BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF023A24

Length=740
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010278591.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    185   4e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010278589.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    185   4e-52   Nelumbo nucifera [Indian lotus]
ref|XP_009801536.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    180   4e-52   Nicotiana sylvestris
ref|XP_010278588.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    180   2e-50   
ref|XP_010278590.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    180   2e-50   
ref|XP_009615319.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    179   3e-50   Nicotiana tomentosiformis
ref|XP_009615318.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    179   3e-50   Nicotiana tomentosiformis
ref|XP_009778598.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    178   1e-49   Nicotiana sylvestris
ref|XP_004229832.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    177   2e-49   Solanum lycopersicum
gb|KHN34425.1|  E3 ubiquitin-protein ligase                             172   2e-49   Glycine soja [wild soybean]
ref|XP_009626445.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    176   6e-49   Nicotiana tomentosiformis
ref|XP_008799545.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    176   7e-49   Phoenix dactylifera
ref|XP_006339453.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    176   1e-48   Solanum tuberosum [potatoes]
gb|EYU35067.1|  hypothetical protein MIMGU_mgv1a008119mg                176   1e-48   Erythranthe guttata [common monkey flower]
tpg|DAA39681.1|  TPA: putative RING zinc finger domain superfamil...    170   1e-48   
gb|KEH31714.1|  zinc finger, C3HC4 type (RING finger) protein           175   2e-48   Medicago truncatula
ref|XP_009762973.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    175   2e-48   Nicotiana sylvestris
ref|XP_009617349.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    175   2e-48   Nicotiana tomentosiformis
ref|XP_011093163.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    174   3e-48   Sesamum indicum [beniseed]
ref|XP_009112973.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    173   4e-48   Brassica rapa
emb|CDY47347.1|  BnaCnng14840D                                          173   4e-48   Brassica napus [oilseed rape]
emb|CDY49194.1|  BnaA09g10840D                                          173   4e-48   Brassica napus [oilseed rape]
ref|XP_003525718.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    173   7e-48   Glycine max [soybeans]
ref|XP_010529547.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    173   1e-47   Tarenaya hassleriana [spider flower]
ref|XP_007155554.1|  hypothetical protein PHAVU_003G211600g             173   1e-47   Phaseolus vulgaris [French bean]
ref|XP_008363169.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    167   1e-47   
ref|XP_008799543.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    171   4e-47   Phoenix dactylifera
ref|XP_008670056.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    171   5e-47   
ref|XP_003550874.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    171   7e-47   Glycine max [soybeans]
ref|XP_004240042.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    171   9e-47   Solanum lycopersicum
ref|XP_006345510.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    170   2e-46   Solanum tuberosum [potatoes]
ref|XP_011091747.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    168   2e-46   
ref|XP_004133878.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    169   3e-46   Cucumis sativus [cucumbers]
ref|XP_008438087.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    169   5e-46   Cucumis melo [Oriental melon]
ref|XP_010529546.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    169   8e-46   Tarenaya hassleriana [spider flower]
ref|XP_009112972.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    167   8e-46   Brassica rapa
ref|XP_006364123.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    166   2e-45   Solanum tuberosum [potatoes]
ref|XP_011463819.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    167   2e-45   Fragaria vesca subsp. vesca
gb|EYU32071.1|  hypothetical protein MIMGU_mgv1a008136mg                167   2e-45   Erythranthe guttata [common monkey flower]
ref|XP_007211433.1|  hypothetical protein PRUPE_ppa007140mg             167   3e-45   Prunus persica
ref|XP_008225188.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    167   3e-45   Prunus mume [ume]
ref|XP_010255490.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    166   4e-45   Nelumbo nucifera [Indian lotus]
ref|XP_010255491.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    166   5e-45   Nelumbo nucifera [Indian lotus]
emb|CBI38762.3|  unnamed protein product                                164   6e-45   Vitis vinifera
emb|CBI34726.3|  unnamed protein product                                162   9e-45   Vitis vinifera
gb|KDP28678.1|  hypothetical protein JCGZ_14449                         164   9e-45   Jatropha curcas
ref|XP_002509740.1|  cleavage and polyadenylation specificity fac...    165   1e-44   Ricinus communis
ref|XP_010676528.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    164   1e-44   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO63536.1|  hypothetical protein CISIN_1g020491mg                   163   1e-44   Citrus sinensis [apfelsine]
gb|KDO63535.1|  hypothetical protein CISIN_1g020491mg                   163   1e-44   Citrus sinensis [apfelsine]
ref|XP_002271651.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    165   1e-44   Vitis vinifera
ref|XP_004511598.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    165   2e-44   Cicer arietinum [garbanzo]
gb|EPS63490.1|  hypothetical protein M569_11294                         163   2e-44   Genlisea aurea
ref|XP_007040144.1|  Zinc finger, C3HC4 type (RING finger) family...    164   2e-44   Theobroma cacao [chocolate]
ref|XP_007040145.1|  Zinc finger, C3HC4 type (RING finger) family...    164   2e-44   Theobroma cacao [chocolate]
ref|XP_006477421.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    164   3e-44   Citrus sinensis [apfelsine]
emb|CDP08874.1|  unnamed protein product                                164   3e-44   Coffea canephora [robusta coffee]
ref|XP_006440560.1|  hypothetical protein CICLE_v10020554mg             164   3e-44   Citrus clementina [clementine]
ref|XP_006440561.1|  hypothetical protein CICLE_v10020554mg             164   4e-44   Citrus clementina [clementine]
ref|XP_006477422.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    164   4e-44   Citrus sinensis [apfelsine]
ref|XP_006477419.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    164   4e-44   Citrus sinensis [apfelsine]
ref|XP_010112554.1|  E3 ubiquitin-protein ligase                        163   5e-44   Morus notabilis
ref|XP_006440562.1|  hypothetical protein CICLE_v10020554mg             163   5e-44   Citrus clementina [clementine]
gb|KJB52052.1|  hypothetical protein B456_008G244300                    163   5e-44   Gossypium raimondii
ref|XP_002511805.1|  cleavage and polyadenylation specificity fac...    162   8e-44   Ricinus communis
ref|XP_010661149.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    163   8e-44   Vitis vinifera
ref|XP_003631422.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    163   8e-44   Vitis vinifera
ref|XP_008360211.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    157   1e-43   
gb|KHN35002.1|  E3 ubiquitin-protein ligase                             160   1e-43   Glycine soja [wild soybean]
ref|XP_011463818.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    162   1e-43   Fragaria vesca subsp. vesca
ref|XP_008438088.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    162   2e-43   
ref|XP_002889965.1|  protein binding protein                            161   2e-43   
ref|XP_010553509.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    162   2e-43   
ref|XP_010553507.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    162   2e-43   
ref|XP_010553505.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    162   2e-43   Tarenaya hassleriana [spider flower]
gb|KHG00725.1|  hypothetical protein F383_22058                         161   2e-43   Gossypium arboreum [tree cotton]
ref|XP_008238809.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    161   3e-43   Prunus mume [ume]
ref|XP_008358659.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    161   3e-43   
ref|XP_008238810.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    161   3e-43   Prunus mume [ume]
emb|CDY60265.1|  BnaC05g49290D                                          160   3e-43   Brassica napus [oilseed rape]
ref|XP_004252582.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    160   3e-43   Solanum lycopersicum
ref|XP_003538385.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    161   4e-43   Glycine max [soybeans]
ref|XP_006590532.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    161   4e-43   Glycine max [soybeans]
ref|XP_003517458.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    160   5e-43   Glycine max [soybeans]
ref|XP_010933860.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    160   6e-43   Elaeis guineensis
ref|XP_010458710.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    161   6e-43   Camelina sativa [gold-of-pleasure]
ref|XP_009346865.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    160   6e-43   Pyrus x bretschneideri [bai li]
ref|XP_010476241.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    161   7e-43   Camelina sativa [gold-of-pleasure]
gb|KDO63537.1|  hypothetical protein CISIN_1g020491mg                   159   8e-43   Citrus sinensis [apfelsine]
emb|CDY26592.1|  BnaA09g46850D                                          160   9e-43   Brassica napus [oilseed rape]
ref|XP_004295567.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    160   1e-42   Fragaria vesca subsp. vesca
ref|XP_007158469.1|  hypothetical protein PHAVU_002G155000g             160   1e-42   Phaseolus vulgaris [French bean]
gb|KFK43535.1|  hypothetical protein AALP_AA1G139400                    160   1e-42   Arabis alpina [alpine rockcress]
ref|XP_006402511.1|  hypothetical protein EUTSA_v10006041mg             159   1e-42   
ref|NP_001031032.1|  E3 ubiquitin-protein ligase                        158   2e-42   Arabidopsis thaliana [mouse-ear cress]
emb|CDY16029.1|  BnaC08g40940D                                          159   2e-42   Brassica napus [oilseed rape]
ref|XP_006477420.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    159   2e-42   Citrus sinensis [apfelsine]
ref|XP_010053666.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    159   2e-42   Eucalyptus grandis [rose gum]
ref|XP_010494577.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    159   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006440563.1|  hypothetical protein CICLE_v10020554mg             159   2e-42   Citrus clementina [clementine]
ref|XP_006304987.1|  hypothetical protein CARUB_v10009353mg             159   2e-42   Capsella rubella
gb|KJB39631.1|  hypothetical protein B456_007G022500                    159   2e-42   Gossypium raimondii
ref|XP_006477418.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    159   3e-42   Citrus sinensis [apfelsine]
ref|XP_011023403.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    159   3e-42   Populus euphratica
ref|XP_002301335.1|  zinc finger family protein                         158   3e-42   Populus trichocarpa [western balsam poplar]
ref|XP_009369024.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    159   3e-42   Pyrus x bretschneideri [bai li]
ref|XP_009369026.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    159   3e-42   Pyrus x bretschneideri [bai li]
gb|KJB20720.1|  hypothetical protein B456_003G161000                    158   4e-42   Gossypium raimondii
ref|NP_172736.2|  E3 ubiquitin-protein ligase                           159   4e-42   Arabidopsis thaliana [mouse-ear cress]
emb|CDX71761.1|  BnaC08g31130D                                          158   4e-42   
gb|KHN29414.1|  E3 ubiquitin-protein ligase                             156   4e-42   Glycine soja [wild soybean]
ref|XP_006417201.1|  hypothetical protein EUTSA_v10007780mg             159   4e-42   Eutrema salsugineum [saltwater cress]
ref|XP_009118057.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    158   5e-42   Brassica rapa
ref|XP_008392389.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    158   5e-42   
ref|XP_008392391.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    158   5e-42   
ref|XP_009118058.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    158   6e-42   Brassica rapa
ref|XP_009352819.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    157   7e-42   Pyrus x bretschneideri [bai li]
ref|XP_009116780.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    157   7e-42   Brassica rapa
emb|CDY52328.1|  BnaA09g38770D                                          157   7e-42   Brassica napus [oilseed rape]
gb|ABR17177.1|  unknown                                                 157   7e-42   Picea sitchensis
gb|ABR18161.1|  unknown                                                 157   8e-42   Picea sitchensis
gb|KJB25759.1|  hypothetical protein B456_004G208600                    157   9e-42   Gossypium raimondii
ref|XP_010553504.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    158   1e-41   Tarenaya hassleriana [spider flower]
ref|XP_010553508.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    157   1e-41   
emb|CDY31275.1|  BnaC08g15700D                                          157   1e-41   Brassica napus [oilseed rape]
ref|XP_008232745.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    156   1e-41   Prunus mume [ume]
emb|CDY66607.1|  BnaA06g38090D                                          157   1e-41   Brassica napus [oilseed rape]
ref|XP_010545928.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    157   1e-41   Tarenaya hassleriana [spider flower]
ref|XP_010545944.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    157   1e-41   Tarenaya hassleriana [spider flower]
gb|KHG14407.1|  hypothetical protein F383_04260                         157   2e-41   Gossypium arboreum [tree cotton]
ref|XP_009148567.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    157   2e-41   Brassica rapa
gb|KHF98416.1|  hypothetical protein F383_13016                         156   2e-41   Gossypium arboreum [tree cotton]
ref|XP_010933858.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    156   2e-41   Elaeis guineensis
emb|CDY21061.1|  BnaA08g24640D                                          155   2e-41   Brassica napus [oilseed rape]
ref|XP_007220471.1|  hypothetical protein PRUPE_ppa007521mg             156   2e-41   Prunus persica
emb|CDY37062.1|  BnaA04g26400D                                          156   2e-41   Brassica napus [oilseed rape]
ref|XP_007051906.1|  RING/U-box superfamily protein, putative           156   2e-41   Theobroma cacao [chocolate]
ref|XP_009345444.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    156   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_009345446.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    156   2e-41   Pyrus x bretschneideri [bai li]
gb|KHN24279.1|  E3 ubiquitin-protein ligase                             151   2e-41   Glycine soja [wild soybean]
gb|KFK40526.1|  hypothetical protein AALP_AA2G007300                    155   3e-41   Arabis alpina [alpine rockcress]
ref|XP_011035074.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    156   3e-41   Populus euphratica
gb|KHG00577.1|  hypothetical protein F383_17805                         156   3e-41   Gossypium arboreum [tree cotton]
ref|XP_003533627.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    155   3e-41   Glycine max [soybeans]
emb|CDY27362.1|  BnaC04g50430D                                          161   4e-41   Brassica napus [oilseed rape]
ref|XP_007209235.1|  hypothetical protein PRUPE_ppa007012mg             155   4e-41   Prunus persica
ref|XP_009411463.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    155   4e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008345901.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    155   4e-41   Malus domestica [apple tree]
ref|XP_009110629.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    155   6e-41   Brassica rapa
ref|XP_010671755.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    155   6e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009110628.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    155   7e-41   Brassica rapa
