   NFLPN   Q+
Sbjct  191  SYPMAELGRYTAEQFPAAYSGNGVSLTLGLPHSHCENLQIQGSHRHHHHQNFLPNQSIQL  250

Query  421  GRGVVIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFVT  269
            GRGV I +       AG+  P  A P ++ +N NIQ+RKRF +QLLPDFV 
Sbjct  251  GRGVEISDP---GDYAGLNPPAGAAPGNIYENINIQSRKRFASQLLPDFVA  298



>ref|XP_004228612.1| PREDICTED: BEL1-like homeodomain protein 1 [Solanum lycopersicum]
Length=700

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 74/105 (70%), Gaps = 7/105 (7%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNA-VSLTLGLQHSENLSAAMFATHHNFLPNQMGRGVVIG  401
            +YP+ ++ RF+TEQF  PYST+  VSLTLGL H+ENLS  M ATHH+FLP    + V IG
Sbjct  601  AYPIGEIARFSTEQFSAPYSTSGTVSLTLGLPHNENLS--MSATHHSFLPIPT-QNVQIG  657

Query  400  EAEANDXVAGMTTPTXAHPTS-VXDNFNIQNRKRFPAQLLPDFVT  269
            E   N     + TPT AH TS V +NFNIQNRKRF A LLPDFVT
Sbjct  658  EP--NHEFGSLNTPTSAHSTSNVYENFNIQNRKRFAAPLLPDFVT  700



>ref|XP_007204250.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 ref|XP_007204251.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 gb|EMJ05449.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 gb|EMJ05450.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
Length=707

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 69/104 (66%), Gaps = 6/104 (6%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ ++GRF  +QF P +S N VSLTLGL H ENLS +    H NFLPN   Q+GR V I
Sbjct  606  YPIGEIGRFDADQFTPRFSGNGVSLTLGLPHCENLSLSGAHHHQNFLPNQNIQLGRRVDI  665

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            G  EAND    + T +  H ++  +N +IQNRKRF AQLLPDFV
Sbjct  666  G--EANDQFGTINT-SAPHSSAAFENIDIQNRKRFVAQLLPDFV  706



>ref|XP_006348466.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006348467.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Solanum 
tuberosum]
Length=704

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 74/104 (71%), Gaps = 6/104 (6%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNA-VSLTLGLQHSENLSAAMFATHHNFLPNQMGRGVVIG  401
            +YP+ ++ RF+TEQF  PYST+  VSLTLGL H+ENLS  M ATHH+FLP    + + IG
Sbjct  604  AYPIGEIARFSTEQFSAPYSTSGTVSLTLGLPHNENLS--MSATHHSFLPIPT-QNIQIG  660

Query  400  EAEANDXVAGMTTPTXAHPTS-VXDNFNIQNRKRFPAQLLPDFV  272
             +E N     + TPT AH TS V +NFNIQNRKRF A LLPDFV
Sbjct  661  -SEPNHEFGSLNTPTSAHSTSSVYENFNIQNRKRFAAPLLPDFV  703



>ref|XP_008241058.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241059.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241060.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241062.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
Length=710

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 69/104 (66%), Gaps = 6/104 (6%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ ++GRF  +QF P +S N VSLTLGL H ENLS +    H NFLPN   Q+GR V I
Sbjct  609  YPIGEIGRFDADQFTPRFSGNGVSLTLGLPHCENLSLSGAHHHQNFLPNQNIQLGRRVDI  668

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            G  EAND    + T +  H ++  +N +IQNRKRF AQLLPDFV
Sbjct  669  G--EANDQFGTINT-SAPHSSAAFENIDIQNRKRFVAQLLPDFV  709



>ref|XP_008367359.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=349

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 64/104 (62%), Gaps = 5/104 (5%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ ++GRF  +QF P +S N VSLTLGL H ENLS +    H  FLPN   Q+GR V I
Sbjct  247  YPIGEIGRFDADQFTPRFSGNGVSLTLGLPHCENLSLSGAHHHQTFLPNQNIQLGRRVDI  306

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            G  E ND    + T       +  +N +IQNRKRF AQLLPDFV
Sbjct  307  G--ETNDQFGAINTSAPHSSAAAFENIDIQNRKRFVAQLLPDFV  348



>gb|AAN03626.1|AF406702_1 BEL1-related homeotic protein 29, partial [Solanum tuberosum]
Length=567

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 73/104 (70%), Gaps = 6/104 (6%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNA-VSLTLGLQHSENLSAAMFATHHNFLPNQMGRGVVIG  401
            +YP+ ++ RF+TEQF  PYST+  VSLTLGL H+ENLS  M ATHH+FLP    + + IG
Sbjct  467  AYPIGEIARFSTEQFSAPYSTSGTVSLTLGLPHNENLS--MSATHHSFLPIPT-QNIQIG  523

Query  400  EAEANDXVAGMTTPTXAHPTS-VXDNFNIQNRKRFPAQLLPDFV  272
             +E N     + TPT AH TS V + FNIQNRKRF A LLPDFV
Sbjct  524  -SEPNHEFGSLNTPTSAHSTSSVYETFNIQNRKRFAAPLLPDFV  566



>ref|XP_006430060.1| hypothetical protein CICLE_v10011201mg [Citrus clementina]
 ref|XP_006430061.1| hypothetical protein CICLE_v10011201mg [Citrus clementina]
 gb|ESR43300.1| hypothetical protein CICLE_v10011201mg [Citrus clementina]
 gb|ESR43301.1| hypothetical protein CICLE_v10011201mg [Citrus clementina]
Length=693

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 66/104 (63%), Gaps = 9/104 (9%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ ++GRF  EQF P +S N VSLTLGL H ENLS  + ATH NFLP+   Q+GR V I
Sbjct  595  YPIGEIGRFDAEQFTPRFSGNGVSLTLGLPHCENLS--LSATHQNFLPSQNIQLGRRVEI  652

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            GE        G       H ++  +N NIQNRKRF AQLLPDFV
Sbjct  653  GEPNE----FGTINTQSPHASAAYENMNIQNRKRFAAQLLPDFV  692



>gb|KDO70617.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
 gb|KDO70618.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
 gb|KDO70619.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
 gb|KDO70620.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
Length=693

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 66/104 (63%), Gaps = 9/104 (9%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ ++GRF  EQF P +S N VSLTLGL H ENLS  + ATH NFLP+   Q+GR V I
Sbjct  595  YPIGEIGRFDAEQFTPRFSGNGVSLTLGLPHCENLS--LSATHQNFLPSQNIQLGRRVEI  652

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            GE        G       H ++  +N NIQNRKRF AQLLPDFV
Sbjct  653  GEPNE----FGTINTQSPHASAAYENMNIQNRKRFAAQLLPDFV  692



>gb|KJB16539.1| hypothetical protein B456_002G234900 [Gossypium raimondii]
 gb|KJB16540.1| hypothetical protein B456_002G234900 [Gossypium raimondii]
Length=634

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 65/104 (63%), Gaps = 8/104 (8%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ ++ RF TEQF P +S N VSLTLGL H ENLS +    H  FLPN   QMGR V I
Sbjct  535  YPIGEITRFDTEQFTPRFSGNGVSLTLGLPHCENLSLSG-TPHQTFLPNQAMQMGRRVDI  593

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            GE        G   P+  H ++  DN NIQNRKRF AQLLPDFV
Sbjct  594  GEPNE----FGSINPSTPHSSAAYDNINIQNRKRFAAQLLPDFV  633



>gb|KHG01894.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=634

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 65/104 (63%), Gaps = 8/104 (8%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ ++ RF TEQF P +S N VSLTLGL H ENLS +    H  FLPN   QMGR V I
Sbjct  535  YPIGEITRFDTEQFTPRFSGNGVSLTLGLPHCENLSLS-GTPHQTFLPNQAMQMGRRVDI  593

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            GE        G   P+  H ++  DN NIQNRKRF AQLLPDFV
Sbjct  594  GEPNE----FGSINPSTPHSSAAYDNINIQNRKRFAAQLLPDFV  633



>gb|ACD39469.1| BEL29 protein [Solanum etuberosum]
Length=516

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 72/108 (67%), Gaps = 8/108 (7%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNA-VSLTLGLQHSENLSAAMFATHHNFLP----NQMGRG  413
            +YP+ ++ RF+TEQF  PYST+  VSLTLGL H+ENLS  M ATHH+FLP    N    G
Sbjct  410  AYPIGEIARFSTEQFSAPYSTSGTVSLTLGLPHNENLS--MSATHHSFLPIPTQNIQIGG  467

Query  412  VVIGEAEANDXVAGMTTPTXAHPTS-VXDNFNIQNRKRFPAQLLPDFV  272
              +   E N     + TPT AH TS V +NFNIQNRKRF A LLPDFV
Sbjct  468  GGVEIGEPNHEFGSLNTPTSAHSTSSVYENFNIQNRKRFAAPLLPDFV  515



>ref|XP_006481599.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006481600.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Citrus 
sinensis]
Length=693

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 66/104 (63%), Gaps = 9/104 (9%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ ++GRF  EQF P +S N VSLTLGL H ENLS  + ATH +FLP+   Q+GR V I
Sbjct  595  YPIGEIGRFDAEQFTPRFSGNGVSLTLGLPHCENLS--LSATHQSFLPSQNIQLGRRVEI  652

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            GE        G       H ++  +N NIQNRKRF AQLLPDFV
Sbjct  653  GEPNE----FGTINTQSPHASAAYENMNIQNRKRFAAQLLPDFV  692



>gb|KDP36113.1| hypothetical protein JCGZ_08757 [Jatropha curcas]
Length=676

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 71/106 (67%), Gaps = 11/106 (10%)
 Frame = -1

Query  574  YPMEQMGRFTTEQ--FPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQ---MGRGV  410
            YP+ ++GRF TEQ   PP +S NAVSLTLGL H ENLS  + ATH  FLPNQ   +GR V
Sbjct  576  YPIGELGRFDTEQQFTPPRFSGNAVSLTLGLPHCENLS--LSATHQTFLPNQNIQLGRRV  633

Query  409  VIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
             +GE    +   G+ T T  H ++  D+ +IQNRKRF AQLLPDFV
Sbjct  634  EMGEP---NEFGGINTST-PHSSTAYDSIDIQNRKRFAAQLLPDFV  675



>ref|XP_010059079.1| PREDICTED: BEL1-like homeodomain protein 1 [Eucalyptus grandis]
 gb|KCW90459.1| hypothetical protein EUGRSUZ_A02588 [Eucalyptus grandis]
 gb|KCW90460.1| hypothetical protein EUGRSUZ_A02588 [Eucalyptus grandis]
Length=703

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 68/113 (60%), Gaps = 17/113 (15%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVS---------LTLGLQHSENLSAAMFATHHNFLPNQ-  425
            YPM ++GRF  +QF P +S N VS         LTLGL HSENLS  +   H +FLP+Q 
Sbjct  595  YPMGEIGRFGADQFAPSFSGNGVSPTFSGNGVSLTLGLPHSENLS--LSGAHQSFLPSQN  652

Query  424  --MGRGVVIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
              +GR V IGEA   +    M TPT  H +S  +  NIQNRKRFP QLL DFV
Sbjct  653  IQLGRRVDIGEA---NEFGAMNTPTIPHSSSAYETMNIQNRKRFPVQLLQDFV  702



>ref|XP_009348973.1| PREDICTED: BEL1-like homeodomain protein 1 [Pyrus x bretschneideri]
 ref|XP_009348980.1| PREDICTED: BEL1-like homeodomain protein 1 [Pyrus x bretschneideri]
 ref|XP_009348985.1| PREDICTED: BEL1-like homeodomain protein 1 [Pyrus x bretschneideri]
Length=710

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 64/104 (62%), Gaps = 5/104 (5%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ ++GRF  +QF P +S N VSLTLGL H ENLS +    H  FLPN   Q+GR V I
Sbjct  608  YPIGEIGRFDADQFTPRFSGNGVSLTLGLPHCENLSLSGAHHHQTFLPNQNIQLGRRVDI  667

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            G  E ND    + T       +  +N +IQNRKRF AQLLPDFV
Sbjct  668  G--ETNDQFGAINTSAPHSSAAAFENIDIQNRKRFVAQLLPDFV  709



>ref|XP_008391977.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008391978.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=708

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 64/104 (62%), Gaps = 5/104 (5%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ ++GRF  +QF P +S N VSLTLGL H ENLS +    H  FLPN   Q+GR V I
Sbjct  606  YPIGEIGRFDADQFTPRFSGNGVSLTLGLPHCENLSLSGAHHHQTFLPNQNIQLGRRVDI  665