gb|KDP25486.1|  hypothetical protein JCGZ_20642                         154   1e-40   Jatropha curcas
ref|XP_004515807.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    154   1e-40   Cicer arietinum [garbanzo]
ref|XP_010540663.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    155   1e-40   Tarenaya hassleriana [spider flower]
ref|XP_009393489.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    154   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010540680.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    154   1e-40   Tarenaya hassleriana [spider flower]
ref|XP_009369023.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    154   2e-40   Pyrus x bretschneideri [bai li]
ref|XP_009369025.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    154   2e-40   Pyrus x bretschneideri [bai li]
ref|XP_010919263.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    154   2e-40   Elaeis guineensis
ref|XP_011035066.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    153   2e-40   Populus euphratica
ref|XP_008392388.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    154   3e-40   
gb|KDO86036.1|  hypothetical protein CISIN_1g017405mg                   153   3e-40   Citrus sinensis [apfelsine]
ref|XP_006491024.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    153   3e-40   Citrus sinensis [apfelsine]
ref|XP_006445135.1|  hypothetical protein CICLE_v10020664mg             153   3e-40   Citrus clementina [clementine]
ref|XP_008392390.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    153   3e-40   
gb|KHG06982.1|  hypothetical protein F383_33104                         153   3e-40   Gossypium arboreum [tree cotton]
gb|KCW77597.1|  hypothetical protein EUGRSUZ_D01910                     152   3e-40   Eucalyptus grandis [rose gum]
gb|KCW77596.1|  hypothetical protein EUGRSUZ_D01910                     152   4e-40   Eucalyptus grandis [rose gum]
emb|CDY70309.1|  BnaCnng67740D                                          152   4e-40   Brassica napus [oilseed rape]
emb|CAB71048.1|  putative protein                                       152   4e-40   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567110.1|  RING/U-box superfamily protein                        153   4e-40   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567379.1|  E3 ubiquitin-protein ligase                           153   4e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002320753.2|  hypothetical protein POPTR_0014s07110g             152   6e-40   
ref|XP_006391773.1|  hypothetical protein EUTSA_v10023515mg             152   6e-40   Eutrema salsugineum [saltwater cress]
ref|XP_006391774.1|  hypothetical protein EUTSA_v10023515mg             152   7e-40   Eutrema salsugineum [saltwater cress]
ref|XP_003611137.1|  E3 ubiquitin-protein ligase                        152   7e-40   Medicago truncatula
ref|XP_004493023.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    152   7e-40   Cicer arietinum [garbanzo]
ref|XP_010545919.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    153   8e-40   Tarenaya hassleriana [spider flower]
ref|XP_010545936.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    152   8e-40   Tarenaya hassleriana [spider flower]
ref|XP_011035060.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    152   8e-40   Populus euphratica
ref|XP_010053324.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    152   1e-39   Eucalyptus grandis [rose gum]
ref|XP_009345445.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    152   1e-39   Pyrus x bretschneideri [bai li]
ref|XP_009345443.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    152   1e-39   Pyrus x bretschneideri [bai li]
ref|XP_009382298.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    151   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006279087.1|  hypothetical protein CARUB_v10012711mg             151   2e-39   Capsella rubella
ref|XP_008355581.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    151   2e-39   
ref|XP_008355584.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    151   2e-39   
gb|KJB20719.1|  hypothetical protein B456_003G161000                    151   2e-39   Gossypium raimondii
ref|XP_002876598.1|  hypothetical protein ARALYDRAFT_486593             151   2e-39   
ref|XP_003563155.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    150   3e-39   Brachypodium distachyon [annual false brome]
gb|ADK63393.1|  C3HC4 type zinc finger protein                          149   3e-39   Brassica rapa
ref|XP_008383660.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    150   3e-39   
ref|XP_009142362.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    150   4e-39   Brassica rapa
ref|XP_009401775.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    151   4e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009143169.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    150   4e-39   Brassica rapa
emb|CDX74763.1|  BnaA05g05090D                                          149   5e-39   
ref|XP_011033783.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    150   5e-39   Populus euphratica
ref|XP_011033785.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    150   5e-39   Populus euphratica
ref|XP_002880197.1|  hypothetical protein ARALYDRAFT_322232             150   5e-39   Arabidopsis lyrata subsp. lyrata
ref|XP_002303571.2|  hypothetical protein POPTR_0003s12350g             150   6e-39   Populus trichocarpa [western balsam poplar]
ref|XP_011035055.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    150   6e-39   Populus euphratica
ref|XP_010540654.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    150   7e-39   Tarenaya hassleriana [spider flower]
ref|XP_010540671.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    150   7e-39   Tarenaya hassleriana [spider flower]
gb|KJB41239.1|  hypothetical protein B456_007G096300                    149   9e-39   Gossypium raimondii
ref|XP_010919264.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    149   1e-38   Elaeis guineensis
ref|XP_006857849.1|  hypothetical protein AMTR_s00069p00064990          149   1e-38   
gb|ADK63418.1|  C3HC4 type zinc finger protein                          149   1e-38   Brassica rapa
ref|NP_564810.1|  zinc finger, C3HC4 type (RING finger) family pr...    149   1e-38   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63303.1|  unknown                                                 149   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887973.1|  zinc finger family protein                         149   2e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_010422123.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    149   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010092737.1|  E3 ubiquitin-protein ligase                        149   2e-38   
ref|XP_004147971.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    148   2e-38   
ref|XP_010434567.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    148   3e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010544693.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    148   3e-38   Tarenaya hassleriana [spider flower]
ref|XP_010544692.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    148   3e-38   Tarenaya hassleriana [spider flower]
ref|XP_006302394.1|  hypothetical protein CARUB_v10020462mg             148   3e-38   Capsella rubella
ref|XP_008448958.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    148   3e-38   Cucumis melo [Oriental melon]
ref|XP_003552356.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    147   4e-38   Glycine max [soybeans]
ref|XP_010413448.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    147   5e-38   Camelina sativa [gold-of-pleasure]
ref|NP_001059583.1|  Os07g0463400                                       147   5e-38   
gb|EEC81984.1|  hypothetical protein OsI_25906                          147   5e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_006294289.1|  hypothetical protein CARUB_v10023298mg             148   6e-38   
ref|XP_007139958.1|  hypothetical protein PHAVU_008G073000g             147   7e-38   Phaseolus vulgaris [French bean]
gb|KFK31927.1|  hypothetical protein AALP_AA6G177200                    147   7e-38   Arabis alpina [alpine rockcress]
ref|XP_004956145.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    146   8e-38   Setaria italica
ref|XP_010430403.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    147   9e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010455583.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    147   9e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010473550.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    147   9e-38   Camelina sativa [gold-of-pleasure]
ref|XP_008355582.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    147   1e-37   
ref|XP_008355580.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    146   1e-37   
gb|KFK37366.1|  hypothetical protein AALP_AA4G247400                    146   1e-37   Arabis alpina [alpine rockcress]
ref|XP_006287901.1|  hypothetical protein CARUB_v10001135mg             146   1e-37   Capsella rubella
emb|CAN65431.1|  hypothetical protein VITISV_017099                     145   2e-37   Vitis vinifera
ref|XP_010469042.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    145   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_009401774.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    147   2e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006396865.1|  hypothetical protein EUTSA_v10028703mg             146   2e-37   Eutrema salsugineum [saltwater cress]
ref|XP_010418331.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    145   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_011033784.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    145   3e-37   Populus euphratica
ref|XP_010512452.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    145   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010533709.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    145   3e-37   Tarenaya hassleriana [spider flower]
emb|CDX86759.1|  BnaA09g21490D                                          145   3e-37   
emb|CDY57781.1|  BnaCnng32440D                                          145   4e-37   Brassica napus [oilseed rape]
ref|NP_001147541.1|  protein binding protein                            145   4e-37   Zea mays [maize]
ref|XP_010934468.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    145   4e-37   Elaeis guineensis
ref|XP_006658537.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    143   4e-37   Oryza brachyantha
dbj|BAK01729.1|  predicted protein                                      144   5e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN21610.1|  E3 ubiquitin protein ligase RIE1                        143   6e-37   Glycine soja [wild soybean]
ref|XP_009124794.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    144   7e-37   Brassica rapa
ref|XP_008389094.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    140   7e-37   
gb|AGG16262.1|  C3HC4 type RING finger                                  139   8e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010055479.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    140   9e-37   Eucalyptus grandis [rose gum]
ref|XP_003525228.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    143   9e-37   Glycine max [soybeans]
ref|XP_008800795.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    144   9e-37   Phoenix dactylifera
ref|XP_003518612.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    143   1e-36   Glycine max [soybeans]
gb|EMT20198.1|  E3 ubiquitin-protein ligase                             141   1e-36   
gb|AAL24200.1|  At1g63170/F16M19_7                                      144   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008651537.1|  PREDICTED: protein binding protein isoform X2      143   1e-36   Zea mays [maize]
dbj|BAK00653.1|  predicted protein                                      143   2e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008789277.1|  PREDICTED: E3 ubiquitin protein ligase RIE1 ...    143   2e-36   Phoenix dactylifera
ref|XP_008789278.1|  PREDICTED: E3 ubiquitin protein ligase RIE1 ...    143   2e-36   Phoenix dactylifera
ref|XP_008390260.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    138   2e-36   
gb|AAO72540.1|  ring zinc finger protein-like protein                   140   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006583716.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    142   3e-36   Glycine max [soybeans]
ref|XP_003623820.1|  E3 ubiquitin-protein ligase                        142   3e-36   Medicago truncatula
ref|NP_001053593.2|  Os04g0568900                                       140   3e-36   
ref|XP_002459812.1|  hypothetical protein SORBIDRAFT_02g011130          142   3e-36   Sorghum bicolor [broomcorn]
ref|XP_004956144.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    141   4e-36   Setaria italica
ref|XP_008386321.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    137   5e-36   
ref|XP_007153245.1|  hypothetical protein PHAVU_003G019100g             139   6e-36   Phaseolus vulgaris [French bean]
emb|CAE02249.2|  OSJNBb0032E06.5                                        140   6e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007160430.1|  hypothetical protein PHAVU_002G321300g             141   6e-36   Phaseolus vulgaris [French bean]
ref|XP_008354302.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    140   1e-35   
gb|KCW89980.1|  hypothetical protein EUGRSUZ_A02179                     140   1e-35   Eucalyptus grandis [rose gum]
ref|NP_001130198.1|  uncharacterized LOC100191292                       141   1e-35   Zea mays [maize]
ref|XP_004498249.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    140   1e-35   Cicer arietinum [garbanzo]
ref|XP_010651669.1|  PREDICTED: E3 ubiquitin protein ligase RIE1        140   1e-35   Vitis vinifera
ref|XP_007153246.1|  hypothetical protein PHAVU_003G019100g             140   1e-35   Phaseolus vulgaris [French bean]
ref|XP_010907310.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    136   2e-35   Elaeis guineensis
ref|XP_010934467.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    140   2e-35   
gb|AFW63358.1|  putative RING zinc finger domain superfamily protein    135   3e-35   
ref|XP_002312464.2|  zinc finger family protein                         139   4e-35   
ref|XP_004165340.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    137   5e-35   
ref|XP_004976528.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    139   6e-35   
gb|EEE57561.1|  hypothetical protein OsJ_07906                          135   6e-35   
ref|XP_008651536.1|  PREDICTED: protein binding protein isoform X1      138   8e-35   
gb|KDP38117.1|  hypothetical protein JCGZ_04760                         138   9e-35   
gb|KEH40623.1|  zinc finger (C3HC4-type RING finger) family protein     138   1e-34   
ref|XP_011463168.1|  PREDICTED: E3 ubiquitin protein ligase RIE1        138   1e-34   
ref|XP_010255487.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    139   1e-34   
dbj|BAD15897.1|  RING zinc finger protein-like                          133   1e-34   
gb|ACN40787.1|  unknown                                                 138   1e-34   
ref|NP_001151256.1|  protein binding protein                            137   1e-34   
tpg|DAA60522.1|  TPA: putative RING zinc finger domain superfamil...    137   1e-34   
ref|XP_010255488.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    139   1e-34   
emb|CDP16293.1|  unnamed protein product                                135   2e-34   
ref|XP_010940872.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    138   2e-34   
gb|EMT12642.1|  E3 ubiquitin-protein ligase                             135   2e-34   
ref|XP_004136763.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    137   2e-34   
ref|XP_006302484.1|  hypothetical protein CARUB_v10020579mg             137   2e-34   
gb|KHN16532.1|  E3 ubiquitin protein ligase RIE1                        136   2e-34   
ref|XP_008813538.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    133   3e-34   
emb|CAB39939.1|  putative protein                                       137   3e-34   
ref|XP_007045267.1|  Zinc finger, C3HC4 type (RING finger) family...    137   3e-34   
ref|XP_010470747.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    136   3e-34   
ref|XP_011024112.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    136   3e-34   
ref|XP_010511779.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    136   3e-34   
ref|XP_006584880.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    136   4e-34   
ref|XP_006652656.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    134   4e-34   
gb|ACF87715.1|  unknown                                                 135   5e-34   
ref|NP_001047717.2|  Os02g0674700                                       136   5e-34   
ref|XP_010695901.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    136   5e-34   
ref|XP_008662009.1|  PREDICTED: LOC100284185 isoform X1                 136   6e-34   
ref|XP_011021769.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    135   6e-34   
ref|XP_010272924.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    135   7e-34   
gb|KFK30652.1|  hypothetical protein AALP_AA6G009800                    135   7e-34   
ref|XP_002314782.2|  hypothetical protein POPTR_0010s11660g             135   7e-34   
dbj|BAD29468.1|  ring zinc finger protein-like                          136   7e-34   
ref|XP_010111279.1|  E3 ubiquitin protein ligase RIE1                   131   8e-34   
ref|XP_008778191.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    135   8e-34   
ref|NP_001150553.1|  LOC100284185                                       136   8e-34   
ref|XP_002874711.1|  hypothetical protein ARALYDRAFT_327304             136   9e-34   
gb|ACF78887.1|  unknown                                                 135   9e-34   
ref|XP_003570089.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    135   9e-34   
ref|XP_010107068.1|  E3 ubiquitin protein ligase RIE1                   136   1e-33   
gb|EYU35678.1|  hypothetical protein MIMGU_mgv1a018208mg                135   1e-33   
ref|XP_002526000.1|  cleavage and polyadenylation specificity fac...    139   1e-33   
ref|XP_002452592.1|  hypothetical protein SORBIDRAFT_04g028660          135   1e-33   
ref|XP_003570086.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    135   1e-33   
dbj|BAJ98696.1|  predicted protein                                      135   2e-33   
gb|KJB15334.1|  hypothetical protein B456_002G172200                    134   2e-33   
ref|XP_007223310.1|  hypothetical protein PRUPE_ppa007296mg             135   2e-33   
ref|XP_010271358.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    134   2e-33   
ref|XP_006339241.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    130   2e-33   
ref|XP_008389170.1|  PREDICTED: E3 ubiquitin protein ligase RIE1        135   2e-33   
ref|XP_006448162.1|  hypothetical protein CICLE_v10015731mg             134   2e-33   
ref|XP_008443208.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    134   2e-33   
ref|XP_003630948.1|  E3 ubiquitin-protein ligase                        134   2e-33   
ref|XP_010251798.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    133   4e-33   
ref|NP_001149757.1|  LOC100283384                                       134   4e-33   
ref|XP_009351549.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    133   6e-33   
ref|XP_009408396.1|  PREDICTED: E3 ubiquitin protein ligase RIE1        133   6e-33   
ref|XP_011070049.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    133   7e-33   
ref|XP_009606719.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    132   8e-33   
ref|XP_010940871.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    133   9e-33   
ref|NP_001048049.1|  Os02g0735900                                       127   1e-32   
gb|AAM61051.1|  putative RING zinc finger protein                       132   1e-32   
ref|NP_176974.1|  C3HC4-type RING finger domain-containing protein      132   1e-32   
emb|CDY71708.1|  BnaCnng74070D                                          132   1e-32   
ref|XP_009420927.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    131   2e-32   
ref|XP_010932732.1|  PREDICTED: uncharacterized protein LOC105053331    136   2e-32   
ref|XP_002887158.1|  hypothetical protein ARALYDRAFT_475916             131   2e-32   
gb|KDO60760.1|  hypothetical protein CISIN_1g018193mg                   131   3e-32   
gb|KCW64497.1|  hypothetical protein EUGRSUZ_G02105                     131   3e-32   
ref|XP_008467019.1|  PREDICTED: E3 ubiquitin protein ligase RIE1        131   4e-32   
ref|XP_003624869.1|  E3 ubiquitin-protein ligase                        130   4e-32   
gb|KHN34569.1|  E3 ubiquitin protein ligase RIE1                        127   4e-32   
ref|XP_008221359.1|  PREDICTED: cleavage and polyadenylation spec...    135   4e-32   
ref|XP_002962655.1|  hypothetical protein SELMODRAFT_78385              131   5e-32   
ref|XP_006391188.1|  hypothetical protein EUTSA_v10018815mg             130   5e-32   
ref|XP_008381749.1|  PREDICTED: E3 ubiquitin protein ligase RIE1        131   5e-32   
ref|XP_008803038.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    131   5e-32   
emb|CDY12686.1|  BnaA02g13540D                                          130   5e-32   
ref|XP_002980437.1|  hypothetical protein SELMODRAFT_112292             130   6e-32   
ref|XP_004150618.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    130   6e-32   
ref|XP_009127596.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    130   7e-32   
ref|XP_006649025.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    130   8e-32   
emb|CDY01880.1|  BnaC06g29200D                                          130   9e-32   
ref|XP_006469322.1|  PREDICTED: cleavage and polyadenylation spec...    134   9e-32   
ref|XP_010534170.1|  PREDICTED: E3 ubiquitin protein ligase RIE1        130   9e-32   
ref|XP_001754436.1|  predicted protein                                  129   1e-31   
ref|XP_006482012.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    128   2e-31   
ref|XP_004249338.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    129   2e-31   
ref|XP_010312169.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    129   2e-31   
gb|KJB30722.1|  hypothetical protein B456_005G157000                    129   2e-31   
ref|XP_003521096.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    128   2e-31   
emb|CAN61404.1|  hypothetical protein VITISV_014258                     129   2e-31   
emb|CBI32866.3|  unnamed protein product                                126   3e-31   
ref|XP_001784296.1|  predicted protein                                  127   3e-31   
gb|KJB60892.1|  hypothetical protein B456_009G330000                    128   3e-31   
ref|XP_003553376.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    128   4e-31   
ref|XP_011070565.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    128   4e-31   
ref|XP_011070566.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    128   4e-31   
ref|XP_004503351.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    127   8e-31   
ref|XP_003570691.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    127   1e-30   
ref|XP_010066571.1|  PREDICTED: cleavage and polyadenylation spec...    131   1e-30   
ref|XP_009773933.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    127   1e-30   
ref|XP_006355061.1|  PREDICTED: LOW QUALITY PROTEIN: cleavage and...    130   1e-30   
ref|XP_009773932.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    127   1e-30   
emb|CBI26830.3|  unnamed protein product                                126   1e-30   
ref|XP_010319559.1|  PREDICTED: cleavage and polyadenylation spec...    131   1e-30   
ref|XP_009399941.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    126   1e-30   
ref|XP_006430473.1|  hypothetical protein CICLE_v10012313mg             125   2e-30   
ref|XP_008803037.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    126   3e-30   
ref|XP_002283980.2|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    126   3e-30   
gb|KHG10998.1|  E3 ubiquitin ligase RIE1 -like protein                  126   3e-30   
ref|XP_010101531.1|  E3 ubiquitin-protein ligase                        122   6e-30   
ref|XP_009608303.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    123   3e-29   
emb|CDP14337.1|  unnamed protein product                                122   9e-29   
ref|XP_006828462.1|  hypothetical protein AMTR_s00060p00138000          119   9e-29   
gb|EEC73955.1|  hypothetical protein OsI_08846                          121   1e-28   
ref|XP_004493307.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    120   1e-28   
ref|XP_004953845.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    121   2e-28   
ref|NP_849924.1|  E3 ubiquitin protein ligase RIE1                      120   3e-28   
ref|XP_006395857.1|  hypothetical protein EUTSA_v10004486mg             119   6e-28   
ref|XP_009101309.1|  PREDICTED: E3 ubiquitin protein ligase RIE1        119   1e-27   
emb|CDY17638.1|  BnaA06g34570D                                          118   1e-27   
ref|XP_009419123.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    117   2e-27   
emb|CDX96049.1|  BnaA07g26820D                                          117   2e-27   
ref|XP_009105357.1|  PREDICTED: E3 ubiquitin protein ligase RIE1        117   3e-27   
emb|CDY36255.1|  BnaC07g21090D                                          117   3e-27   
ref|XP_010502156.1|  PREDICTED: E3 ubiquitin protein ligase RIE1        117   4e-27   
ref|XP_009765931.1|  PREDICTED: cleavage and polyadenylation spec...    120   4e-27   
ref|XP_007162014.1|  hypothetical protein PHAVU_001G116400g             116   4e-27   
ref|XP_006291380.1|  hypothetical protein CARUB_v10017517mg             117   5e-27   
ref|XP_008679100.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    116   8e-27   
tpg|DAA60524.1|  TPA: putative RING zinc finger domain superfamil...    109   1e-26   
gb|KFK33397.1|  hypothetical protein AALP_AA5G007500                    115   2e-26   
ref|XP_008646047.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    111   4e-26   
gb|EPS70600.1|  hypothetical protein M569_04161                         110   5e-26   
ref|XP_002320752.2|  hypothetical protein POPTR_0014s07100g             108   6e-26   
ref|XP_010673203.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    112   1e-25   
ref|XP_002969635.1|  hypothetical protein SELMODRAFT_66385              112   2e-25   
ref|XP_010518550.1|  PREDICTED: cleavage and polyadenylation spec...    115   3e-25   
ref|XP_010430653.1|  PREDICTED: cleavage and polyadenylation spec...    115   3e-25   
ref|XP_010527797.1|  PREDICTED: E3 ubiquitin protein ligase RIE1        112   3e-25   
ref|XP_004144310.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    111   4e-25   
dbj|BAK01779.1|  predicted protein                                      111   4e-25   
ref|XP_002970900.1|  hypothetical protein SELMODRAFT_66382              111   5e-25   
ref|XP_004498315.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    109   2e-24   
ref|XP_006832971.1|  hypothetical protein AMTR_s00095p00171280          103   8e-24   
gb|KHG06981.1|  hypothetical protein F383_33104                         110   1e-23   
dbj|BAG92967.1|  unnamed protein product                                102   3e-23   
gb|EPS69634.1|  hypothetical protein M569_05133                         105   4e-23   
emb|CDP15670.1|  unnamed protein product                                102   1e-22   
ref|XP_004306831.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  99.8    5e-21   
gb|AES81093.2|  RING-finger ubiquitin ligase                          96.3    1e-20   
ref|XP_002452761.1|  hypothetical protein SORBIDRAFT_04g032025        92.0    5e-20   
gb|KHG00424.1|  E3 ubiquitin ligase RIE1 -like protein                95.9    1e-19   
ref|XP_002971210.1|  hypothetical protein SELMODRAFT_171829           96.3    1e-19   
ref|XP_002961593.1|  hypothetical protein SELMODRAFT_76977            96.3    1e-19   
gb|AFW73301.1|  putative RING zinc finger domain superfamily protein  89.7    3e-19   
gb|AFK39085.1|  unknown                                               90.1    3e-19   
gb|KJB41242.1|  hypothetical protein B456_007G096300                  93.6    7e-19   
ref|XP_001765272.1|  predicted protein                                92.8    1e-18   
ref|XP_003624875.1|  RING finger protein                              93.2    2e-18   
ref|XP_001765270.1|  predicted protein                                91.3    3e-18   
dbj|BAD19217.1|  RING zinc finger protein-like                        89.0    6e-18   
ref|XP_008342734.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  91.7    7e-18   
gb|KJB83264.1|  hypothetical protein B456_013G238400                  92.0    8e-18   
gb|KJB83263.1|  hypothetical protein B456_013G238400                  91.7    8e-18   
ref|XP_009339006.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  91.3    9e-18   
ref|XP_008342732.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  91.3    1e-17   
ref|NP_001169753.1|  uncharacterized LOC100383634                     90.5    1e-17   
ref|XP_004954169.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  90.5    1e-17   
ref|XP_009339004.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  90.9    1e-17   
ref|XP_008465569.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  86.7    1e-17   
ref|NP_001048342.1|  Os02g0787500                                     89.7    2e-17   
ref|XP_009377510.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  90.5    2e-17   
gb|EAY87799.1|  hypothetical protein OsI_09219                        90.1    2e-17   
gb|EMT29820.1|  E3 ubiquitin-protein ligase                           91.7    2e-17   
ref|XP_006412451.1|  hypothetical protein EUTSA_v10025242mg           90.5    2e-17   
ref|XP_010249880.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  90.5    2e-17   
ref|XP_009760536.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  90.1    2e-17   
gb|KHM98780.1|  E3 ubiquitin-protein ligase                           90.1    3e-17   
gb|KHN44137.1|  E3 ubiquitin-protein ligase                           89.7    3e-17   
ref|XP_003543658.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  89.7    3e-17   
ref|XP_003624876.1|  RING finger protein                              88.2    4e-17   
gb|KHG16467.1|  hypothetical protein F383_05962                       89.4    4e-17   
gb|AES81094.2|  C3HC4-type RING zinc finger protein                   87.8    4e-17   
ref|XP_003546278.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  89.0    6e-17   
gb|KJB70539.1|  hypothetical protein B456_011G078300                  89.0    6e-17   
ref|XP_009358216.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  89.0    6e-17   
ref|XP_009358215.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  88.6    7e-17   
ref|XP_009358214.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  88.6    8e-17   
ref|NP_194986.2|  C3H4 type zinc finger protein                       89.0    8e-17   
gb|KCW59672.1|  hypothetical protein EUGRSUZ_H02426                   87.8    9e-17   
ref|XP_010915017.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  88.6    1e-16   
emb|CAA18601.1|  putative protein                                     88.6    1e-16   
ref|XP_003522643.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  87.4    1e-16   
gb|KHF98391.1|  hypothetical protein F383_13476                       87.8    1e-16   
ref|XP_008352040.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  87.8    1e-16   
ref|XP_008337111.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  86.7    1e-16   
ref|XP_002309588.2|  zinc finger family protein                       87.8    2e-16   
ref|XP_011019728.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  87.8    2e-16   
ref|XP_009408952.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  87.4    2e-16   
ref|XP_004498626.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  87.4    2e-16   
ref|XP_003558525.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  87.4    2e-16   
ref|XP_010109041.1|  E3 ubiquitin-protein ligase                      87.4    2e-16   
ref|XP_011087227.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  87.4    2e-16   
ref|XP_009408951.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  87.4    2e-16   
ref|XP_006648026.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  87.0    2e-16   
ref|XP_010062440.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  86.3    3e-16   
ref|XP_006283708.1|  hypothetical protein CARUB_v10004779mg           87.4    3e-16   
ref|XP_008219854.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  87.0    3e-16   
ref|XP_010447366.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  87.0    3e-16   
emb|CDP18420.1|  unnamed protein product                              86.7    3e-16   
gb|KCW44260.1|  hypothetical protein EUGRSUZ_L02308                   86.3    4e-16   
emb|CAN81037.1|  hypothetical protein VITISV_017962                   87.4    4e-16   
ref|XP_010432691.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  87.0    4e-16   