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            G  E ND    + T       +  +N +IQNRKRF AQLLPDFV
Sbjct  666  G--ETNDQFGAINTSAPHSSAAAFENIDIQNRKRFVAQLLPDFV  707



>ref|XP_008360598.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008360599.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=710

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 64/104 (62%), Gaps = 5/104 (5%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ ++GRF  +QF P +S N VSLTLGL H ENLS +    H  FLPN   Q+GR V I
Sbjct  608  YPIGEIGRFDADQFTPRFSGNGVSLTLGLPHCENLSLSGAHHHQTFLPNQNIQLGRRVDI  667

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            G  E ND    + T       +  +N +IQNRKRF AQLLPDFV
Sbjct  668  G--ETNDQFGAINTSAPHSSAAAFENIDIQNRKRFVAQLLPDFV  709



>ref|XP_002524053.1| bel1 homeotic protein, putative [Ricinus communis]
 gb|EEF38263.1| bel1 homeotic protein, putative [Ricinus communis]
Length=679

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 68/104 (65%), Gaps = 9/104 (9%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+  +GRF TEQF P +S N VSLTLGL H ENLS  M  TH +FLP+   Q+GR V I
Sbjct  581  YPIGDLGRFDTEQFTPRFSGNGVSLTLGLPHCENLS--MSGTHESFLPSQNIQLGRRVEI  638

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
             E    +   G+ T T  H ++  ++ NIQNRKRF AQLLPDFV
Sbjct  639  SEP---NEFGGINTST-PHSSTAYESINIQNRKRFAAQLLPDFV  678



>ref|XP_011042587.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042589.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042590.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042591.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042592.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042593.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
Length=679

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 66/104 (63%), Gaps = 9/104 (9%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ ++GRF  EQF P +S N VSL+LGL H ENLS  +  TH  FLPN   Q+GR V I
Sbjct  581  YPIGEIGRFDGEQFTPRFSGNGVSLSLGLPHCENLS--LSGTHQTFLPNQNIQLGRRVEI  638

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            GEA       G    +  H ++  D+ ++QNRKRF AQLLPDFV
Sbjct  639  GEANE----FGAINTSTPHSSTAYDSIDMQNRKRFIAQLLPDFV  678



>ref|XP_007027982.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007027983.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007027984.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08484.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08485.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08486.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
Length=668

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 65/104 (63%), Gaps = 9/104 (9%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ ++GRF  EQF P +S N VSLTLGL H ENLS  +  TH   LPN   QMGR + I
Sbjct  570  YPIGEIGRFDAEQFTPRFSGNGVSLTLGLPHCENLS--LSGTHQTLLPNPNLQMGRRLDI  627

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            GE      +     P+  H ++  +N +IQNRKRF AQLLPDFV
Sbjct  628  GEPNEFATI----NPSAPHSSAAYENISIQNRKRFAAQLLPDFV  667



>ref|XP_010247184.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247191.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247201.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247208.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247219.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247226.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247233.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
Length=729

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVV  407
            +Y + ++GRF  EQF P +S N VSLTLGL H ENLS  +  T   FL N   Q+GR + 
Sbjct  628  TYSIGELGRFDPEQFTPRFSGNGVSLTLGLPHCENLS--LSGTQQTFLSNQNIQLGRRLE  685

Query  406  IGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            +G  E ND   G++TP+  H ++  +N NIQNRKRF AQLLPD+V
Sbjct  686  MGGGEPND-FCGLSTPS-PHSSAAYENINIQNRKRFAAQLLPDYV  728



>ref|XP_006381943.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381944.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381945.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_002308323.2| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381946.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381947.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381948.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59740.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59741.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59742.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|EEE91846.2| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59743.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59744.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59745.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
Length=678

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 67/104 (64%), Gaps = 9/104 (9%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YPM ++GRF  EQF P +S N VSLTLGL H ENLS  +  TH  FLPN   Q+GR V I
Sbjct  580  YPMGEIGRFDGEQFTPRFSGNGVSLTLGLPHCENLS--LSGTHQTFLPNQNIQLGRRVEI  637

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            GE    +    + T T  H ++  ++ +IQNRKRF AQLLPDFV
Sbjct  638  GEP---NEYGALNTST-PHSSTAYESIDIQNRKRFIAQLLPDFV  677



>ref|XP_008387112.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008387113.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008387114.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=703

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 63/104 (61%), Gaps = 5/104 (5%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ ++GRF  +QF P +S N VSLTLGL H ENLS +    H  FLPN   Q+GR V  
Sbjct  601  YPIGEIGRFDADQFAPRFSGNGVSLTLGLPHCENLSMSGAHRHQTFLPNQNIQLGRRVDT  660

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            G  E ND    + T       +  +N +IQNRKRF AQLLPDFV
Sbjct  661  G--ETNDQFGAINTSASHSSAAAFENIDIQNRKRFVAQLLPDFV  702



>ref|XP_011021429.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011021430.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011021431.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
Length=732

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 69/106 (65%), Gaps = 8/106 (8%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQ----MGRGV  410
            +YPM  +GRF  EQ  P +S N+VSLTLGL H ENLS  +  T  N+L +Q     GR +
Sbjct  630  AYPMGDLGRFNIEQLTPRFSGNSVSLTLGLPHCENLS--LSGTQQNYLSSQNIQLGGRRI  687

Query  409  VIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
             IG +E +   +G+ T   +H +S  ++ +IQNRKRFPAQLLPDFV
Sbjct  688  EIGTSEPD--FSGINTSQNSHSSSGFESVDIQNRKRFPAQLLPDFV  731



>ref|XP_002299773.2| hypothetical protein POPTR_0001s22430g [Populus trichocarpa]
 gb|EEE84578.2| hypothetical protein POPTR_0001s22430g [Populus trichocarpa]
Length=732

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 69/106 (65%), Gaps = 8/106 (8%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQ----MGRGV  410
            +YPM  +GRF  EQ  P +S N+VSLTLGL H ENLS  +  T  N+L +Q     GR +
Sbjct  630  AYPMGDLGRFNIEQLTPRFSGNSVSLTLGLPHCENLS--LSGTQQNYLSSQNIQLGGRRI  687

Query  409  VIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
             IG +E +   +G+ T   +H +S  ++ +IQNRKRFPAQLLPDFV
Sbjct  688  EIGTSEPD--FSGINTSQNSHSSSGFESVDIQNRKRFPAQLLPDFV  731



>gb|KHG11905.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=653

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 64/104 (62%), Gaps = 9/104 (9%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ ++GRF  EQF P +  N VSLTLGL H ENLS  +  TH NFLPN   QMGR + I
Sbjct  555  YPIGEIGRFDAEQFAPRFPGNGVSLTLGLPHCENLS--LSGTHQNFLPNQTMQMGRRLDI  612

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
             E        G   P   H ++  ++ N+QNRKRF AQLLPDFV
Sbjct  613  DEPNE----FGAINPPTPHSSAAYESINLQNRKRFVAQLLPDFV  652



>gb|KHG11906.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=680

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 64/104 (62%), Gaps = 9/104 (9%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ ++GRF  EQF P +  N VSLTLGL H ENLS  +  TH NFLPN   QMGR + I
Sbjct  582  YPIGEIGRFDAEQFAPRFPGNGVSLTLGLPHCENLS--LSGTHQNFLPNQTMQMGRRLDI  639

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
             E        G   P   H ++  ++ N+QNRKRF AQLLPDFV
Sbjct  640  DEPNE----FGAINPPTPHSSAAYESINLQNRKRFVAQLLPDFV  679



>ref|XP_011046419.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011046420.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011046421.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011046422.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011046423.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
Length=679

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 67/104 (64%), Gaps = 9/104 (9%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ ++GRF  EQF P +S N VSLTLGL H ENLS  +  TH  FLPN   Q+GR V I
Sbjct  581  YPIGEIGRFDGEQFTPRFSGNGVSLTLGLPHCENLS--LSGTHQTFLPNQNIQLGRRVEI  638

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            GE    +    + T T  H ++  ++ +IQNRKR+ AQLLPDFV
Sbjct  639  GEP---NEYGALNTST-PHSSTAYESIDIQNRKRYIAQLLPDFV  678



>ref|XP_011003835.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003836.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003838.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003839.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003840.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003841.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
Length=734

 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 67/107 (63%), Gaps = 8/107 (7%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQ-----MGRG  413
            +YPM  +GRF  EQ  P +S N+VSLTLGL H ENLS  +  T  N+L NQ      GR 
Sbjct  630  AYPMGDLGRFNLEQMTPRFSGNSVSLTLGLPHCENLS--LSGTQQNYLSNQNINQLAGRR  687

Query  412  VVIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            + IG     D  +G+ T   +H ++  ++ +IQNRKRFPAQLLPDFV
Sbjct  688  LEIGSGTEPD-FSGINTSQNSHSSTGFESIDIQNRKRFPAQLLPDFV  733



>ref|XP_006373820.1| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 ref|XP_002323384.2| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 ref|XP_006373821.1| BEL1-like homeodomain 1 family protein [Populus trichocarpa]
 ref|XP_006373822.1| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 gb|ERP51617.1| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 gb|EEF05145.2| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 gb|ERP51618.1| BEL1-like homeodomain 1 family protein [Populus trichocarpa]
 gb|ERP51619.1| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
Length=679

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 65/104 (63%), Gaps = 9/104 (9%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ ++GRF  EQF P +S N VSL+LGL H ENLS  +  TH  FLPN   Q+GR V I
Sbjct  581  YPIGEIGRFDGEQFTPRFSGNGVSLSLGLPHCENLS--LSGTHQTFLPNQNIQLGRRVEI  638

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            GE        G    +  H ++  ++ +IQNRKRF AQLLPDFV
Sbjct  639  GEPNE----FGAINTSTPHSSTAYESIDIQNRKRFLAQLLPDFV  678



>ref|XP_010263012.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010263013.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
Length=739

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 67/105 (64%), Gaps = 7/105 (7%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVV  407
            +Y + ++GRF  EQF P +S N VSLTLGL H ENLS  +  T   +L N   Q+GR + 
Sbjct  638  AYSLGELGRFDPEQFAPRFSGNGVSLTLGLPHCENLS--LSGTQQTYLSNQNIQLGRRLE  695

Query  406  IGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            IG  E ND   GM++P   H ++  +N NIQN KRF AQLLPDFV
Sbjct  696  IGGGEPND-FCGMSSP-PPHSSAAYENMNIQNGKRFAAQLLPDFV  738



>gb|KHG12855.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=644

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 64/106 (60%), Gaps = 11/106 (10%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ +M RF  E F P +  N VSLTLGL H ENLS  + ATH  FLPN   QMGR + I
Sbjct  544  YPIAEMARFDAEHFAPRFPGNGVSLTLGLPHCENLS--LSATHQTFLPNQTLQMGRRLDI  601

Query  403  GEAEANDXVAGMTTPTXAHPTSV--XDNFNIQNRKRFPAQLLPDFV  272
            GE        G   P+  H ++    +N ++QNRKRF AQLLPDFV
Sbjct  602  GEPNE----YGAINPSTPHSSAAYEIENIDVQNRKRFAAQLLPDFV  643



>gb|KHG12856.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=763

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 64/106 (60%), Gaps = 11/106 (10%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ +M RF  E F P +  N VSLTLGL H ENLS  + ATH  FLPN   QMGR + I
Sbjct  663  YPIAEMARFDAEHFAPRFPGNGVSLTLGLPHCENLS--LSATHQTFLPNQTLQMGRRLDI  720

Query  403  GEAEANDXVAGMTTPTXAHPTSV--XDNFNIQNRKRFPAQLLPDFV  272
            GE        G   P+  H ++    +N ++QNRKRF AQLLPDFV
Sbjct  721  GEPNE----YGAINPSTPHSSAAYEIENIDVQNRKRFAAQLLPDFV  762



>gb|KHN10043.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=431

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 66/105 (63%), Gaps = 12/105 (11%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYS-TNAVSLTLGLQHSENLSAAMFATHHNFLPNQ---MGRGVV  407
            YPME++GRF  EQF P +S  N VSLTLGL H + LS     TH +FLPNQ   +GRG+ 
Sbjct  334  YPMEEIGRFDAEQFTPRFSGNNGVSLTLGLPHCDTLSG----THQSFLPNQNIQLGRGLD  389