>ref|XP_010278591.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X4 [Nelumbo 
nucifera]
Length=386

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 129/173 (75%), Gaps = 1/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ + +DS QLYW  IIFLAFDVFFV+FC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  215  GGQALIRDSPQLYWLCIIFLAFDVFFVIFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  274

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI++L KY F R  +FE   GE   G   G+MT C  D    + H LS++DAECCI
Sbjct  275  ASKEDIDQLPKYKFQRIGNFEKITGE-IQGPFGGIMTKCVSDTETPIEHVLSLEDAECCI  333

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL  Y+DGAELR+LPC HHFHC+C DKWL INATCPLCK +II+       EV
Sbjct  334  CLSTYDDGAELRKLPCSHHFHCSCIDKWLYINATCPLCKYNIIRSGNQGREEV  386



>ref|XP_010278589.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X2 [Nelumbo 
nucifera]
Length=387

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 129/173 (75%), Gaps = 1/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ + +DS QLYW  IIFLAFDVFFV+FC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  216  GGQALIRDSPQLYWLCIIFLAFDVFFVIFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  275

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI++L KY F R  +FE   GE   G   G+MT C  D    + H LS++DAECCI
Sbjct  276  ASKEDIDQLPKYKFQRIGNFEKITGE-IQGPFGGIMTKCVSDTETPIEHVLSLEDAECCI  334

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL  Y+DGAELR+LPC HHFHC+C DKWL INATCPLCK +II+       EV
Sbjct  335  CLSTYDDGAELRKLPCSHHFHCSCIDKWLYINATCPLCKYNIIRSGNQGREEV  387



>ref|XP_009801536.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Nicotiana 
sylvestris]
Length=211

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 124/166 (75%), Gaps = 3/166 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ M Q S QLYW  I+FLAFDVFFVVF I LAC +GLGICCCLPCI+AVLYAVADQ G
Sbjct  43   GGQRMVQKSPQLYWLCIVFLAFDVFFVVFLITLACAVGLGICCCLPCIIAVLYAVADQKG  102

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            AD+EDIE+LSKY F +    +N  GE   G+ AG MT CG D  +   H LS DDA C I
Sbjct  103  ADKEDIEQLSKYIFRQNGCSDNRTGE-IQGTFAGFMTQCGTDTPI--EHSLSTDDAACSI  159

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CL  Y+DG ELR+LPCGHHFHCAC DKWL ++ATCPLCK SI+  S
Sbjct  160  CLSTYDDGEELRELPCGHHFHCACIDKWLYMSATCPLCKRSIVGAS  205



>ref|XP_010278588.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X1 [Nelumbo 
nucifera]
Length=388

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 129/174 (74%), Gaps = 2/174 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ + +DS QLYW  IIFLAFDVFFV+FC+ LACVIG+ +CCCLPCI+AVLYAVADQ +
Sbjct  216  GGQALIRDSPQLYWLCIIFLAFDVFFVIFCVALACVIGIAVCCCLPCIIAVLYAVADQQE  275

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDI++L KY F R  +FE   GE   G   G+MT C  D    + H LS++DAECC
Sbjct  276  GASKEDIDQLPKYKFQRIGNFEKITGE-IQGPFGGIMTKCVSDTETPIEHVLSLEDAECC  334

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ICL  Y+DGAELR+LPC HHFHC+C DKWL INATCPLCK +II+       EV
Sbjct  335  ICLSTYDDGAELRKLPCSHHFHCSCIDKWLYINATCPLCKYNIIRSGNQGREEV  388



>ref|XP_010278590.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X3 [Nelumbo 
nucifera]
Length=387

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 129/174 (74%), Gaps = 2/174 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ + +DS QLYW  IIFLAFDVFFV+FC+ LACVIG+ +CCCLPCI+AVLYAVADQ +
Sbjct  215  GGQALIRDSPQLYWLCIIFLAFDVFFVIFCVALACVIGIAVCCCLPCIIAVLYAVADQQE  274

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDI++L KY F R  +FE   GE   G   G+MT C  D    + H LS++DAECC
Sbjct  275  GASKEDIDQLPKYKFQRIGNFEKITGE-IQGPFGGIMTKCVSDTETPIEHVLSLEDAECC  333

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ICL  Y+DGAELR+LPC HHFHC+C DKWL INATCPLCK +II+       EV
Sbjct  334  ICLSTYDDGAELRKLPCSHHFHCSCIDKWLYINATCPLCKYNIIRSGNQGREEV  387



>ref|XP_009615319.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Nicotiana tomentosiformis]
Length=357

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 123/166 (74%), Gaps = 3/166 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ M Q+S QLYW  I+FLAFDVFFVVF I LAC +GLGICCCLPCI+AVLYAVADQ G
Sbjct  189  GGQRMVQESPQLYWLCIVFLAFDVFFVVFLITLACAVGLGICCCLPCIIAVLYAVADQKG  248

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A++EDIE+LSKY F      EN  GE   G+ AG MT CG D      H LS DDA C I
Sbjct  249  ANKEDIEQLSKYIFRHNGVNENRTGE-IQGTFAGFMTQCGTDTPK--EHSLSTDDAACSI  305

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CL  Y+DG ELR+LPCGHHFHCAC DKWL ++ATCPLCK SI+  S
Sbjct  306  CLSTYDDGEELRELPCGHHFHCACIDKWLYMSATCPLCKRSIVGTS  351



>ref|XP_009615318.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Nicotiana tomentosiformis]
Length=360

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 123/166 (74%), Gaps = 3/166 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ M Q+S QLYW  I+FLAFDVFFVVF I LAC +GLGICCCLPCI+AVLYAVADQ G
Sbjct  192  GGQRMVQESPQLYWLCIVFLAFDVFFVVFLITLACAVGLGICCCLPCIIAVLYAVADQKG  251

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A++EDIE+LSKY F      EN  GE   G+ AG MT CG D      H LS DDA C I
Sbjct  252  ANKEDIEQLSKYIFRHNGVNENRTGE-IQGTFAGFMTQCGTDTPK--EHSLSTDDAACSI  308

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CL  Y+DG ELR+LPCGHHFHCAC DKWL ++ATCPLCK SI+  S
Sbjct  309  CLSTYDDGEELRELPCGHHFHCACIDKWLYMSATCPLCKRSIVGTS  354



>ref|XP_009778598.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Nicotiana 
sylvestris]
Length=383

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 126/172 (73%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GG+ +  D+ QLYW  + FLAFDVFFVV C+ +AC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  213  GGESLTHDAPQLYWLCLTFLAFDVFFVVICVAVACLIGIAVCCCLPCIIAILYAVADQEG  272

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +ED+ERL KY F +   FE  +GE    S  GVMT C  D  +   H L ++DAECCI
Sbjct  273  ATKEDVERLPKYKFRKLGDFEKQNGE-IQESFGGVMTECDTDTPI--EHVLPLEDAECCI  329

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CLC YEDG ELR+LPC HHFH AC DKWL INATCPLCK +I+K    +SGE
Sbjct  330  CLCPYEDGTELRELPCRHHFHSACIDKWLFINATCPLCKFNILKNGNQSSGE  381



>ref|XP_004229832.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Solanum lycopersicum]
Length=383

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 126/172 (73%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GG  +A+D+ QLYW  + FLAFDVFFVV C+ +AC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  213  GGDSLARDAPQLYWLCLTFLAFDVFFVVICVAVACLIGIAVCCCLPCIIAILYAVADQEG  272

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +ED+ERL+KY F R   FE  +GE    S  GVMT C  D  +   H L ++DAECCI
Sbjct  273  ATKEDVERLTKYKFRRLGKFEKQNGE-IQESFGGVMTECDTDTPI--EHVLPLEDAECCI  329

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CLC YEDG ELR+LPC HHFH  C DKWL +NATCPLCK +I+K    +S E
Sbjct  330  CLCPYEDGIELRELPCRHHFHSVCIDKWLYMNATCPLCKFNILKNGNQSSSE  381



>gb|KHN34425.1| E3 ubiquitin-protein ligase [Glycine soja]
Length=215

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 126/172 (73%), Gaps = 3/172 (2%)
 Frame = -3

Query  735  GQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGA  556
             + + +DS  LYW  I FL FDVFFVVFC+ LAC++G+ +CCCLPCI+A+LYAVADQ+GA
Sbjct  47   SESLVRDSPLLYWLCIAFLGFDVFFVVFCMALACIVGIAVCCCLPCIIALLYAVADQEGA  106

Query  555  DQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCIC  376
             +EDIE+LSK+ F RT + E   G    G+  G+M  C  D  +   H LS +DAECCIC
Sbjct  107  SKEDIEQLSKFKFQRTETNEKHAGN-TQGAAGGIMIECDADSPI--EHVLSDEDAECCIC  163

Query  375  LCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            L AY+DG ELRQLPCGHHFHCAC DKWL INATCPLCK +I+K + H   EV
Sbjct  164  LSAYDDGVELRQLPCGHHFHCACVDKWLHINATCPLCKYNILKSTSHAQDEV  215



>ref|XP_009626445.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Nicotiana 
tomentosiformis]
Length=383

 Score =   176 bits (447),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 126/172 (73%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GG+ +  D+ QLYW  + FLAFDV FVV C+ +AC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  213  GGESLTHDAPQLYWLCLTFLAFDVIFVVICVAVACLIGIAVCCCLPCIIAILYAVADQEG  272

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +ED+ERL KY F +   FE  +GE    S  GVMT C  D  +   H L+++DAECCI
Sbjct  273  ATKEDVERLPKYKFRKLGDFEKQNGE-IQESFGGVMTECDTDTPI--EHVLTLEDAECCI  329

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CLC YEDG ELR+LPC HHFH AC DKWL INATCPLCK +I+K    +SGE
Sbjct  330  CLCPYEDGTELRELPCRHHFHSACIDKWLFINATCPLCKFNILKNGNQSSGE  381



>ref|XP_008799545.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Phoenix dactylifera]
Length=377

 Score =   176 bits (446),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 126/173 (73%), Gaps = 3/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +  D+ QLYW  I+FLAFDVFFV+FC+ LACVIG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  208  GGQVLTHDAPQLYWLCIVFLAFDVFFVIFCVALACVIGIAVCCCLPCIIAILYAVADQEG  267

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI +L KY F +    E   GE   GS  G+M  CG D  +   H LS +DAECCI
Sbjct  268  ASEEDIRQLPKYKFRKIGDSEKLVGE-ISGSFGGIMMECGNDPPI--EHALSGEDAECCI  324

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AY+DG ELRQLPCGHHFHCAC DKWL INATCPLCK +IIK       EV
Sbjct  325  CLSAYDDGVELRQLPCGHHFHCACIDKWLFINATCPLCKFNIIKSRNQGREEV  377



>ref|XP_006339453.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Solanum 
tuberosum]
Length=383

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 126/172 (73%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GG+ + +D+ +LYW  + FLAFDVFFVV C+ +AC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  213  GGESLTRDAPRLYWLCLTFLAFDVFFVVICVAVACLIGIAVCCCLPCIIAILYAVADQEG  272

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +ED+ERL+KY F R   FE  +GE    S  GVMT C  D  +   H L ++DAECCI
Sbjct  273  ATKEDVERLTKYKFRRLGEFEKQNGE-IQESFGGVMTECDTDTPI--EHVLPLEDAECCI  329

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CLC YEDG ELR+LPC HHFH  C DKWL +NATCPLCK +I+K    +S E
Sbjct  330  CLCPYEDGIELRELPCRHHFHSVCIDKWLYMNATCPLCKFNILKNGNQSSSE  381



>gb|EYU35067.1| hypothetical protein MIMGU_mgv1a008119mg [Erythranthe guttata]
Length=384

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 124/172 (72%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +  +S QLYW  I FLAFDVFFVV C+ +AC+IGL +CCCLPCI+A+LYAVADQ+G
Sbjct  214  GGQSLPTESPQLYWLCITFLAFDVFFVVICVAVACLIGLAVCCCLPCIIAILYAVADQEG  273

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE L +Y F +   FE  +GE   GS  GVMT C  D      H L ++DAECCI
Sbjct  274  ATKEDIESLPRYKFQKIGDFEKQNGE-IQGSFRGVMTECDTDSPT--EHILPIEDAECCI  330

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CLCAY+DG ELR+LPC HHFH AC DKWL INATCPLCK +I+K    +  E
Sbjct  331  CLCAYDDGTELRELPCSHHFHSACIDKWLYINATCPLCKLNILKNGNQSGSE  382



>tpg|DAA39681.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=199

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 126/169 (75%), Gaps = 4/169 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQD-  562
            GGQ ++ D+ QLYW +I+FLAFDVFFVVFCI LACVIG+ +CCCLPCI+ +LYAV DQ+ 
Sbjct  30   GGQALSHDAPQLYWLTIVFLAFDVFFVVFCIALACVIGIAVCCCLPCIIGILYAVTDQEE  89

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA ++D+  LSK+ F RT+S  +         + GVMT CG +  +   H LS +DAECC
Sbjct  90   GASEDDVNNLSKFKF-RTMSDADKLAAGIAAPVGGVMTECGTNPPV--EHILSAEDAECC  146

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYH  235
            ICLC YEDG ELR+LPC HHFHC+C DKWL INATCPLCK +I+K + H
Sbjct  147  ICLCPYEDGVELRELPCNHHFHCSCIDKWLHINATCPLCKFNIVKSNLH  195



>gb|KEH31714.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=371

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 127/172 (74%), Gaps = 4/172 (2%)
 Frame = -3

Query  735  GQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGA  556
            GQ +  DS  LYW  I+FL FDVFFVVFCI LAC+IG+ +CCCLPCI+A+LYAVADQ+GA
Sbjct  204  GQDLIHDSPNLYWLCIVFLGFDVFFVVFCIALACIIGIAVCCCLPCIIALLYAVADQEGA  263

Query  555  DQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCIC  376
             +EDIE+LSK+ F R  + +  D  +  G + G+M  C  D  +   H L+ +DAECCIC
Sbjct  264  TKEDIEQLSKFKFQRKSNEKLADNTQ--GPVGGIMIECQADSPI--EHVLADEDAECCIC  319

Query  375  LCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            L AY+DGAELRQLPCGHHFHC C DKWL INATCPLCK +I+K S H   EV
Sbjct  320  LSAYDDGAELRQLPCGHHFHCTCVDKWLHINATCPLCKYNILKSSSHGQEEV  371



>ref|XP_009762973.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Nicotiana 
sylvestris]
Length=389

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 126/172 (73%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ M +D+ QLYW  I FLAFDVFFVV C+ +ACVIG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  219  GGQTMTRDAPQLYWLCITFLAFDVFFVVICVAVACVIGIAVCCCLPCIIAILYAVADQEG  278

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +ED+ERL+KY F R  +FE  +GE    S  GVM  C  D      H L  +DAECCI
Sbjct  279  ATKEDVERLTKYKFRRLGNFEKENGE-IQESFGGVMVECDTDTPT--EHVLPPEDAECCI  335

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            C+C+YEDGAELR+LPC HHFH AC DKWL INATCPLCK +I+K    +  E
Sbjct  336  CICSYEDGAELRELPCRHHFHAACIDKWLYINATCPLCKFNILKNGNQSGSE  387



>ref|XP_009617349.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Nicotiana 
tomentosiformis]
Length=389

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 124/172 (72%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ M +D+ QLYW  I FLAFDVFFVV C+ +ACVIG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  219  GGQTMTRDAPQLYWLCITFLAFDVFFVVICVAVACVIGIAVCCCLPCIIAILYAVADQEG  278

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +ED+ERL KY F R  +FE   GE    S  GVM  C  D      H L  +DAECCI
Sbjct  279  ATKEDVERLPKYKFRRLGNFEKESGE-IQESFGGVMVECDTDTPT--EHVLPPEDAECCI  335

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CLC+YEDGAELR+LPC HHFH AC DKWL INATCPLCK +I+K    +  E
Sbjct  336  CLCSYEDGAELRELPCRHHFHAACIDKWLYINATCPLCKFNIVKNGNQSGSE  387