Query  406  IGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            IGE        G    + +H ++  ++ N+QN KRF AQLLPDFV
Sbjct  390  IGEPNQ----FGALNNSTSHSSAAFESINMQNPKRFAAQLLPDFV  430



>ref|XP_011467196.1| PREDICTED: BEL1-like homeodomain protein 1 [Fragaria vesca subsp. 
vesca]
Length=704

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 70/105 (67%), Gaps = 8/105 (8%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVV-  407
            YP+ ++GRF T+QF P +S N+VSL+LGL H ENLS +  A H  FLPN   Q+GR V  
Sbjct  603  YPIGEIGRFDTDQFTPRFSGNSVSLSLGLPHCENLSLS-GAHHQTFLPNQNIQLGRRVDH  661

Query  406  IGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            IG  E ND    M T +  H ++  ++ +IQNRKRF AQLLPDFV
Sbjct  662  IG--EPNDQFGTMNT-SAPHSSAGFESIDIQNRKRFVAQLLPDFV  703



>gb|KJB36260.1| hypothetical protein B456_006G149100 [Gossypium raimondii]
Length=644

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 63/106 (59%), Gaps = 11/106 (10%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ +M RF  E F P +  N VSLTLGL H ENLS  + ATH  FLPN   QMGR + I
Sbjct  544  YPIAEMARFDAEHFAPRFPGNGVSLTLGLPHCENLS--LPATHQTFLPNQTLQMGRRLDI  601

Query  403  GEAEANDXVAGMTTPTXAHPTSV--XDNFNIQNRKRFPAQLLPDFV  272
            GE        G   P+  H +     +N ++QNRKRF AQLLPDFV
Sbjct  602  GEPNE----YGAINPSTPHSSVAYEIENIDVQNRKRFAAQLLPDFV  643



>ref|XP_003519115.1| PREDICTED: BEL1-like homeodomain protein 1-like isoformX1 [Glycine 
max]
 ref|XP_006575286.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006575287.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
Length=664

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 66/105 (63%), Gaps = 12/105 (11%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYS-TNAVSLTLGLQHSENLSAAMFATHHNFLPNQ---MGRGVV  407
            YPME++GRF  EQF P +S  N VSLTLGL H + LS     TH +FLPNQ   +GRG+ 
Sbjct  567  YPMEEIGRFDAEQFTPRFSGNNGVSLTLGLPHCDTLSG----THQSFLPNQNIQLGRGLD  622

Query  406  IGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            IGE        G    + +H ++  ++ N+QN KRF AQLLPDFV
Sbjct  623  IGEPNQ----FGALNNSTSHSSAAFESINMQNPKRFAAQLLPDFV  663



>ref|XP_002266838.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653287.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653288.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653289.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653290.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653292.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
Length=696

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 62/103 (60%), Gaps = 9/103 (9%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVV  407
            SY + ++GRF  EQF P +S N VSLTLGL H ENLS  +  TH  FLPN   Q+GR V 
Sbjct  595  SYSLGEIGRFDAEQFTPRFSGNGVSLTLGLPHCENLS--LSGTHQTFLPNQNIQLGRRVD  652

Query  406  IGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPD  278
            +GE        G    T  H T+  +N N+QN KRF AQLLPD
Sbjct  653  MGEPNE----YGTINTTTPHSTAAYENINMQNGKRFAAQLLPD  691



>emb|CAN63083.1| hypothetical protein VITISV_015358 [Vitis vinifera]
Length=709

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 62/103 (60%), Gaps = 9/103 (9%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVV  407
            SY + ++GRF  EQF P +S N VSLTLGL H ENLS  +  TH  FLPN   Q+GR V 
Sbjct  608  SYSLGEIGRFDAEQFTPRFSGNGVSLTLGLPHCENLS--LSGTHQTFLPNQNIQLGRRVD  665

Query  406  IGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPD  278
            +GE        G    T  H T+  +N N+QN KRF AQLLPD
Sbjct  666  MGEPNE----YGTINTTTPHSTAAYENINMQNGKRFAAQLLPD  704



>gb|KHN48417.1| BEL1-like homeodomain protein 1, partial [Glycine soja]
Length=471

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 66/105 (63%), Gaps = 12/105 (11%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYS-TNAVSLTLGLQHSENLSAAMFATHHNFLPNQ---MGRGVV  407
            YP+E++GRF  EQF P +S  N VSLTLGL H + LS     TH +FLPNQ   +GRG+ 
Sbjct  374  YPIEEIGRFDAEQFTPRFSGKNGVSLTLGLPHCDTLSG----THQSFLPNQNIQLGRGLD  429

Query  406  IGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            IGE        G    + +H ++  ++ N+QN KRF AQLLPDFV
Sbjct  430  IGEPNQ----FGALNNSNSHNSAAFESINMQNPKRFAAQLLPDFV  470



>ref|XP_007145789.1| hypothetical protein PHAVU_007G267900g [Phaseolus vulgaris]
 gb|ESW17783.1| hypothetical protein PHAVU_007G267900g [Phaseolus vulgaris]
Length=649

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 65/104 (63%), Gaps = 11/104 (11%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YPME++GRF  EQF P +S N VSLTLGL H + LS     TH  FLPN   Q+GRG+ I
Sbjct  553  YPMEEIGRFDAEQFTPRFSGNGVSLTLGLPHCDTLS----GTHQTFLPNQNIQLGRGLDI  608

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            G+        G+   + +H ++  ++ N+QN KRF AQL+ DFV
Sbjct  609  GQPNQ----FGVLNNSTSHSSAAYESMNMQNPKRFAAQLVLDFV  648



>ref|XP_003535815.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006588872.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
Length=661

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 66/105 (63%), Gaps = 12/105 (11%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYS-TNAVSLTLGLQHSENLSAAMFATHHNFLPNQ---MGRGVV  407
            YP+E++GRF  EQF P +S  N VSLTLGL H + LS     TH +FLPNQ   +GRG+ 
Sbjct  564  YPIEEIGRFDAEQFTPRFSGKNGVSLTLGLPHCDTLSG----THQSFLPNQNIQLGRGLD  619

Query  406  IGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            IGE        G    + +H ++  ++ N+QN KRF AQLLPDFV
Sbjct  620  IGEPNQ----FGALNNSNSHNSAAFESINMQNPKRFAAQLLPDFV  660



>gb|KJB62029.1| hypothetical protein B456_009G396900 [Gossypium raimondii]
Length=653

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 61/104 (59%), Gaps = 9/104 (9%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ ++GRF  EQF P +  N VSLTLGL H ENLS  +   H N +PN   QMGR + I
Sbjct  555  YPIGEIGRFDAEQFAPRFPGNGVSLTLGLPHCENLS--LSGAHQNLIPNQTMQMGRRLDI  612

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
             E        G   P   H ++  ++ N+ NRKRF AQLLPDFV
Sbjct  613  DEPNE----FGAINPPTPHSSAAYESINLHNRKRFVAQLLPDFV  652



>gb|EYU18114.1| hypothetical protein MIMGU_mgv1a010011mg [Erythranthe guttata]
Length=324

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 65/112 (58%), Gaps = 12/112 (11%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPP-PYSTNAVSLTLGLQHSEN---LSAA--MFATHHNFLPN----  428
            SY + ++GRF  + F   PY  N VSLTLGL H +N   +S+       H  F+P     
Sbjct  214  SYAINELGRFEPDHFQQHPYLGNGVSLTLGLPHCDNQLTMSSVPHHHHHHQAFMPTNQGM  273

Query  427  QMGRGVVIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            Q+GRGV IGE   ND V         HPT+V +N NIQNRKRF AQLLPDFV
Sbjct  274  QLGRGVEIGET--NDYVGMNAQQPNTHPTNVYENINIQNRKRFAAQLLPDFV  323



>ref|XP_006854627.1| hypothetical protein AMTR_s00030p00173920 [Amborella trichopoda]
 gb|ERN16094.1| hypothetical protein AMTR_s00030p00173920 [Amborella trichopoda]
Length=709

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 63/105 (60%), Gaps = 6/105 (6%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVV  407
            +Y +  +GRF  EQF P +S N VSLTLGL H ++LS A   T   +L N   QMGR   
Sbjct  607  AYHIGDLGRFGHEQFAPRFSGNGVSLTLGLPHCDSLSLA--GTQQAYLSNPNLQMGRRHE  664

Query  406  IGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            +G  E ND  +  T    AH  +  +N +IQNRKRF AQLLPDFV
Sbjct  665  LG-GEPNDFCSMNTASATAHSANPYENLSIQNRKRFAAQLLPDFV  708



>ref|XP_007132496.1| hypothetical protein PHAVU_011G099100g [Phaseolus vulgaris]
 ref|XP_007132497.1| hypothetical protein PHAVU_011G099100g [Phaseolus vulgaris]
 gb|ESW04490.1| hypothetical protein PHAVU_011G099100g [Phaseolus vulgaris]
 gb|ESW04491.1| hypothetical protein PHAVU_011G099100g [Phaseolus vulgaris]
Length=733

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 61/104 (59%), Gaps = 6/104 (6%)
 Frame = -1

Query  577  SYPMEQMGRF--TTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQMGRGVVI  404
            ++PME +GRF   +EQ  P +  N VSLTLGL HSENL+  +  T H FL   M  G+  
Sbjct  633  AFPMEDIGRFHHVSEQLAPRFHGNGVSLTLGLPHSENLT--LSGTQHGFLSPNMHLGMRT  690

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
                 N+    + TP  +H  +  DN +IQNRKRF AQLL DFV
Sbjct  691  --TNENEFCGAINTPPSSHSATSYDNIDIQNRKRFAAQLLRDFV  732



>ref|XP_002275098.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
Length=728

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 62/103 (60%), Gaps = 7/103 (7%)
 Frame = -1

Query  571  PMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVIG  401
            P+  +GRF  EQ  P +  N+VSLTLGL H ENLS  +  +  ++L N   Q+GR + +G
Sbjct  629  PIGDIGRFNPEQLAPRFHGNSVSLTLGLPHCENLS--LSGSQQSYLSNPNVQLGRRLEMG  686

Query  400  EAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
              E +    G+     +H  +  D+ NIQNRKRF AQLLPDFV
Sbjct  687  NGEPD--YCGINAAQPSHSNAAYDSINIQNRKRFAAQLLPDFV  727



>emb|CAN69527.1| hypothetical protein VITISV_027380 [Vitis vinifera]
Length=728

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 62/103 (60%), Gaps = 7/103 (7%)
 Frame = -1

Query  571  PMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVIG  401
            P+  +GRF  EQ  P +  N+VSLTLGL H ENLS  +  +  ++L N   Q+GR + +G
Sbjct  629  PIGDIGRFNPEQLAPRFHGNSVSLTLGLPHCENLS--LSGSQQSYLSNPNVQLGRRLEMG  686

Query  400  EAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
              E +    G+     +H  +  D+ NIQNRKRF AQLLPDFV
Sbjct  687  NGEPD--YCGINAAQPSHSNAAYDSINIQNRKRFAAQLLPDFV  727



>ref|XP_008442920.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis melo]
Length=713

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 63/105 (60%), Gaps = 9/105 (9%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYS-TNAVSLTLGLQHSENLSAAMFATHHNFLPNQ---MGRGVV  407
            YP+ ++ RF  +QF P +S  N VSLTLGL H ENLS    ATH +FLPNQ   +GR   
Sbjct  613  YPIGEIARFDADQFTPRFSGNNGVSLTLGLPHCENLSLNP-ATHQSFLPNQSIHLGRRTE  671

Query  406  IGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            IG+      +   T    AH ++  D  NIQN KRF AQLLPDFV
Sbjct  672  IGKPTDFSAINAST----AHSSTAFDTINIQNGKRFAAQLLPDFV  712



>ref|XP_004136516.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
Length=716

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 63/105 (60%), Gaps = 9/105 (9%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYS-TNAVSLTLGLQHSENLSAAMFATHHNFLPNQ---MGRGVV  407
            YP+ ++ RF  +QF P +S  N VSLTLGL H ENLS    ATH +FLPNQ   +GR   
Sbjct  616  YPIGEIARFDADQFTPRFSGNNGVSLTLGLPHCENLSLNP-ATHQSFLPNQSIHLGRRTE  674

Query  406  IGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            IG+      +   T    AH ++  +  NIQN KRF AQLLPDFV
Sbjct  675  IGKPTDFSAINAST----AHSSTAFETINIQNGKRFAAQLLPDFV  715



>ref|XP_004171976.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
 gb|KGN59214.1| hypothetical protein Csa_3G782620 [Cucumis sativus]
Length=716