>ref|XP_011093163.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Sesamum 
indicum]
Length=376

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 125/172 (73%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +  +S QLYW SI FLAFDVFFVV CI +ACVIGL +CCCLPCI+A+LYAVADQ+G
Sbjct  206  GGQSLPSESPQLYWISITFLAFDVFFVVICIAVACVIGLAVCCCLPCIIAILYAVADQEG  265

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI+RL +  F +   FE  +GE + GS  G++T C  D      H L  +DAECCI
Sbjct  266  ASKEDIQRLPRLKFRKISDFEKHNGE-SQGSFGGILTECDTDSPT--EHVLPPEDAECCI  322

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CLCAY+DGAELR+LPC HHFH AC DKWL INA CPLCK +I+K    +  E
Sbjct  323  CLCAYDDGAELRELPCSHHFHSACIDKWLVINAICPLCKFNILKNGNQSRRE  374



>ref|XP_009112973.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X2 [Brassica 
rapa]
Length=344

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 129/176 (73%), Gaps = 6/176 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ S QLYW  I+FL FDVFFVV CI LACVIG+ +CCCLPCI+AVLYAVA+Q+G
Sbjct  169  GGQELAQGSPQLYWLCIVFLGFDVFFVVLCIALACVIGIAVCCCLPCIIAVLYAVAEQEG  228

Query  558  ADQEDIERLSKYTFTRTISFE----NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDA  391
            A +EDI++L+K+ F +    E    + + E+A G   GVMT CG D  +   H L  +DA
Sbjct  229  ASKEDIDQLTKFKFRKVGESEKHTVDEEEEQAKGDSGGVMTECGTDSPL--QHTLPHEDA  286

Query  390  ECCICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            ECCICL AY D  ELR+LPCGHHFHC+C DKWL INATCPLCK +I+K S +  GE
Sbjct  287  ECCICLSAYADETELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKNSNYEDGE  342



>emb|CDY47347.1| BnaCnng14840D [Brassica napus]
Length=344

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 129/176 (73%), Gaps = 6/176 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ S QLYW  I+FL FDVFFVV CI LACVIG+ +CCCLPCI+AVLYAVA+Q+G
Sbjct  169  GGQELAQGSPQLYWLCIVFLGFDVFFVVLCIALACVIGIAVCCCLPCIIAVLYAVAEQEG  228

Query  558  ADQEDIERLSKYTFTRTISFE----NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDA  391
            A +EDI++L+K+ F +    E    + + E+A G   GVMT CG D  +   H L  +DA
Sbjct  229  ASKEDIDQLTKFKFRKVGESEKHTVDEEDEQAKGDSGGVMTECGTDSPL--QHTLPHEDA  286

Query  390  ECCICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            ECCICL AY D  ELR+LPCGHHFHC+C DKWL INATCPLCK +I+K S +  GE
Sbjct  287  ECCICLSAYADETELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKNSNYEDGE  342



>emb|CDY49194.1| BnaA09g10840D [Brassica napus]
Length=344

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 129/176 (73%), Gaps = 6/176 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ S QLYW  I+FL FDVFFVV CI LACVIG+ +CCCLPCI+AVLYAVA+Q+G
Sbjct  169  GGQELAQGSPQLYWLCIVFLGFDVFFVVLCIALACVIGIAVCCCLPCIIAVLYAVAEQEG  228

Query  558  ADQEDIERLSKYTFTRTISFE----NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDA  391
            A +EDI++L+K+ F +    E    + + E+A G   GVMT CG D  +   H L  +DA
Sbjct  229  ASKEDIDQLTKFKFRKVGESEKHTVDEEEEQAKGDSGGVMTECGTDSPL--QHTLPHEDA  286

Query  390  ECCICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            ECCICL AY D  ELR+LPCGHHFHC+C DKWL INATCPLCK +I+K S +  GE
Sbjct  287  ECCICLSAYADETELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKNSNYEDGE  342



>ref|XP_003525718.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Glycine 
max]
Length=380

 Score =   173 bits (439),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 126/172 (73%), Gaps = 3/172 (2%)
 Frame = -3

Query  735  GQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGA  556
             + + +DS  LYW  I FL FDVFFVVFC+ LAC++G+ +CCCLPCI+A+LYAVADQ+GA
Sbjct  212  SESLVRDSPLLYWLCIAFLGFDVFFVVFCMALACIVGIAVCCCLPCIIALLYAVADQEGA  271

Query  555  DQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCIC  376
             +EDIE+LSK+ F RT + E   G    G+  G+M  C  D  +   H LS +DAECCIC
Sbjct  272  SKEDIEQLSKFKFQRTETNEKLAGN-TQGAAGGIMIECDADSPI--EHVLSDEDAECCIC  328

Query  375  LCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            L AY+DG ELRQLPCGHHFHCAC DKWL INATCPLCK +I+K + H   EV
Sbjct  329  LSAYDDGVELRQLPCGHHFHCACVDKWLHINATCPLCKYNILKSTSHAQDEV  380



>ref|XP_010529547.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X2 [Tarenaya 
hassleriana]
Length=400

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 125/169 (74%), Gaps = 2/169 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A DS QLYW  IIFL FDVFFV+FC+ LACVIGL +CCCLPCI+A+LYA+ADQ+G
Sbjct  234  GGQTLAHDSPQLYWLCIIFLGFDVFFVLFCMALACVIGLAVCCCLPCIIAILYALADQEG  293

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A ++DI+ L K+ F R    +   GE    +  G+MT CG D  +   H +S +DAECCI
Sbjct  294  ASKDDIDHLPKFIFRRIGDDDKLPGEAQRSTAGGIMTECGTDSPI--EHSISPEDAECCI  351

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHT  232
            CLC YE+G ELR+LPCGHHFHCAC +KWL+IN+ CPLCK +I+  S H 
Sbjct  352  CLCDYEEGVELRELPCGHHFHCACIEKWLRINSKCPLCKFNIVNDSNHV  400



>ref|XP_007155554.1| hypothetical protein PHAVU_003G211600g [Phaseolus vulgaris]
 gb|ESW27548.1| hypothetical protein PHAVU_003G211600g [Phaseolus vulgaris]
Length=378

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 125/169 (74%), Gaps = 3/169 (2%)
 Frame = -3

Query  726  MAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGADQE  547
            + QDS  LYW  I FL FDVFFVVFCI LAC+IG+ +CCCLPCI+A+LYAVADQ+GA +E
Sbjct  213  LVQDSPLLYWLCIAFLGFDVFFVVFCIALACIIGIAVCCCLPCIIALLYAVADQEGASKE  272

Query  546  DIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCICLCA  367
            DIE+LSK+ F RT + E   G    G+  G+M  C  D  +   H LS +DAECCICL A
Sbjct  273  DIEQLSKFKFQRTETNEKLAGN-TQGAAGGIMMECDTDSPI--EHVLSDEDAECCICLSA  329

Query  366  YEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            Y+DG ELRQLPCGHHFHC+C DKWL INATCPLCK +I+K + H   EV
Sbjct  330  YDDGVELRQLPCGHHFHCSCVDKWLHINATCPLCKYNILKSTSHGQDEV  378



>ref|XP_008363169.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase At1g12760-like, 
partial [Malus domestica]
Length=180

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 120/166 (72%), Gaps = 7/166 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A  S QLYW  IIFL FDVFFV+FC+ LAC+I + +CCCLPCI  +LYAVADQDG
Sbjct  19   GGQSLASASLQLYWLCIIFLGFDVFFVIFCVALACMIDIAVCCCLPCIFTLLYAVADQDG  78

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A  EDIE+LSK+ F +  + +  D  +      GVMT CG D  +   H LS +DAECCI
Sbjct  79   ASMEDIEQLSKFRFKKVANEKVADDVQG-----GVMTECGTDSPI--KHVLSXEDAECCI  131

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CL  Y+DG ELRQLPC HHFHC+C +KWL INA+CPLCK +I+K S
Sbjct  132  CLSCYDDGVELRQLPCAHHFHCSCINKWLFINASCPLCKYNILKSS  177



>ref|XP_008799543.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Phoenix dactylifera]
Length=378

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 126/174 (72%), Gaps = 4/174 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +  D+ QLYW  I+FLAFDVFFV+FC+ LACVIG+ +CCCLPCI+A+LYAVADQ +
Sbjct  208  GGQVLTHDAPQLYWLCIVFLAFDVFFVIFCVALACVIGIAVCCCLPCIIAILYAVADQQE  267

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDI +L KY F +    E   GE   GS  G+M  CG D  +   H LS +DAECC
Sbjct  268  GASEEDIRQLPKYKFRKIGDSEKLVGE-ISGSFGGIMMECGNDPPI--EHALSGEDAECC  324

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ICL AY+DG ELRQLPCGHHFHCAC DKWL INATCPLCK +IIK       EV
Sbjct  325  ICLSAYDDGVELRQLPCGHHFHCACIDKWLFINATCPLCKFNIIKSRNQGREEV  378



>ref|XP_008670056.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Zea mays]
Length=354

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 126/169 (75%), Gaps = 4/169 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQD-  562
            GGQ ++ D+ QLYW +I+FLAFDVFFVVFCI LACVIG+ +CCCLPCI+ +LYAV DQ+ 
Sbjct  185  GGQALSHDAPQLYWLTIVFLAFDVFFVVFCIALACVIGIAVCCCLPCIIGILYAVTDQEE  244

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA ++D+  LSK+ F RT+S  +         + GVMT CG +  +   H LS +DAECC
Sbjct  245  GASEDDVNNLSKFKF-RTMSDADKLAAGIAAPVGGVMTECGTNPPV--EHILSAEDAECC  301

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYH  235
            ICLC YEDG ELR+LPC HHFHC+C DKWL INATCPLCK +I+K + H
Sbjct  302  ICLCPYEDGVELRELPCNHHFHCSCIDKWLHINATCPLCKFNIVKSNLH  350



>ref|XP_003550874.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Glycine 
max]
Length=379

 Score =   171 bits (432),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 125/172 (73%), Gaps = 3/172 (2%)
 Frame = -3

Query  735  GQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGA  556
             + + QDS  LYW  I FL FDVFFVVFCI LAC+IG+ +CCCLPCI+A+LYAVADQ+GA
Sbjct  211  SEALVQDSPLLYWLCIAFLGFDVFFVVFCIALACIIGIAVCCCLPCIIALLYAVADQEGA  270

Query  555  DQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCIC  376
             +EDIE+LSK+ F RT + E   G    G+  G+M  C  D  +   H LS +DAECCIC
Sbjct  271  SKEDIEQLSKFKFQRTETNEKHAGN-TQGAAGGIMIECDADSPI--EHVLSDEDAECCIC  327

Query  375  LCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            L AY+DG ELR+LPC HHFHCAC DKWL INATCPLCK +I+K + H   EV
Sbjct  328  LSAYDDGVELRKLPCSHHFHCACVDKWLHINATCPLCKYNILKSTSHGQDEV  379



>ref|XP_004240042.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Solanum 
lycopersicum]
Length=396

 Score =   171 bits (433),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 126/174 (72%), Gaps = 7/174 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ M +D+ QLYW  I FLAFDVFFVV C+ +ACVIG+ +CCCLPCI+A+LYAV DQ+G
Sbjct  226  GGQTMPRDAPQLYWLCITFLAFDVFFVVICVAVACVIGIAVCCCLPCIIAILYAVTDQEG  285

Query  558  ADQEDIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAEC  385
            A +ED+ERL KY F R  +FE  NGD +E+ G   GVM  C  D      H L  +DAEC
Sbjct  286  ATKEDVERLPKYKFKRLGNFEKENGDIQESFG---GVMVECDTDTPT--EHVLPPEDAEC  340

Query  384  CICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CICLC+YEDG ELR+LPC HHFH AC DKWL INATCPLCK +I+K    +  E
Sbjct  341  CICLCSYEDGIELRELPCRHHFHAACIDKWLYINATCPLCKFNILKYGNQSGSE  394



>ref|XP_006345510.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Solanum 
tuberosum]
Length=396

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 126/174 (72%), Gaps = 7/174 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ M +D+ QLYW  I FLAFDVFFVV C+ +ACVIG+ +CCCLPCI+A+LYAV DQ+G
Sbjct  226  GGQTMPRDAPQLYWLCITFLAFDVFFVVICVAVACVIGIAVCCCLPCIIAILYAVTDQEG  285

Query  558  ADQEDIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAEC  385
            A +ED+ERL KY F R  +FE  NGD +E+ G   GVM  C  D      H L  +DAEC
Sbjct  286  ATKEDVERLPKYKFKRLGNFEKENGDIQESFG---GVMVECDTDTPT--EHVLPPEDAEC  340

Query  384  CICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CICLC+YEDG ELR+LPC HHFH AC DKWL INATCPLCK +I+K    +  E
Sbjct  341  CICLCSYEDGIELRELPCHHHFHAACIDKWLYINATCPLCKFNILKYGNQSGSE  394



>ref|XP_011091747.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Sesamum 
indicum]
Length=329

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 124/172 (72%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +  +S QLYW  I FLAFDVFFVV C+ +ACVIG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  159  GGQSLTSESPQLYWLCITFLAFDVFFVVICVAVACVIGIAVCCCLPCIIAILYAVADQEG  218

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI+RL +Y F +   FE  +GE    S  G+MT C  D      H L ++DAECCI
Sbjct  219  ATKEDIDRLPRYKFRKIGDFEKQNGE-IQESFGGIMTECDTDSPT--EHVLPLEDAECCI  275

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CLCAY+DG ELR+LPC HHFH AC DKWL INATCPLCK +I+K    +  E
Sbjct  276  CLCAYDDGTELRELPCLHHFHSACIDKWLHINATCPLCKFNILKNGNQSGSE  327



>ref|XP_004133878.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Cucumis 
sativus]
 ref|XP_004155812.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Cucumis 
sativus]
 gb|KGN56546.1| hypothetical protein Csa_3G123190 [Cucumis sativus]
Length=385

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 128/175 (73%), Gaps = 7/175 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ + + S QLYW SI FLAFDV FV+ C+ +AC++G+ ICCCLPCI+A+LYAV DQ+G
Sbjct  216  GGQELIEGSPQLYWLSITFLAFDVVFVLICVAIACLVGVAICCCLPCIIAILYAVTDQEG  275

Query  558  ADQEDIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAEC  385
            A +E+IERL KYTF RT   E  NGD +E+ G   G+M+ C  D        L  +D+EC
Sbjct  276  ATKEEIERLPKYTFNRTGDVEKVNGDIQESSG---GIMSNCDTDAPT--ERFLRPEDSEC  330

Query  384  CICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CICL AYE+GAELR+LPC HHFHC C DKWL +NATCPLCK +I+K +  +S EV
Sbjct  331  CICLSAYENGAELRELPCNHHFHCNCIDKWLHMNATCPLCKFNILKPNSSSSEEV  385



>ref|XP_008438087.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Cucumis 
melo]
Length=385

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 127/175 (73%), Gaps = 7/175 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ + + S QLYW SI FLAFDV FV+ C+ +AC++G+ ICCCLPCI+AVLYAV DQ+G
Sbjct  216  GGQELIEGSPQLYWLSITFLAFDVVFVLICVAIACLVGVAICCCLPCIIAVLYAVTDQEG  275

Query  558  ADQEDIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAEC  385
            A +E+IERL KY F RT   E  NGD +E+ G   G+MT C  D        L  +D+EC
Sbjct  276  ATKEEIERLPKYKFNRTGDVEKVNGDIQESSG---GIMTNC--DTEAPTERFLRPEDSEC  330

Query  384  CICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CICL AYE+GAELR+LPC HHFHC C DKWL +NATCPLCK +I+K +  +S EV
Sbjct  331  CICLSAYENGAELRELPCNHHFHCNCIDKWLHMNATCPLCKFNILKPNSSSSEEV  385



>ref|XP_010529546.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X1 [Tarenaya 
hassleriana]
Length=401

 Score =   169 bits (427),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 125/170 (74%), Gaps = 3/170 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +A DS QLYW  IIFL FDVFFV+FC+ LACVIGL +CCCLPCI+A+LYA+ADQ +
Sbjct  234  GGQTLAHDSPQLYWLCIIFLGFDVFFVLFCMALACVIGLAVCCCLPCIIAILYALADQQE  293

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA ++DI+ L K+ F R    +   GE    +  G+MT CG D  +   H +S +DAECC
Sbjct  294  GASKDDIDHLPKFIFRRIGDDDKLPGEAQRSTAGGIMTECGTDSPI--EHSISPEDAECC  351

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHT  232
            ICLC YE+G ELR+LPCGHHFHCAC +KWL+IN+ CPLCK +I+  S H 
Sbjct  352  ICLCDYEEGVELRELPCGHHFHCACIEKWLRINSKCPLCKFNIVNDSNHV  401



>ref|XP_009112972.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Brassica 
rapa]
Length=348

 Score =   167 bits (423),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 129/180 (72%), Gaps = 10/180 (6%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ--  565
            GGQ +AQ S QLYW  I+FL FDVFFVV CI LACVIG+ +CCCLPCI+AVLYAVA+Q  
Sbjct  169  GGQELAQGSPQLYWLCIVFLGFDVFFVVLCIALACVIGIAVCCCLPCIIAVLYAVAEQLK  228

Query  564  --DGADQEDIERLSKYTFTRTISFE----NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLS  403
              +GA +EDI++L+K+ F +    E    + + E+A G   GVMT CG D  +   H L 
Sbjct  229  MQEGASKEDIDQLTKFKFRKVGESEKHTVDEEEEQAKGDSGGVMTECGTDSPL--QHTLP  286

Query  402  VDDAECCICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
             +DAECCICL AY D  ELR+LPCGHHFHC+C DKWL INATCPLCK +I+K S +  GE
Sbjct  287  HEDAECCICLSAYADETELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKNSNYEDGE  346



>ref|XP_006364123.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Solanum 
tuberosum]
Length=356

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 119/166 (72%), Gaps = 1/166 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ M  +S QLYW  I+FLAFDVFFV+F ++LAC IGLGICCC PCI+AVLY VAD+ G
Sbjct  186  GGQRMVDESPQLYWLCIVFLAFDVFFVIFLLVLACAIGLGICCCFPCIIAVLYIVADKKG  245

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A  ED+E+LSKY F R    E     E  G+ AG MTLCG D      H++SVDD+EC I
Sbjct  246  AAIEDVEKLSKYIFQRNDCTEKKCTSENQGTFAGFMTLCGGDAPTD-EHRVSVDDSECSI  304

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CL  Y+DG ELR+LPCGH FHC C DKWL ++ATCPLCK +I   S
Sbjct  305  CLSTYDDGDELRELPCGHLFHCPCIDKWLYMSATCPLCKRNIFGDS  350



>ref|XP_011463819.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=386

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 134/173 (77%), Gaps = 4/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+ S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQDG
Sbjct  218  GGQTLARASPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQDG  277

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+LSK+ F R  + +   GE+  G   GVMT CG D  +   H LS +DAECCI
Sbjct  278  ASKEDIEQLSKFKFRRVSNEKIAAGEQ--GPHGGVMTECGTDSPI--EHVLSPEDAECCI  333

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL +Y+DGAELRQLPCGHHFHC+C DKWL INATCPLCK +I+K S +  GEV
Sbjct  334  CLSSYDDGAELRQLPCGHHFHCSCIDKWLFINATCPLCKYNILKSSSNEQGEV  386



>gb|EYU32071.1| hypothetical protein MIMGU_mgv1a008136mg [Erythranthe guttata]
Length=383

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 127/174 (73%), Gaps = 4/174 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +  ++ QLYW  I FLAFDVFFVV C+ +ACVIG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  213  GGQYLTSEAPQLYWLCITFLAFDVFFVVICVAVACVIGIAVCCCLPCIIAILYAVADQEG  272

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI+RL +Y F +   FE   GE    S  G++T C  D      H L ++DAECCI
Sbjct  273  ATKEDIDRLPRYKFRKIGDFEKQSGE-IQESFGGIITECDTDSPT--EHVLPLEDAECCI  329

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIK-GSYHTSGEV  220
            CLCAYEDGAELR+LPC HHFH  C DKWL INATCPLCK +I+K G+ + S EV
Sbjct  330  CLCAYEDGAELRELPCRHHFHLPCIDKWLHINATCPLCKFNILKNGNQNDSEEV  383



>ref|XP_007211433.1| hypothetical protein PRUPE_ppa007140mg [Prunus persica]
 gb|EMJ12632.1| hypothetical protein PRUPE_ppa007140mg [Prunus persica]
Length=380

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 122/173 (71%), Gaps = 5/173 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GG+ + +DS QLYW  I FLA DV FVV CI +A +IG+ +C CLPCI+A+LY V DQ+G
Sbjct  210  GGESLIRDSPQLYWICITFLALDVVFVVICIAVASLIGIAVCFCLPCIIAILYVVTDQEG  269

Query  558  ADQEDIERLSKYTFTRTIS-FENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            A +E+I+ L KY F RTIS FE  +GE    S  G+MT C  D      H LS +DAECC
Sbjct  270  ATKEEIDHLPKYKF-RTISDFEKVNGE-IQESFGGIMTEC--DTNTPTEHVLSQEDAECC  325

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            ICLCAY+DG ELR+LPC HHFHC C DKWLQINATCPLCK +I+K    +  E
Sbjct  326  ICLCAYDDGTELRELPCHHHFHCTCIDKWLQINATCPLCKFNILKSVSQSGSE  378



>ref|XP_008225188.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Prunus 
mume]
Length=380

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 122/173 (71%), Gaps = 5/173 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GG+ + +DS QLYW  I FLA DV FVV CI +A +IG+ +C CLPCI+A+LY V DQ+G
Sbjct  210  GGESLIRDSPQLYWICITFLALDVVFVVICIAVASLIGIAVCFCLPCIIAILYVVTDQEG  269

Query  558  ADQEDIERLSKYTFTRTIS-FENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            A +E+I+ L KY F RTIS FE  +GE    S  G+MT C  D      H LS +DAECC
Sbjct  270  ATKEEIDHLPKYKF-RTISDFEKVNGE-IQESFGGIMTEC--DTNTPTEHVLSQEDAECC  325

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            ICLCAY+DG ELR+LPC HHFHC C DKWLQINATCPLCK +I+K    +  E
Sbjct  326  ICLCAYDDGTELRELPCHHHFHCTCIDKWLQINATCPLCKFNILKSVSQSGSE  378



>ref|XP_010255490.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Nelumbo nucifera]
Length=382

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 129/173 (75%), Gaps = 3/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ + +DS +LYW  IIFLAFDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  213  GGQALTRDSPELYWLCIIFLAFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  272

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI++L KY F R   FE   GE   G   G+MT C  D    + H LS++DAECCI
Sbjct  273  ASKEDIDQLPKYKFRRISDFEKISGE-IQGPFGGIMTEC--DTETPIEHVLSLEDAECCI  329