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 63/105 (60%), Gaps = 9/105 (9%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYS-TNAVSLTLGLQHSENLSAAMFATHHNFLPNQ---MGRGVV  407
            YP+ ++ RF  +QF P +S  N VSLTLGL H ENLS    ATH +FLPNQ   +GR   
Sbjct  616  YPIGEIARFDADQFTPRFSGNNGVSLTLGLPHCENLSLNP-ATHQSFLPNQSIHLGRRTE  674

Query  406  IGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            IG+      +   T    AH ++  +  NIQN KRF AQLLPDFV
Sbjct  675  IGKPTDFSAINAST----AHSSTAFETINIQNGKRFAAQLLPDFV  715



>gb|KHN33154.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=428

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 61/105 (58%), Gaps = 14/105 (13%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+  +GRF TEQF P  S N VSLTLGL        ++  TH  FLPN   Q+GR + I
Sbjct  335  YPIGDIGRFDTEQFTPRLSGNGVSLTLGLD-------SLPGTHQTFLPNQNIQLGRSLDI  387

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFVT  269
            GE        G  + +  H T+  ++ ++QN KRF AQLLPDFVT
Sbjct  388  GEPNE----FGAISTSSPHSTAAYESISMQNPKRFAAQLLPDFVT  428



>ref|XP_010557975.1| PREDICTED: BEL1-like homeodomain protein 1 [Tarenaya hassleriana]
Length=675

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 64/108 (59%), Gaps = 9/108 (8%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYS--TNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRG  413
            +YP+E+ GRF  E+F P YS   N VSLTLGL H E+ S +   TH NF PN   Q+GR 
Sbjct  572  AYPIEEAGRFEAEEFTPSYSGNNNGVSLTLGLPHCESFSVSA-PTHQNFFPNQNIQIGRD  630

Query  412  VVIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFVT  269
            V + E    +    ++T       +  +  ++QN++RF AQLLPDFVT
Sbjct  631  VEMSEP---NEFGAISTSESHSSAAAYNTISLQNQRRFSAQLLPDFVT  675



>ref|XP_007015671.1| BEL1 homeodomain 1, putative [Theobroma cacao]
 gb|EOY33290.1| BEL1 homeodomain 1, putative [Theobroma cacao]
Length=732

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 63/102 (62%), Gaps = 7/102 (7%)
 Frame = -1

Query  568  MEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVIGE  398
            M ++GRF  EQ  P +  N+VSLTLGL H +NLS  +     NFL N   Q+GR + +G 
Sbjct  634  MGEIGRFDPEQLTPRFPGNSVSLTLGLPHCDNLS--LSGNQQNFLSNQNIQLGRRLELGP  691

Query  397  AEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            +E++    G+     +H ++  +N  +QNRKRF AQLLPDFV
Sbjct  692  SESD--FCGINNQQASHSSTGYENIEMQNRKRFAAQLLPDFV  731



>ref|XP_010543869.1| PREDICTED: BEL1-like homeodomain protein 1 isoform X2 [Tarenaya 
hassleriana]
Length=573

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 62/107 (58%), Gaps = 13/107 (12%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYS--TNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGV  410
            YP+ + GRF  E+F P YS   N VSLTLGL H E+ S +  ATH NF PN   Q+GR V
Sbjct  475  YPICETGRFEAEEFTPSYSGNINGVSLTLGLPHCESFSVS--ATHQNFFPNQNIQIGRNV  532

Query  409  VIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFVT  269
             + E          T+P   +P       N+QN++RF +QLLPDFVT
Sbjct  533  EMSEPNEFGASEPRTSPAAYNP------INLQNQRRFLSQLLPDFVT  573



>ref|XP_010107001.1| BEL1-like homeodomain protein 1 [Morus notabilis]
 gb|EXC12999.1| BEL1-like homeodomain protein 1 [Morus notabilis]
Length=441

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 62/104 (60%), Gaps = 9/104 (9%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+ ++GRF  EQF P +S N VSLTLGL H ENLS  +   H +F+ N   Q+GR +  
Sbjct  343  YPIGEIGRFDAEQFTPRFSGNGVSLTLGLPHCENLS--LSGAHQSFVSNQSIQLGRNI--  398

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
               E N+  A  T+   +   +  +  NIQN KRF AQLLPD+V
Sbjct  399  --GEPNEYSAINTSAPHSSAAAAFETINIQNPKRFAAQLLPDYV  440



>ref|XP_010543867.1| PREDICTED: BEL1-like homeodomain protein 1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010543868.1| PREDICTED: BEL1-like homeodomain protein 1 isoform X1 [Tarenaya 
hassleriana]
Length=594

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 62/107 (58%), Gaps = 13/107 (12%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYS--TNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGV  410
            YP+ + GRF  E+F P YS   N VSLTLGL H E+ S +  ATH NF PN   Q+GR V
Sbjct  496  YPICETGRFEAEEFTPSYSGNINGVSLTLGLPHCESFSVS--ATHQNFFPNQNIQIGRNV  553

Query  409  VIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFVT  269
             + E          T+P   +P       N+QN++RF +QLLPDFVT
Sbjct  554  EMSEPNEFGASEPRTSPAAYNP------INLQNQRRFLSQLLPDFVT  594



>gb|AFK35661.1| unknown [Medicago truncatula]
Length=242

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 61/106 (58%), Gaps = 20/106 (19%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYS--TNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGV  410
            YPME++GRF  EQF P +S   N VSLTLGL H + LS     TH +F+PN   Q+GR +
Sbjct  151  YPMEEIGRFDAEQFAPRFSGNNNGVSLTLGLPHCDTLS----GTHQSFMPNQNIQLGRRL  206

Query  409  VIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
             I E           T      ++  ++ N+QN KRF AQLLPDFV
Sbjct  207  DISE-----------TNEFGDSSAAFESINMQNPKRFAAQLLPDFV  241



>ref|XP_003521496.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006577097.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006577098.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
 ref|XP_006577099.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X4 [Glycine 
max]
Length=679

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 61/105 (58%), Gaps = 14/105 (13%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+  +GRF TEQF P  S N VSLTLGL        ++  TH  FLPN   Q+GR + I
Sbjct  586  YPIGDIGRFDTEQFTPRLSGNGVSLTLGLD-------SLPGTHQTFLPNQNIQLGRSLDI  638

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFVT  269
            GE        G  + +  H T+  ++ ++QN KRF AQLLPDFVT
Sbjct  639  GEPNE----FGAISTSSPHSTAAYESISMQNPKRFAAQLLPDFVT  679



>gb|KHN08605.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=679

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 61/105 (58%), Gaps = 14/105 (13%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+  +GRF  EQF P +S N VSLTLGL        ++  TH  FLPN   Q+GR + I
Sbjct  586  YPIGDIGRFDAEQFTPRFSGNGVSLTLGLD-------SLPGTHQTFLPNQNIQLGRSLDI  638

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFVT  269
            GE        G  + +  H T+  ++ ++QN KRF AQLLPDFVT
Sbjct  639  GEPNE----FGAISTSSPHSTAAYESISMQNPKRFAAQLLPDFVT  679



>ref|XP_003554466.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006604654.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
Length=680

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 61/105 (58%), Gaps = 14/105 (13%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+  +GRF  EQF P +S N VSLTLGL        ++  TH  FLPN   Q+GR + I
Sbjct  587  YPIGDIGRFDAEQFTPRFSGNGVSLTLGLD-------SLPGTHQTFLPNQNIQLGRSLDI  639

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFVT  269
            GE        G  + +  H T+  ++ ++QN KRF AQLLPDFVT
Sbjct  640  GEPNE----FGAISTSSPHSTAAYESISMQNPKRFAAQLLPDFVT  680



>ref|XP_007162972.1| hypothetical protein PHAVU_001G195800g [Phaseolus vulgaris]
 gb|ESW34966.1| hypothetical protein PHAVU_001G195800g [Phaseolus vulgaris]
Length=679

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 60/105 (57%), Gaps = 14/105 (13%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+  +GRF  EQF P +S N VSLTLGL        ++  TH  FLPN   Q+GR + I
Sbjct  586  YPIGDIGRFDAEQFAPRFSGNGVSLTLGLD-------SLPGTHQTFLPNQNIQLGRSLDI  638

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFVT  269
            GE        G    +  H ++  ++ ++QN KRF AQLLPDFVT
Sbjct  639  GEPNE----FGSINTSSPHSSAAYESISMQNPKRFAAQLLPDFVT  679



>gb|KEH41936.1| BEL1-related homeotic protein [Medicago truncatula]
Length=649

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 61/106 (58%), Gaps = 20/106 (19%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYS--TNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGV  410
            YPME++GRF  EQF P +S   N VSLTLGL H + LS     TH +F+PN   Q+GR +
Sbjct  558  YPMEEIGRFDAEQFAPRFSGNNNGVSLTLGLPHCDTLS----GTHQSFMPNQNIQLGRRL  613

Query  409  VIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
             I E           T      ++  ++ N+QN KRF AQLLPDFV
Sbjct  614  DISE-----------TNEFGDSSAAFESINMQNPKRFAAQLLPDFV  648



>dbj|BAE71188.1| BEL1-like homeodomain transcription factor [Trifolium pratense]
Length=651

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 61/107 (57%), Gaps = 22/107 (21%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYS--TNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGV  410
            YPME++GRF  EQF P +S   N VSLTLGL H + LS     TH +F+PN   Q+GR +
Sbjct  560  YPMEEIGRFDAEQFTPRFSGNNNGVSLTLGLPHCDTLS----GTHQSFMPNQNIQLGRRL  615

Query  409  VIGEA-EANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
             I E  E  D  A              ++ N+QN KRF AQLLPDFV
Sbjct  616  DISEQNEFGDSSAAF------------ESMNMQNPKRFAAQLLPDFV  650



>ref|XP_008784116.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
 ref|XP_008784117.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
 ref|XP_008784118.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
Length=660

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 59/102 (58%), Gaps = 15/102 (15%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQMGRGVVIGE  398
            +YP+  +GRF +EQF P +S N VSLTLGL H ENLS  +     +FL N+         
Sbjct  573  AYPIADLGRFDSEQFTPRFSGNGVSLTLGLPHCENLS--LSGAQPSFLSNE---------  621

Query  397  AEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
                   +    P+ AHP++  ++ +I NRKR+ AQLLPDFV
Sbjct  622  ----SMPSFNNNPSVAHPSNAYESIDIPNRKRYAAQLLPDFV  659



>ref|XP_007150022.1| hypothetical protein PHAVU_005G119300g [Phaseolus vulgaris]
 gb|ESW22016.1| hypothetical protein PHAVU_005G119300g [Phaseolus vulgaris]
Length=702

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 60/105 (57%), Gaps = 5/105 (5%)
 Frame = -1

Query  577  SYPMEQMG-RF--TTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQMGRGVV  407
            ++ ME +G RF  TTEQ    +  N VSLTLGL H+ENLS  +  T H FL   +  G  
Sbjct  599  AFAMEDIGNRFNVTTEQLASRFHGNGVSLTLGLPHNENLS--ISGTQHGFLSQNIHLGRR  656

Query  406  IGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            +      +    + TP  +H  +  ++ +IQNRKRF AQLLPDFV
Sbjct  657  LEMGTTGNEFCAINTPPSSHSGTTYESIDIQNRKRFVAQLLPDFV  701



>ref|XP_010912386.1| PREDICTED: BEL1-like homeodomain protein 1 [Elaeis guineensis]
Length=663

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 59/102 (58%), Gaps = 15/102 (15%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQMGRGVVIGE  398
            +YP+  +GRF +EQF P +S N VSLTLGL + ENLS  +     +FL N+         
Sbjct  576  AYPIPDLGRFDSEQFTPRFSGNGVSLTLGLPYCENLS--LSGAQPSFLSNE---------  624

Query  397  AEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
                   +    P+ AHP++  ++ +IQNRKRF AQ LPDFV
Sbjct  625  ----SMPSFNNNPSVAHPSNAYESIDIQNRKRFAAQPLPDFV  662



>ref|XP_004494251.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cicer arietinum]
Length=686

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 63/106 (59%), Gaps = 15/106 (14%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPP-YSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQ---MGRGVV  407
            YP+  +GRF +EQF  P +S+N VSLTLGL        ++  TH  FLPNQ   +GR + 
Sbjct  592  YPIGDIGRFDSEQFTTPRFSSNGVSLTLGLD-------SIQGTHQTFLPNQNIQLGRSLD  644

Query  406  IGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFVT  269
            I  +E N+   G    +  H T   ++ N+QN KRF AQLLPDFV+
Sbjct  645  I--SEQNEF--GSINTSSPHSTGPFESINMQNPKRFAAQLLPDFVS  686



>gb|KHN21192.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=584

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 57/105 (54%), Gaps = 9/105 (9%)
 Frame = -1

Query  568  MEQMGRF---TTEQFPPPYSTNAVSLTLGLQHS-ENLSAAMFATHHNFLPNQMGRGVVIG  401
            ME +GRF    TEQ  P +  N VSLTLGL HS EN  +    T H FL   M  G+   
Sbjct  482  MEDIGRFHHHVTEQLAPRFHGNGVSLTLGLPHSTENNLSLSGTTQHGFLSQNMHLGMRNS  541

Query  400  EAEANDXVAGM--TTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            E   ND   G   TTP  +H     ++ +IQNRKRF AQLL DFV
Sbjct  542  E---NDEFCGAINTTPPSSHSGISYESIDIQNRKRFAAQLLRDFV  583



>ref|XP_003540818.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006592357.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
Length=741

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 57/105 (54%), Gaps = 9/105 (9%)
 Frame = -1

Query  568  MEQMGRF---TTEQFPPPYSTNAVSLTLGLQHS-ENLSAAMFATHHNFLPNQMGRGVVIG  401
            ME +GRF    TEQ  P +  N VSLTLGL HS EN  +    T H FL   M  G+   
Sbjct  639  MEDIGRFHHHVTEQLAPRFHGNGVSLTLGLPHSTENNLSLSGTTQHGFLSQNMHLGMRNS  698

Query  400  EAEANDXVAGM--TTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            E   ND   G   TTP  +H     ++ +IQNRKRF AQLL DFV
Sbjct  699  E---NDEFCGAINTTPPSSHSGISYESIDIQNRKRFAAQLLRDFV  740



>gb|KEH29763.1| BEL1-related homeotic protein [Medicago truncatula]
Length=711

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 60/104 (58%), Gaps = 3/104 (3%)
 Frame = -1

Query  577  SYPMEQMGRF-TTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQMGRGVVIG  401
            S+ ME + RF  +EQ  P +  N VSLTLGL H+EN+   + +T H FL   +  G  I 
Sbjct  610  SFSMEDIRRFNVSEQLAPRFHGNGVSLTLGLPHNENI--PLSSTQHGFLSQNLHLGGTID  667

Query  400  EAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFVT  269
            E  +N+        T +H  +  ++ +I+NRKRF AQLL +FVT
Sbjct  668  EMGSNENEFCTINTTPSHSETNYESIDIENRKRFAAQLLRNFVT  711



>gb|KEH24245.1| BEL1-related homeotic protein [Medicago truncatula]
Length=660

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 60/105 (57%), Gaps = 18/105 (17%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVI  404
            YP+  +GRF +EQF P +S+N VSLTLGL        ++   H  FLPN   Q+GR + I
Sbjct  571  YPIGDIGRFDSEQFAPRFSSNNVSLTLGLD-------SIQGNHQTFLPNQNIQLGRSIDI  623

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFVT  269
             E    +    + T +  +     ++ N+QN KRF AQLLPDFV+
Sbjct  624  SEP---NEFGSINTSSPQY-----ESINMQNPKRFAAQLLPDFVS  660



>emb|CBI24428.3| unnamed protein product [Vitis vinifera]
Length=573

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 51/100 (51%), Gaps = 19/100 (19%)
 Frame = -1

Query  571  PMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQMGRGVVIGEAE  392
            P+  +GRF  EQ  P +  N+VSLTLGL H ENLS             +MG G       
Sbjct  492  PIGDIGRFNPEQLAPRFHGNSVSLTLGLPHCENLSLL-----------EMGNG-------  533

Query  391  ANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
                  G+     +H  +  D+ NIQNRKRF AQLLPDFV
Sbjct  534  -EPDYCGINAAQPSHSNAAYDSINIQNRKRFAAQLLPDFV  572



>ref|XP_009629592.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009629593.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
Length=730

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 58/101 (57%), Gaps = 6/101 (6%)
 Frame = -1

Query  568  MEQMGRFTTEQ-FPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQMGRGVVIGEAE  392
            M + GRF  EQ     +  N VSLTLGL  SENL   +    HNFLPNQ   G+ +G  E
Sbjct  635  MGEFGRFNPEQQMATRFQGNGVSLTLGLPPSENL--VLSGNQHNFLPNQ-NIGIEMGRIE  691

Query  391  ANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFVT  269
             +     MT P  +HP+   +N + Q+ KR+ AQLLPDFV+
Sbjct  692  TH--YNRMTNPQPSHPSITYENIDFQSGKRYAAQLLPDFVS  730



>gb|KJB35453.1| hypothetical protein B456_006G115600 [Gossypium raimondii]
Length=717

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 58/102 (57%), Gaps = 10/102 (10%)
 Frame = -1

Query  568  MEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGVVIGE  398
            M  +GRF   Q    +  N+VSLTLGL H ENLS  +   H + L N   Q+GR + +G+
Sbjct  622  MGDIGRFDPNQLTQRFHGNSVSLTLGLPHCENLS--LSGNHQSLLSNQNIQLGRRLELGQ  679

Query  397  AEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            +E +    G+     A  +S    F +QNRKRF AQLLPDFV
Sbjct  680  SEVD--FCGINNTQQASHSST---FEMQNRKRFAAQLLPDFV  716



>ref|XP_009778869.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009778870.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009778871.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
Length=732

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 61/111 (55%), Gaps = 13/111 (12%)
 Frame = -1

Query  577  SYP-------MEQMGRFTTEQ-FPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQM  422
            SYP       M + GRF  EQ     +  N VSLTLGL  SENL   +  + HNFLPNQ 
Sbjct  627  SYPLMTAYSTMGEFGRFNPEQQMATSFQGNGVSLTLGLPPSENL--VLSGSQHNFLPNQ-  683

Query  421  GRGVVIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFVT  269
              G+ +G  E +     M+ P  +HP    +N + Q+ KR+ AQLLPDFV+
Sbjct  684  NIGIEMGRIETH--YNRMSNPQPSHPNITYENIDFQSGKRYAAQLLPDFVS  732



>gb|KHN17979.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=517

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 65/109 (60%), Gaps = 11/109 (10%)
 Frame = -1

Query  577  SYPMEQMG-RF--TTEQFPPPYSTNAVSLTLGLQHSENLSAAMFAT-HHNFLPN--QMGR  416
            ++ ME MG RF  TTEQ    +  N VSLTLGL H+ENLS  M  T  H FL     +GR
Sbjct  412  AFTMEDMGSRFNVTTEQLASRFHGNGVSLTLGLPHNENLS--MPGTQQHGFLSQNIHLGR  469

Query  415  GVVIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPA-QLLPDFV  272
             + +G    N+  A + TP  +H  +  ++ +IQNRKRF A QLLPDFV
Sbjct  470  RLEMG-TNGNEFCA-INTPPSSHSGTTYESIDIQNRKRFVAHQLLPDFV  516



>ref|XP_003539486.1| PREDICTED: BEL1-like homeodomain protein 1-like, partial [Glycine 
max]
Length=526

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 65/109 (60%), Gaps = 11/109 (10%)
 Frame = -1

Query  577  SYPMEQMG-RF--TTEQFPPPYSTNAVSLTLGLQHSENLSAAMFAT-HHNFLPN--QMGR  416
            ++ ME MG RF  TTEQ    +  N VSLTLGL H+ENLS  M  T  H FL     +GR
Sbjct  421  AFTMEDMGSRFNVTTEQLASRFHGNGVSLTLGLPHNENLS--MPGTQQHGFLSQNIHLGR  478

Query  415  GVVIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPA-QLLPDFV  272
             + +G    N+  A + TP  +H  +  ++ +IQNRKRF A QLLPDFV
Sbjct  479  RLEMG-TNGNEFCA-INTPPSSHSGTTYESIDIQNRKRFVAHQLLPDFV  525



>ref|XP_010521016.1| PREDICTED: BEL1-like homeodomain protein 1 [Tarenaya hassleriana]
Length=662

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 65/114 (57%), Gaps = 17/114 (15%)
 Frame = -1

Query  574  YPMEQMGRFTTEQ----FPPPYS---TNAVSLTLGLQHSENLSAAMFATHH-NFLPN---  428
            Y M++M RF          PP +    N VSLTLGL H E+LSA    THH NF+PN   
Sbjct  554  YQMDEMPRFDVSDHQHLIVPPRTFSGNNGVSLTLGLPHCESLSA----THHQNFMPNHNI  609

Query  427  QMGRGVVIGEAEANDXVAGMTTPTXAHPTSVXDN-FNIQNRKRFPAQLLPDFVT  269
            Q+GR V I   E +D  A   + +  H +SV  N  N++N+KRF AQLLPD V+
Sbjct  610  QLGRRVKI-NGETDDFGAMNASASTPHSSSVAYNGINMENQKRFVAQLLPDLVS  662



>ref|XP_010685441.1| PREDICTED: BEL1-like homeodomain protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=747

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 57/101 (56%), Gaps = 10/101 (10%)
 Frame = -1

Query  556  GRFTTEQFPP-PYSTNAVSLTLGLQHSENLSAAMFATHH-NFLPNQ----MGRGVVIGEA  395
            GRF  +Q    PY  NAVSLTLGL H ENLS      H  NFL NQ    +GR + +G  
Sbjct  651  GRFNPDQMTAHPYHGNAVSLTLGLPHCENLS---LGNHQQNFLQNQPNIQLGRRLELGPG  707

Query  394  EANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            +  D   G++    +HP +  +  +IQNRKRF AQL+ DF 
Sbjct  708  DQPD-FCGISMAQPSHPNNGFETIDIQNRKRFAAQLVHDFA  747



>ref|XP_009420594.1| PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 
1 [Musa acuminata subsp. malaccensis]
Length=669

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 63/106 (59%), Gaps = 10/106 (9%)
 Frame = -1

Query  577  SYPME-QMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN---QMGRGV  410
            +YP+  ++GRF  EQF P +S N VSLTLGLQHSE+L   +     +FL +   QMGR V
Sbjct  569  AYPIGGELGRFDAEQFAPRFSGNGVSLTLGLQHSESL--PLSGAQPSFLSSESMQMGRRV  626

Query  409  VIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
             +   EA D  +       AH ++ X   ++Q R+RF AQLLP+ +
Sbjct  627  EM-NTEAGDYCSLNNNAAVAHSSNAX---SVQGRERFSAQLLPELI  668



>ref|XP_003543416.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006594920.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006594921.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
 ref|XP_006594922.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X4 [Glycine 
max]
Length=702

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 62/108 (57%), Gaps = 8/108 (7%)
 Frame = -1

Query  577  SYPMEQMG-RF--TTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN--QMGRG  413
            ++ ME +G RF  TTEQ    +  N VSLTLGL H+ENLS +     H FL     +GR 
Sbjct  596  AFTMEDIGSRFNVTTEQLASRFHGNGVSLTLGLPHNENLSMS-GTQQHGFLSQNIHLGRR  654

Query  412  VVIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPA-QLLPDFV  272
            + +G    N+     T P  +H  +  ++ +IQNRKRF A QLLPDFV
Sbjct  655  LEMG-TNGNEFCTINTAPPSSHSGTTYESIDIQNRKRFVAHQLLPDFV  701



>ref|XP_004497655.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cicer arietinum]
Length=667

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 59/108 (55%), Gaps = 23/108 (21%)
 Frame = -1

Query  574  YPMEQMGRFTTEQFPPPYSTNA----VSLTLGLQHSENLSAAMFATHHNFLPN---QMGR  416
            YPME++GRF  E F P +S N     VSLTLGL             H +F+PN   Q+GR
Sbjct  575  YPMEEIGRFDEENFTPRFSGNNNNNGVSLTLGL------------PHQSFMPNENIQLGR  622

Query  415  GVVIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
             + I E    +   G    + +H ++  ++ N+QN KRF AQLLPDFV
Sbjct  623  RLEISE----NNEFGALNNSNSHSSAAFESINMQNPKRFAAQLLPDFV  666



>gb|KJB55565.1| hypothetical protein B456_009G082700 [Gossypium raimondii]
 gb|KJB55566.1| hypothetical protein B456_009G082700 [Gossypium raimondii]
Length=721

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 58/101 (57%), Gaps = 7/101 (7%)
 Frame = -1

Query  568  MEQMGRFT-TEQFPPPYSTNA-VSLTLGLQHSENLSAAMFATHHNFLPNQMGRGVVIGEA  395
            M ++GRF   +Q PP +  N+ VSLTLGL   ENLS  +   H NF+PNQ    V    A
Sbjct  625  MREVGRFNHGQQLPPGFHGNSGVSLTLGLPDCENLS--LSGNHQNFVPNQTINDVE--GA  680

Query  394  EANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
              +D  A  T P  +H T+  D   +Q+RKRF A LLPDFV
Sbjct  681  TQSDFCAINTQPQPSHSTTY-DTMEMQSRKRFAAPLLPDFV  720



>gb|KHF99976.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=693

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 57/102 (56%), Gaps = 18/102 (18%)
 Frame = -1

Query  568  MEQMGRFTTEQ-FPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQMGRGVVIGEAE  392
            M ++GRF  EQ  PP +  N+VSLTLGL H ENLS  +     NFL N            
Sbjct  606  MGEIGRFNEEQQLPPKFHGNSVSLTLGLPHCENLS--LSGNPQNFLSN------------  651

Query  391  ANDXVAGMTTPTXAHPTSVX-DNFN-IQNRKRFPAQLLPDFV  272
             ++   G+ TP  +H  +   DN + +QNR+RF AQLLPDFV
Sbjct  652  -HNIQLGINTPHASHSNAAGFDNIHEMQNRQRFAAQLLPDFV  692



>gb|KJB09137.1| hypothetical protein B456_001G125400 [Gossypium raimondii]
 gb|KJB09138.1| hypothetical protein B456_001G125400 [Gossypium raimondii]
 gb|KJB09139.1| hypothetical protein B456_001G125400 [Gossypium raimondii]
Length=693

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 57/102 (56%), Gaps = 18/102 (18%)
 Frame = -1

Query  568  MEQMGRFTTEQ-FPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQMGRGVVIGEAE  392
            M ++GRF  EQ  PP +  N+VSLTLGL H ENLS  +     NFL N            
Sbjct  606  MGEIGRFNEEQQLPPKFHGNSVSLTLGLPHCENLS--LSRNPQNFLSN------------  651

Query  391  ANDXVAGMTTPTXAHPTSVX-DNFN-IQNRKRFPAQLLPDFV  272
             ++   G+ TP  +H  +   DN + +QNR+RF AQLLPDFV
Sbjct  652  -HNIQLGINTPHASHSNAAGFDNIHEMQNRQRFAAQLLPDFV  692



>ref|XP_008799712.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
 ref|XP_008799713.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
Length=673

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 57/103 (55%), Gaps = 14/103 (14%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNA-VSLTLGLQHSENLSAAMFATHHNFLPNQMGRGVVIG  401
            +YP+  +GRF +EQF P +  N  VSLTLGL   EN S  +      FL N+       G
Sbjct  583  AYPIAGIGRFDSEQFAPRFPGNGGVSLTLGLPQCENFS--LSGAQPPFLSNE-------G  633

Query  400  EAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
             A  N       +   AHP+S  ++ +IQ+RKRF A+LLPDFV
Sbjct  634  MASFNSN----PSAAPAHPSSAYESIDIQSRKRFAARLLPDFV  672



>emb|CDX84171.1| BnaC04g09330D [Brassica napus]
Length=588

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 58/112 (52%), Gaps = 15/112 (13%)
 Frame = -1

Query  574  YPMEQMGRFTT-----EQFPPPYS--TNAVSLTLGLQHSENLSA----AMFATHHNFLPN  428
            Y M++M RF       E     YS   N VSLTLGL H ++LS+        THH  +P 
Sbjct  480  YQMDEMSRFDVAVSDQELLAQRYSGNNNGVSLTLGLPHCDSLSSTRHQGFMQTHHG-IP-  537

Query  427  QMGRGVVIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
             +GR V IGE E     A ++  T     +     NIQN+KR+ AQLLPDFV
Sbjct  538  -IGRRVKIGETEEYG-AANISAATVHSSAAAYSAMNIQNQKRYVAQLLPDFV  587



>ref|XP_006494895.1| PREDICTED: BEL1-like homeodomain protein 1-like [Citrus sinensis]
Length=672

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 57/107 (53%), Gaps = 19/107 (18%)
 Frame = -1

Query  562  QMGRFTTE------QFPPP--YSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQMGRGVV  407
            ++GRF  +      Q   P  +  N VSLTLGL H ENLS  +  + HN L +       
Sbjct  576  EIGRFNPDNHHHHHQLAAPTFHGNNGVSLTLGLPHCENLS--LSGSQHNLLSS-------  626

Query  406  IGEAEANDXVAGMTTPTX-AHPTSVXDNFNIQNRKRFPAQLLPDFVT  269
             G+    D   G+ TP   +H  +  ++ +IQ+RKRF AQLLPDFVT
Sbjct  627  -GQNIEPDHFCGIETPQHNSHSGTAYESIDIQSRKRFAAQLLPDFVT  672



>emb|CDX75085.1| BnaA05g08310D [Brassica napus]
Length=628

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 58/111 (52%), Gaps = 13/111 (12%)
 Frame = -1

Query  574  YPMEQMGRFTT-----EQFPPPYS--TNAVSLTLGLQHSENLSAAM---FATHHNFLPNQ  425
            Y M++M RF       E     YS   N VSLTLGL H ++LS+     F   H+ +P  
Sbjct  520  YQMDEMSRFDVAVSDQELLAQRYSGNNNGVSLTLGLPHCDSLSSTRHQGFMQTHHGIP--  577

Query  424  MGRGVVIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            +GR V IG+ E     A ++  T     +     NIQN+KR+ AQLLPDFV
Sbjct  578  IGRRVKIGDTEEYGS-ANISAATVHSSAAAYSAMNIQNQKRYVAQLLPDFV  627



>gb|KDO46590.1| hypothetical protein CISIN_1g005901mg [Citrus sinensis]
 gb|KDO46591.1| hypothetical protein CISIN_1g005901mg [Citrus sinensis]
 gb|KDO46592.1| hypothetical protein CISIN_1g005901mg [Citrus sinensis]
Length=671

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 57/107 (53%), Gaps = 19/107 (18%)
 Frame = -1

Query  562  QMGRFTTE------QFPPP--YSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQMGRGVV  407
            ++GRF  +      Q   P  +  N VSLTLGL H ENLS  +  + HN L +       
Sbjct  575  EIGRFNPDNHHHHHQLAAPTFHGNNGVSLTLGLPHCENLS--LSGSQHNLLSS-------  625

Query  406  IGEAEANDXVAGMTTPTX-AHPTSVXDNFNIQNRKRFPAQLLPDFVT  269
             G+    D   G+ TP   +H  +  ++ +IQ+RKRF AQLLPDFVT
Sbjct  626  -GQNIEPDHFCGIETPQHNSHSGTAYESIDIQSRKRFAAQLLPDFVT  671



>ref|XP_006424091.1| hypothetical protein CICLE_v10027955mg [Citrus clementina]
 gb|ESR37331.1| hypothetical protein CICLE_v10027955mg [Citrus clementina]
Length=671

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 57/107 (53%), Gaps = 19/107 (18%)
 Frame = -1

Query  562  QMGRFTTE------QFPPP--YSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQMGRGVV  407
            ++GRF  +      Q   P  +  N VSLTLGL H ENLS  +  + HN L +       
Sbjct  575  EIGRFNPDNHHHHHQLAAPTFHGNNGVSLTLGLPHCENLS--LSGSQHNLLSS-------  625

Query  406  IGEAEANDXVAGMTTPTX-AHPTSVXDNFNIQNRKRFPAQLLPDFVT  269
             G+    D   G+ TP   +H  +  ++ +IQ+RKRF AQLLPDFVT
Sbjct  626  -GQNIEPDHFCGIETPQHNSHSGTAYESIDIQSRKRFAAQLLPDFVT  671



>emb|CDY40420.1| BnaA04g20970D [Brassica napus]
Length=632

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 60/119 (50%), Gaps = 21/119 (18%)
 Frame = -1

Query  574  YPMEQMGRFTT-----EQFPPPYS--TNAVSLTLGLQHSENLSA----AMFATHHNFLPN  428
            Y M++M RF       E     YS   N VSLTLGL H ++LS+        THH  +P 
Sbjct  516  YQMDEMSRFEVAVSDQELLAQRYSGNNNGVSLTLGLPHCDSLSSTHHQGFMQTHHG-IP-  573

Query  427  QMGRGVVIGEAE-------ANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
             +GR V IGEA+            +  T  + A   +  +  NIQN+KR+ AQLLPDFV
Sbjct  574  -IGRRVKIGEADDYGAAALNGGGGSAATVHSSATAAAAYNGMNIQNQKRYVAQLLPDFV  631



>ref|XP_004506223.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cicer arietinum]
Length=636

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 11/105 (10%)
 Frame = -1

Query  577  SYPMEQMGRF--TTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQMGRGVVI  404
            S+ M+ +GRF  + +Q  P    N VSLTLGL H+EN+S  + +T H FL   +  G  I
Sbjct  541  SFSMDNIGRFNVSDQQLAPKCHGNGVSLTLGLPHNENVS--LSSTQHGFLSQNIHLGGRI  598

Query  403  GEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFVT  269
             E   N+              +  ++ +IQNRKRF AQLL +FV 
Sbjct  599  NEMGGNEN-------EFCAINNNNESVDIQNRKRFAAQLLRNFVV  636



>emb|CDX84585.1| BnaA03g16450D [Brassica napus]
Length=671

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 62/121 (51%), Gaps = 25/121 (21%)
 Frame = -1

Query  574  YPMEQMGRFT---------TEQFPPPYSTNAVSLTLGLQHSENLSA----AMFATHHNFL  434
            Y M++M RF          T++F    + N VSLTLGL H ++LS+        THH   
Sbjct  555  YQMDEMSRFNVAVSDQELLTQRFSG--NNNGVSLTLGLPHCDSLSSTHHQGFMQTHHGI-  611

Query  433  PNQMGRGVVIGEAE--ANDXVAGMT-----TPTXAHPTSVXDNFNIQNRKRFPAQLLPDF  275
              Q+GR V IGE E   N  + G +       + A   +  +  NIQN+KR+ AQLLPDF
Sbjct  612  --QIGRSVKIGETEEYGNSAINGGSGSTATAHSSAAAAAAYNGMNIQNQKRYVAQLLPDF  669

Query  274  V  272
            V
Sbjct  670  V  670



>ref|XP_009141535.1| PREDICTED: BEL1-like homeodomain protein 1 [Brassica rapa]
 ref|XP_009141536.1| PREDICTED: BEL1-like homeodomain protein 1 [Brassica rapa]
 ref|XP_009141537.1| PREDICTED: BEL1-like homeodomain protein 1 [Brassica rapa]
Length=675

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 60/119 (50%), Gaps = 21/119 (18%)
 Frame = -1

Query  574  YPMEQMGRFTT-----EQFPPPYS--TNAVSLTLGLQHSENLSA----AMFATHHNFLPN  428
            Y M++M RF       E     YS   N VSLTLGL H ++LS+        THH  +P 
Sbjct  559  YQMDEMSRFEVAVSDQELLAQRYSGNNNGVSLTLGLPHCDSLSSTHHQGFMQTHHG-IP-  616

Query  427  QMGRGVVIGEAE-------ANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
             +GR V IGEA+            +  T  + A   +  +  NIQN+KR+ AQLLPDFV
Sbjct  617  -IGRRVKIGEADDYGAAALNGGGGSAATVHSSATAAAAYNGMNIQNQKRYVAQLLPDFV  674



>emb|CDX79646.1| BnaC03g19820D [Brassica napus]
Length=691

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 62/121 (51%), Gaps = 25/121 (21%)
 Frame = -1

Query  574  YPMEQMGRFT---------TEQFPPPYSTNAVSLTLGLQHSENLSA----AMFATHHNFL  434
            Y M++M RF          T++F    + N VSLTLGL H ++LS+        THH   
Sbjct  575  YQMDEMSRFNVAVSDQELLTQRFSG--NINGVSLTLGLPHCDSLSSTHHQGFMQTHHGI-  631

Query  433  PNQMGRGVVIGEAE--ANDXVAG-----MTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDF  275
              Q+GR V IGE E   N  + G      T  + A   +  +  NIQN+KR+ AQLLPDF
Sbjct  632  --QIGRSVKIGETEEYGNSAINGGSGSAATAHSSAAAAAAYNGMNIQNQKRYVAQLLPDF  689

Query  274  V  272
            V
Sbjct  690  V  690



>ref|XP_009133059.1| PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 
1 [Brassica rapa]
Length=658

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 62/121 (51%), Gaps = 25/121 (21%)
 Frame = -1

Query  574  YPMEQMGRFT---------TEQFPPPYSTNAVSLTLGLQHSENLSA----AMFATHHNFL  434
            Y M++M RF          T++F    + N VSLTLGL H ++LS+        THH   
Sbjct  542  YQMDEMSRFNVAVSDQELLTQRFSG--NNNGVSLTLGLPHCDSLSSTHHQGFMQTHHGI-  598

Query  433  PNQMGRGVVIGEAE--ANDXVAG-----MTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDF  275
              Q+GR V IGE E   N  + G      T  + A   +  +  NIQN+KR+ AQLLPDF
Sbjct  599  --QIGRSVKIGETEEYGNSAINGGSGSAATAHSSAAAAAAYNGMNIQNQKRYVAQLLPDF  656

Query  274  V  272
            V
Sbjct  657  V  657



>ref|XP_003539151.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006591059.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006591060.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
Length=764

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 58/115 (50%), Gaps = 16/115 (14%)
 Frame = -1

Query  568  MEQMGRF------TTEQ--FPPPYSTNAVSLTLGLQHS----ENLSAAMFATHHNFLPNQ  425
            ME +GRF       T+Q    P +  N VSLTLGL HS     NLS +     H FL   
Sbjct  649  MEDIGRFHHHHHHVTDQQSLAPRFHGNGVSLTLGLPHSTENNNNLSLSGTTHQHGFLSQN  708

Query  424  MGRGVVIGEAEANDXVAG---MTTPTXAHPTSVXDNFNI-QNRKRFPAQLLPDFV  272
            M  G+      AN+   G    T P+ +H  +  ++ +I QNRKRF AQLL DFV
Sbjct  709  MHLGMRSTTNNANNEFCGAINTTPPSNSHSGTSYESIDIIQNRKRFAAQLLRDFV  763



>ref|XP_008230296.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008230304.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
Length=655

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 60/112 (54%), Gaps = 15/112 (13%)
 Frame = -1

Query  577  SYPMEQMGRFTT--EQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN--------  428
            +YP+ ++GRF    E     +  N VSLTLGL H EN  +++  T  +FL N        
Sbjct  548  TYPIPEIGRFDMNPEHLAQRFHGNGVSLTLGLPHREN--SSLSGTQQSFLSNHGQINIHD  605

Query  427  QMGRGVVIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            Q+GR    G  EA+     +  P  +H     ++ ++++RKRF AQLLPDFV
Sbjct  606  QLGRRFNTG-GEAD--FCAINHPQPSHSGIDYEDMDMRSRKRFAAQLLPDFV  654



>ref|XP_006293790.1| hypothetical protein CARUB_v10022772mg [Capsella rubella]
 gb|EOA26688.1| hypothetical protein CARUB_v10022772mg [Capsella rubella]
Length=679

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 60/117 (51%), Gaps = 19/117 (16%)
 Frame = -1

Query  574  YPMEQMGRFTT----EQFPPPYS--TNAVSLTLGLQHSENLSA----AMFATHHNFLPNQ  425
            Y M++M RF      E     YS   N VSLTLGL H +NLS+        THH  +P  
Sbjct  565  YQMDEMSRFDVVSDQELMAQRYSGNNNGVSLTLGLPHCDNLSSTHHQGFMQTHHG-IP--  621

Query  424  MGRGVVIGEAEA------NDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            +GR V IGE E       N   +  T  + A   +  +  NIQN+KR+ AQLLPDFV
Sbjct  622  IGRRVKIGETEEYGAAAINGGGSAATAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFV  678



>gb|KHN19925.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=767

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 58/118 (49%), Gaps = 19/118 (16%)
 Frame = -1

Query  568  MEQMGRF---------TTEQ--FPPPYSTNAVSLTLGLQHS----ENLSAAMFATHHNFL  434
            ME +GRF          T+Q    P +  N VSLTLGL HS     NLS +     H FL
Sbjct  649  MEDIGRFHHHHHHHHHVTDQQSLAPRFHGNGVSLTLGLPHSTENNNNLSLSGTTHQHGFL  708

Query  433  PNQMGRGVVIGEAEANDXVAG---MTTPTXAHPTSVXDNFNI-QNRKRFPAQLLPDFV  272
               M  G+      AN+   G    T P+ +H  +  ++ +I QNRKRF AQLL DFV
Sbjct  709  SQNMHLGMRSTTNNANNEFCGAINTTPPSNSHSGTSYESIDIIQNRKRFAAQLLRDFV  766



>ref|XP_010507571.1| PREDICTED: BEL1-like homeodomain protein 1 [Camelina sativa]
Length=233

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 60/117 (51%), Gaps = 19/117 (16%)
 Frame = -1

Query  574  YPMEQMGRFTT----EQFPPPYS--TNAVSLTLGLQHSENLSA----AMFATHHNFLPNQ  425
            Y M++M RF      E     YS   N VSLTLGL H ++LS+        THH  +P  
Sbjct  119  YQMDEMSRFDVVSDQELMAQRYSGNNNGVSLTLGLPHCDSLSSTHHQGFMQTHHG-IP--  175

Query  424  MGRGVVIGEAEA------NDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            +GR V IGE E       N   +  T  + A   +  +  NIQN+KR+ AQLLPDFV
Sbjct  176  IGRRVKIGETEEYGTASINGGGSATTAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFV  232



>ref|XP_006410764.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 ref|XP_006410765.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 ref|XP_006410766.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 gb|ESQ52217.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 gb|ESQ52218.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 gb|ESQ52219.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
Length=677

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 60/116 (52%), Gaps = 18/116 (16%)
 Frame = -1

Query  574  YPMEQMGRFTT-----EQFPPPYS--TNAVSLTLGLQHSENLSA----AMFATHHNFLPN  428
            Y M++M RF       E     YS   N VSLTLGL H ++LS+        THH  +P 
Sbjct  564  YQMDEMSRFDVAVSDQELLAQRYSGNNNGVSLTLGLPHCDSLSSTHHQGFMQTHHG-IP-  621

Query  427  QMGRGVVIGEAE----ANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
             +GR V IGE E    A     G +  T     +V +  NIQN+KR+ AQLLPDFV
Sbjct  622  -IGRRVKIGETEEYGAAALNGGGGSAATAHSSAAVYNGMNIQNQKRYVAQLLPDFV  676



>gb|AEW09250.1| hypothetical protein UMN_1142_01, partial [Pinus lambertiana]
 gb|AFB34663.1| hypothetical protein UMN_1142_01, partial [Pinus cembra]
 gb|AFB34664.1| hypothetical protein UMN_1142_01, partial [Pinus cembra]
Length=100

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 49/98 (50%), Gaps = 4/98 (4%)
 Frame = -1

Query  559  MGRFTTEQFPPPYS-TNAVSLTLGLQHSENLSAAMFATHHNFLPNQ-MGRGVVIGEAEAN  386
            + R+  E F P YS    VSLTLGLQH ++LS  +  T  ++   Q +G G     A  +
Sbjct  4    LSRYGQETFTPKYSGIGGVSLTLGLQHCDDLS--LSGTQQSYNSTQGLGSGRRHDLASDS  61

Query  385  DXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            D    +   +     S  DN ++QN KRF   +L DFV
Sbjct  62   DDYCHIHDTSAVRGASNYDNMSMQNGKRFATHMLHDFV  99



>emb|CDP15553.1| unnamed protein product [Coffea canephora]
Length=725

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 59/107 (55%), Gaps = 8/107 (7%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQ---MGRGVV  407
            ++ + ++G+F  EQ    +  N+VSLTLGL  SENL A    T  N+L +Q   +   + 
Sbjct  623  AFNLGELGQFNPEQLTTGFHGNSVSLTLGLPPSENL-ALSAGTQQNYLSDQNMELEDRLE  681

Query  406  IGEAEAN-DXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFVT  269
            +G  + + D V    T   +H +   +  N  NRKRF AQLLPDFVT
Sbjct  682  MGTMDGHYDRVNKTQT---SHSSLGYETINFDNRKRFAAQLLPDFVT  725



>gb|AEW09251.1| hypothetical protein UMN_1142_01, partial [Pinus radiata]
 gb|AFG58515.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58516.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58517.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58518.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58519.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58520.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58521.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58522.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58523.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58524.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58525.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58526.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58527.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
Length=100

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 48/98 (49%), Gaps = 4/98 (4%)
 Frame = -1

Query  559  MGRFTTEQFPPPYS-TNAVSLTLGLQHSENLSAAMFATHHNFLPNQ-MGRGVVIGEAEAN  386
            + R+  E F P YS    VSLTLGLQH ++LS  +  T  ++   Q +G G     A   
Sbjct  4    LSRYGQETFTPKYSGIGGVSLTLGLQHCDDLS--LSGTQQSYNSTQGLGSGRRHDLASDT  61

Query  385  DXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            D    +   +     S  DN ++QN KRF   +L DFV
Sbjct  62   DDYCHIHDASAVRGASNYDNMSMQNGKRFATHMLHDFV  99



>ref|XP_002881420.1| hypothetical protein ARALYDRAFT_482564 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57679.1| hypothetical protein ARALYDRAFT_482564 [Arabidopsis lyrata subsp. 
lyrata]
Length=671

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 60/117 (51%), Gaps = 19/117 (16%)
 Frame = -1

Query  574  YPMEQMGRFTT----EQFPPPYS--TNAVSLTLGLQHSENLSA----AMFATHHNFLPNQ  425
            Y M++M RF      E     YS   N VSLTLGL H ++LS+        THH  +P  
Sbjct  557  YQMDEMSRFDVVSDQELMAQRYSGNNNGVSLTLGLPHCDSLSSTHHQGFMQTHHG-IP--  613

Query  424  MGRGVVIGEAEA------NDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            +GR V IGE E       N   +  T  + A   +  +  NIQN+KR+ AQLLPDFV
Sbjct  614  IGRRVKIGETEEYGAATINGGSSATTAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFV  670



>ref|XP_007208166.1| hypothetical protein PRUPE_ppa002583mg [Prunus persica]
 gb|EMJ09365.1| hypothetical protein PRUPE_ppa002583mg [Prunus persica]
Length=655

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 59/112 (53%), Gaps = 15/112 (13%)
 Frame = -1

Query  577  SYPMEQMGRFTT--EQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPN--------  428
            +YP+ ++ RF    E     +  N VSLTLGL H EN+S  +  T  +FL N        
Sbjct  548  TYPIPEIERFDMNPEHLAQRFHGNGVSLTLGLPHRENIS--LSGTQQSFLSNHGQINIHD  605

Query  427  QMGRGVVIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            Q+GR    G  EA+     +  P  +H     ++ ++++RKRF AQLLPDFV
Sbjct  606  QLGRRFNTG-GEAD--FCAINHPQPSHSGIDYEDMDMRSRKRFAAQLLPDFV  654



>gb|AAK43836.1|AF353094_1 BEL1-like homeodomain 1 [Arabidopsis thaliana]
Length=680

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 60/117 (51%), Gaps = 19/117 (16%)
 Frame = -1

Query  574  YPMEQMGRFTT----EQFPPPYS--TNAVSLTLGLQHSENLSA----AMFATHHNFLPNQ  425
            Y M++M RF      E     YS   N VSLTLGL H ++LS+        THH  +P  
Sbjct  566  YQMDEMSRFDVVSDQELMAQRYSGNNNGVSLTLGLPHCDSLSSTDHQGFMQTHHG-IP--  622

Query  424  MGRGVVIGEAEA------NDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            +GR V IGE E       N   +  T  + A   +  +  NIQN+KR+ AQLLPDFV
Sbjct  623  IGRRVKIGETEEYGPATINGGSSTTTAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFV  679



>ref|NP_181138.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
 ref|NP_850256.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
 ref|NP_001031490.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
 sp|Q9SJ56.1|BLH1_ARATH RecName: Full=BEL1-like homeodomain protein 1; Short=BEL1-like 
protein 1; AltName: Full=Protein EMBRYO SAC DEVELOPMENT ARREST 
29 [Arabidopsis thaliana]
 gb|AAD21463.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AAL59997.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AAM20198.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AAM20705.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AAP37781.1| At2g35940 [Arabidopsis thaliana]
 dbj|BAE99297.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AEC09179.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
 gb|AEC09180.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
 gb|AEC09181.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
Length=680

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 60/117 (51%), Gaps = 19/117 (16%)
 Frame = -1

Query  574  YPMEQMGRFTT----EQFPPPYS--TNAVSLTLGLQHSENLSA----AMFATHHNFLPNQ  425
            Y M++M RF      E     YS   N VSLTLGL H ++LS+        THH  +P  
Sbjct  566  YQMDEMSRFDVVSDQELMAQRYSGNNNGVSLTLGLPHCDSLSSTHHQGFMQTHHG-IP--  622

Query  424  MGRGVVIGEAEA------NDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            +GR V IGE E       N   +  T  + A   +  +  NIQN+KR+ AQLLPDFV
Sbjct  623  IGRRVKIGETEEYGPATINGGSSTTTAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFV  679



>ref|XP_010516801.1| PREDICTED: BEL1-like homeodomain protein 1 [Camelina sativa]
Length=260

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 59/117 (50%), Gaps = 19/117 (16%)
 Frame = -1

Query  574  YPMEQMGRFTT----EQFPPPYS--TNAVSLTLGLQHSENLSA----AMFATHHNFLPNQ  425
            Y M++M RF      E     YS   N VSLTLGL H ++LS+        THH    N 
Sbjct  146  YQMDEMSRFDVVSDQELMAQRYSGNNNGVSLTLGLPHCDSLSSTHHQGFMQTHHG---NP  202

Query  424  MGRGVVIGEAE------ANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            +GR V IGE E       N   +  T  + A   +  +  NIQN+KR+ AQLLPDFV
Sbjct  203  IGRRVKIGETEEYGAAAXNGGGSATTAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFV  259



>ref|XP_010505121.1| PREDICTED: BEL1-like homeodomain protein 1 [Camelina sativa]
Length=675

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 60/117 (51%), Gaps = 19/117 (16%)
 Frame = -1

Query  574  YPMEQMGRFTT----EQFPPPYS--TNAVSLTLGLQHSENLSA----AMFATHHNFLPNQ  425
            Y M++M RF      E     YS   N VSLTLGL H ++LS+        THH  +P  
Sbjct  561  YQMDEMSRFDVVSDQELMAQRYSGNNNGVSLTLGLPHCDSLSSTHHQGFMQTHHG-IP--  617

Query  424  MGRGVVIGEAEA------NDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            +GR V IGE E       N   +  T  + A   +  +  NIQN+KR+ AQLLPDFV
Sbjct  618  IGRRVKIGETEEYGTASINGGGSATTAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFV  674



>ref|XP_007150021.1| hypothetical protein PHAVU_005G119300g [Phaseolus vulgaris]
 gb|ESW22015.1| hypothetical protein PHAVU_005G119300g [Phaseolus vulgaris]
Length=708

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 51/95 (54%), Gaps = 5/95 (5%)
 Frame = -1

Query  577  SYPMEQMG-RF--TTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQMGRGVV  407
            ++ ME +G RF  TTEQ    +  N VSLTLGL H+ENLS +   T H FL   +  G  
Sbjct  599  AFAMEDIGNRFNVTTEQLASRFHGNGVSLTLGLPHNENLSIS--GTQHGFLSQNIHLGRR  656

Query  406  IGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKR  302
            +      +    + TP  +H  +  ++ +IQNRKR
Sbjct  657  LEMGTTGNEFCAINTPPSSHSGTTYESIDIQNRKR  691



>ref|XP_010509532.1| PREDICTED: BEL1-like homeodomain protein 1 [Camelina sativa]
Length=678

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 60/117 (51%), Gaps = 19/117 (16%)
 Frame = -1

Query  574  YPMEQMGRFTT----EQFPPPYS--TNAVSLTLGLQHSENLSA----AMFATHHNFLPNQ  425
            Y M++M RF      E     YS   N VSLTLGL H ++LS+        THH  +P  
Sbjct  564  YQMDEMSRFDVVSDQELMAQRYSGNNNGVSLTLGLPHCDSLSSTHHQGFMQTHHG-IP--  620

Query  424  MGRGVVIGEAEA------NDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
            +GR V IGE E       N   +  T  + A   +  +  NIQN+KR+ AQLLPDFV
Sbjct  621  IGRRVKIGETEEYGAAAINGGGSATTAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFV  677



>gb|AFB32720.1| hypothetical protein 0_17161_01, partial [Larix decidua]
Length=129

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 56/102 (55%), Gaps = 9/102 (9%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYS-TNAVSLTLGLQHSENLSAAMFATHHNFLPNQ---MGRGV  410
            SY +  + R+  E F P +S +  VSLTLGLQ ++ LS  +  T  N++  Q   +GR  
Sbjct  32   SYQIGDLSRYGHESFTPRFSGSGGVSLTLGLQRTDGLS--LQGTQQNYMSTQSLALGRRH  89

Query  409  VIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLL  284
             +G   ++     + T T AHP ++ +N NIQ RK F  QL+
Sbjct  90   DLGGNSSD--YCNIETST-AHPANIYENLNIQPRKCFATQLM  128



>emb|CDY32069.1| BnaC04g44970D [Brassica napus]
Length=636

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 60/119 (50%), Gaps = 21/119 (18%)
 Frame = -1

Query  574  YPMEQMGRFTT-----EQFPPPYS--TNAVSLTLGLQHSENLSA----AMFATHHNFLPN  428
            Y M++M RF       E     YS   N VSLTLGL H ++LS+        THH  +P 
Sbjct  520  YQMDEMSRFEVAVSDQELLAQRYSGNNNGVSLTLGLPHCDSLSSTHHQGFMQTHHG-IP-  577

Query  427  QMGRGVVIGEAE-------ANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
             +GR V IGEA+            +  T  + A   +  +  NIQN+KR+ AQLLPDFV
Sbjct  578  -IGRRVKIGEADDYGAAALNGGGGSAATVHSSAAAAAAYNGMNIQNQKRYVAQLLPDFV  635



>ref|XP_010093716.1| BEL1-like homeodomain protein 1 [Morus notabilis]
 gb|EXC39356.1| BEL1-like homeodomain protein 1 [Morus notabilis]
Length=422

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 51/108 (47%), Gaps = 23/108 (21%)
 Frame = -1

Query  577  SYPMEQMGRFTTE------QFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQMGR  416
            +YP+  +GRF         Q  P +  N VSLTLGL H EN S          L NQ   
Sbjct  331  AYPVGDLGRFHLSADHHHHQLAPRFHGNGVSLTLGLPHCENHS----------LSNQ---  377

Query  415  GVVIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
             ++       D   G    T +  T   DN ++Q+RKRF AQLLPDFV
Sbjct  378  NIIDPSGTRLDNSIG----TGSESTGNYDNMDMQSRKRFVAQLLPDFV  421



>ref|XP_010089795.1| BEL1-like homeodomain protein 1 [Morus notabilis]
 gb|EXB38411.1| BEL1-like homeodomain protein 1 [Morus notabilis]
Length=687

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 51/108 (47%), Gaps = 23/108 (21%)
 Frame = -1

Query  577  SYPMEQMGRFTTE------QFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQMGR  416
            +YP+  +GRF         Q  P +  N VSLTLGL H EN S          L NQ   
Sbjct  596  AYPVGDLGRFHLSADHHHHQLAPRFHGNGVSLTLGLPHCENHS----------LSNQ---  642

Query  415  GVVIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLLPDFV  272
             ++       D   G    T +  T   DN ++Q+RKRF AQLLPDFV
Sbjct  643  NIIDPSGTRLDNSIG----TGSESTGNYDNMDMQSRKRFVAQLLPDFV  686



>gb|AFB32721.1| hypothetical protein 0_17161_01, partial [Pinus mugo]
 gb|AFB32722.1| hypothetical protein 0_17161_01, partial [Pinus mugo]
 gb|AFB32723.1| hypothetical protein 0_17161_01, partial [Pinus mugo]
Length=129

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 54/102 (53%), Gaps = 9/102 (9%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYS-TNAVSLTLGLQHSENLSAAMFATHHNFLPNQ---MGRGV  410
            SY +  + R+  E F P +S +  VSLTLGLQ ++ LS  +     N++  Q   +GR  
Sbjct  32   SYQIGDLSRYGHESFTPRFSGSGGVSLTLGLQRTDGLS--LQGAQQNYMSTQSLALGRRH  89

Query  409  VIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLL  284
             +G   ++     ++ P   HP ++ +N NIQ RK F  QL+
Sbjct  90   DLGGNSSDYCNIEISAP---HPANLYENINIQPRKCFATQLM  128



>gb|AEW08020.1| hypothetical protein 0_17161_01, partial [Pinus lambertiana]
Length=129

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (52%), Gaps = 9/102 (9%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYS-TNAVSLTLGLQHSENLSAAMFATHHNFLPNQ---MGRGV  410
            SY +  + R+  E F P +S +  VSLTLGLQ ++ LS  +     N++  Q   +GR  
Sbjct  32   SYQIGDLSRYGHESFTPRFSGSGGVSLTLGLQRTDGLS--LQGAQQNYMSTQSLALGRRH  89

Query  409  VIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLL  284
             +G   ++      + P   HP ++ +N NIQ RK F  QL+
Sbjct  90   DLGGNSSDYCNIETSAP---HPANIYENINIQPRKCFATQLM  128



>gb|ACC77468.1| BEL1 [Kalanchoe x houghtonii]
Length=641

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 53/105 (50%), Gaps = 18/105 (17%)
 Frame = -1

Query  577  SYPMEQMGRF-TTEQFPPPYS-TNAVSLTLGLQHSENLSAAMFATHHNFLPNQMGRGVVI  404
            S P+E++ +F ++ Q+ P +S    VSLTLGL  +               PNQ  R +  
Sbjct  551  SCPLEEINQFDSSHQYQPRFSGKGGVSLTLGLTDT-------------LFPNQNMRRMDT  597

Query  403  GEAEANDXVAGMTTPTXAHPTSVX-DNFNIQNRKRFPAQLLPDFV  272
            GEA     +     P  A  TS   ++ NIQN KRFP QLLPDFV
Sbjct  598  GEASEFGTIN--NNPNPARTTSTAYESINIQNPKRFPVQLLPDFV  640



>gb|AEW08021.1| hypothetical protein 0_17161_01, partial [Pinus radiata]
 gb|AFG47671.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47672.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47673.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47674.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47675.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47676.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47677.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47678.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47679.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47680.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47681.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47682.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47683.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47684.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
Length=129

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (52%), Gaps = 9/102 (9%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYS-TNAVSLTLGLQHSENLSAAMFATHHNFLPNQ---MGRGV  410
            SY +  + R+  E F P +S +  VSLTLGLQ ++ LS  +     N++  Q   +GR  
Sbjct  32   SYQIGDLSRYGHESFTPRFSGSGGVSLTLGLQRTDGLS--LQGAQQNYMSTQSLALGRRH  89

Query  409  VIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLL  284
             +G   ++      + P   HP ++ +N NIQ RK F  QL+
Sbjct  90   DLGGNSSDYCNIETSAP---HPANLYENINIQPRKCFATQLM  128



>ref|XP_010931060.1| PREDICTED: BEL1-like homeodomain protein 1 [Elaeis guineensis]
 ref|XP_010931061.1| PREDICTED: BEL1-like homeodomain protein 1 [Elaeis guineensis]
Length=621

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYSTNAVSLTLGLQHSENLSAAMFATHHNFLPNQMGRGV  410
            +YP+  +GRF +EQF P +S N VSLTLGL   EN S  +     +FL +++ RG+
Sbjct  560  AYPVAGIGRFDSEQFAPSFSGNGVSLTLGLPQCENFS--LSGAQPSFLTSRVERGL  613



>gb|AFB32724.1| hypothetical protein 0_17161_01, partial [Pinus mugo]
Length=129

 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 52/102 (51%), Gaps = 9/102 (9%)
 Frame = -1

Query  577  SYPMEQMGRFTTEQFPPPYS-TNAVSLTLGLQHSENLSAAMFATHHNFLPNQ---MGRGV  410
            SY +  + R+  E F P +S +  VSLTLGLQ  + LS  +     N++  Q   +GR  
Sbjct  32   SYHIGDLSRYGHESFTPRFSGSGGVSLTLGLQRIDGLS--LQGAQQNYMLTQSLALGRRH  89

Query  409  VIGEAEANDXVAGMTTPTXAHPTSVXDNFNIQNRKRFPAQLL  284
             +G   ++      + P   HP ++ +N NIQ RK F  QL+
Sbjct  90   DLGGNSSDYCNIETSAP---HPANLYENINIQPRKCFATQLM  128



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985