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL  Y+DGAELR+LPCGHHFHCAC DKWL INATCPLCK +IIK       EV
Sbjct  330  CLSTYDDGAELRELPCGHHFHCACIDKWLYINATCPLCKYNIIKSGSQGREEV  382



>ref|XP_010255491.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X4 [Nelumbo nucifera]
Length=381

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 129/173 (75%), Gaps = 3/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ + +DS +LYW  IIFLAFDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  212  GGQALTRDSPELYWLCIIFLAFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  271

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI++L KY F R   FE   GE   G   G+MT C  D    + H LS++DAECCI
Sbjct  272  ASKEDIDQLPKYKFRRISDFEKISGE-IQGPFGGIMTEC--DTETPIEHVLSLEDAECCI  328

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL  Y+DGAELR+LPCGHHFHCAC DKWL INATCPLCK +IIK       EV
Sbjct  329  CLSTYDDGAELRELPCGHHFHCACIDKWLYINATCPLCKYNIIKSGSQGREEV  381



>emb|CBI38762.3| unnamed protein product [Vitis vinifera]
Length=329

 Score =   164 bits (416),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 122/172 (71%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ + +DS QLYW  I+FLAFDVFFVV C+ +ACVIG+ +CCCLPCI+A+LY VADQ+G
Sbjct  159  GGQDLTRDSPQLYWLCIVFLAFDVFFVVICVAVACVIGIAVCCCLPCIIAILYTVADQEG  218

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +E+IERL KY F R    E  +GE    S  G+MT C  D  M   H +  +DAECCI
Sbjct  219  ATKEEIERLPKYKFRRIGESEKLNGE-IQESFGGIMTECDTDTPM--EHVIPQEDAECCI  275

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CL AYED  ELR+LPC H FHC C DKWL INATCPLCK +I+K +  +  E
Sbjct  276  CLSAYEDETELRELPCRHRFHCTCIDKWLYINATCPLCKLNILKNASQSGCE  327



>emb|CBI34726.3| unnamed protein product [Vitis vinifera]
Length=269

 Score =   162 bits (411),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 131/173 (76%), Gaps = 3/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+DS QLYW  IIFL FDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  100  GGQALARDSPQLYWLCIIFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAILYAVADQEG  159

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI++LS++ F +    E  DG+   G+  G+MT CG D      H LS +DAECCI
Sbjct  160  ASKEDIDQLSRFKFRKVGDIEKIDGD-IQGACGGIMTECGTDAPT--EHVLSQEDAECCI  216

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AY+DG ELR+LPCGHHFHC C DKWL INATCPLCK +I+K S +   EV
Sbjct  217  CLSAYDDGVELRELPCGHHFHCTCVDKWLYINATCPLCKYNILKSSSNGREEV  269



>gb|KDP28678.1| hypothetical protein JCGZ_14449 [Jatropha curcas]
Length=329

 Score =   164 bits (415),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 122/172 (71%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ + +DS QLYW  I FLAFDV FV+ C+ +AC+IG+ ICCCLPCI+ +LYA+ +++G
Sbjct  159  GGQNLTRDSPQLYWLCITFLAFDVIFVIICVAVACLIGIAICCCLPCIIGILYAMTEREG  218

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +E+I+RL KY F RT   E  +GE    S  G+MT  G +      H LS +DAECCI
Sbjct  219  ATKEEIDRLPKYKFHRTGDIEKVNGE-IQASFGGMMT--GYEPDTPTVHLLSHEDAECCI  275

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CL AYEDG ELR+LPC HHFHC C DKWL INATCPLCK +I+K    + GE
Sbjct  276  CLSAYEDGTELRELPCHHHFHCTCIDKWLCINATCPLCKYNILKAGNQSGGE  327



>ref|XP_002509740.1| cleavage and polyadenylation specificity factor, putative [Ricinus 
communis]
 gb|EEF51127.1| cleavage and polyadenylation specificity factor, putative [Ricinus 
communis]
Length=383

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 134/175 (77%), Gaps = 5/175 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ ++ +S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  212  GGQALSHNSPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQEG  271

Query  558  ADQEDIERLSKYTFTRTISFEN--GDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAEC  385
            A +EDIE+LSK+ F R  + E   G+G+E  G + GVMT CG D  +   H LS +DAEC
Sbjct  272  ASKEDIEQLSKFKFRRVDNDEKLTGNGDE-QGPLGGVMTECGTDSPV--EHILSEEDAEC  328

Query  384  CICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CICL AY+DG ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K S     EV
Sbjct  329  CICLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSRDREEV  383



>ref|XP_010676528.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Beta vulgaris 
subsp. vulgaris]
Length=348

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 119/173 (69%), Gaps = 4/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GG  + QDS  LYW  I FL  D+FFV+FC+ LA VI   +CCCLPCI+A+LY +AD+ G
Sbjct  180  GGHALEQDSPTLYWLCIAFLVLDLFFVIFCVALASVIAAAVCCCLPCIIAILYILADRGG  239

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +E+I+ L KYTF R+ S E    EE      G++  CG D A+     L+ +DAECCI
Sbjct  240  ASKEEIDNLPKYTFHRSDS-EKKMNEETEAPCGGIIKGCGTDCAV--ERTLTAEDAECCI  296

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CLCAYEDG ELR+LPC HHFHC+C DKWL IN+TCPLCK  I K  Y+  GEV
Sbjct  297  CLCAYEDGIELRELPCNHHFHCSCVDKWLHINSTCPLCKYDISK-RYNRDGEV  348



>gb|KDO63536.1| hypothetical protein CISIN_1g020491mg [Citrus sinensis]
Length=324

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 130/172 (76%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+DS  LYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  154  GGQALARDSPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQEG  213

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIERLSK+ F R +  E    ++  GS  G+MT CG +      H LS +DAECCI
Sbjct  214  ASKEDIERLSKFKFRRMVDTEKL-SDDGQGSQGGIMTECGTETPN--EHVLSNEDAECCI  270

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CL AY+DG ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K S +   E
Sbjct  271  CLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDRE  322



>gb|KDO63535.1| hypothetical protein CISIN_1g020491mg [Citrus sinensis]
Length=323

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 130/172 (76%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+DS  LYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  153  GGQALARDSPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQEG  212

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIERLSK+ F R +  E    ++  GS  G+MT CG +      H LS +DAECCI
Sbjct  213  ASKEDIERLSKFKFRRMVDTEKLS-DDGQGSQGGIMTECGTETPN--EHVLSNEDAECCI  269

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CL AY+DG ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K S +   E
Sbjct  270  CLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDRE  321



>ref|XP_002271651.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Vitis vinifera]
Length=382

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 122/172 (71%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ + +DS QLYW  I+FLAFDVFFVV C+ +ACVIG+ +CCCLPCI+A+LY VADQ+G
Sbjct  212  GGQDLTRDSPQLYWLCIVFLAFDVFFVVICVAVACVIGIAVCCCLPCIIAILYTVADQEG  271

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +E+IERL KY F R    E  +GE    S  G+MT C  D  M   H +  +DAECCI
Sbjct  272  ATKEEIERLPKYKFRRIGESEKLNGE-IQESFGGIMTECDTDTPM--EHVIPQEDAECCI  328

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CL AYED  ELR+LPC H FHC C DKWL INATCPLCK +I+K +  +  E
Sbjct  329  CLSAYEDETELRELPCRHRFHCTCIDKWLYINATCPLCKLNILKNASQSGCE  380



>ref|XP_004511598.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Cicer 
arietinum]
Length=393

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 131/173 (76%), Gaps = 3/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQDS QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  224  GGQALAQDSPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQEG  283

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+LSK+ F R  S +   G    G + G+MT C  D  +   H L+ +DAECCI
Sbjct  284  ASKEDIEQLSKFKFQRVESNDKQTGN-IQGPVGGIMTECRADSPI--EHVLAEEDAECCI  340

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CLC+Y+DG ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K S     EV
Sbjct  341  CLCSYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSNLGQEEV  393



>gb|EPS63490.1| hypothetical protein M569_11294, partial [Genlisea aurea]
Length=347

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GG  +  ++ QLYW  I FLAFDVFFVV C+ +AC+IGL +CCCLPCI+AVLYAV DQ+G
Sbjct  177  GGPTLIDEAPQLYWLCITFLAFDVFFVVICVAVACIIGLAVCCCLPCIIAVLYAVGDQEG  236

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIERL KY F R   FE  +GE    S  G+MT    D        L ++DAECCI
Sbjct  237  ATKEDIERLPKYIFRRIGDFEKQNGE-IQESFGGIMT--ETDSESPSERVLPLEDAECCI  293

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIK-GSYHTSGEV  220
            CLC Y+DG ELR+LPC HHFH  C DKWL INATCPLCK +I+K GS   S EV
Sbjct  294  CLCTYDDGNELRELPCRHHFHSICVDKWLHINATCPLCKLNILKSGSQSGSDEV  347



>ref|XP_007040144.1| Zinc finger, C3HC4 type (RING finger) family protein isoform 
1 [Theobroma cacao]
 gb|EOY24645.1| Zinc finger, C3HC4 type (RING finger) family protein isoform 
1 [Theobroma cacao]
Length=381

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 130/168 (77%), Gaps = 3/168 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+ S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  214  GGQALARGSPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQEG  273

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI++LSK+ F +T + E   G+ A G + G+MT C  D  M   H LS DDAECCI
Sbjct  274  ASKEDIDQLSKFRFRKTCNDEKIAGD-AEGPVGGIMTECSTDSPM--EHVLSQDDAECCI  330

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYH  235
            CL  Y+DG ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K S H
Sbjct  331  CLSPYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSH  378



>ref|XP_007040145.1| Zinc finger, C3HC4 type (RING finger) family protein isoform 
2 [Theobroma cacao]
 gb|EOY24646.1| Zinc finger, C3HC4 type (RING finger) family protein isoform 
2 [Theobroma cacao]
Length=380

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 130/168 (77%), Gaps = 3/168 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+ S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  213  GGQALARGSPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQEG  272

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI++LSK+ F +T + E   G+ A G + G+MT C  D  M   H LS DDAECCI
Sbjct  273  ASKEDIDQLSKFRFRKTCNDEKIAGD-AEGPVGGIMTECSTDSPM--EHVLSQDDAECCI  329

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYH  235
            CL  Y+DG ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K S H
Sbjct  330  CLSPYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSH  377



>ref|XP_006477421.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X4 [Citrus sinensis]
Length=381

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 130/172 (76%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+DS  LYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  211  GGQALARDSPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQEG  270

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIERLSK+ F R +  E    ++  GS  G+MT CG +      H LS +DAECCI
Sbjct  271  ASKEDIERLSKFKFRRMVDTEKL-SDDGQGSQGGIMTECGTETPN--EHVLSNEDAECCI  327

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CL AY+DG ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K S +   E
Sbjct  328  CLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDRE  379



>emb|CDP08874.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 124/172 (72%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GG  +  D+ QLYW  I FLAFDVFFVV C+ +ACVIG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  224  GGPNLTHDAPQLYWLCITFLAFDVFFVVICVAVACVIGIAVCCCLPCIIAILYAVADQEG  283

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L KY F R    E  +GE    S  G+MT C  D +  + H L ++DAECCI
Sbjct  284  ATKEDIEQLPKYKFRRFGDSEKQNGE-IQESFGGIMTEC--DTSTPVEHVLPLEDAECCI  340

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CLC Y+DG ELR+LPC HHFH AC +KWL INATCPLCK +I+K    + GE
Sbjct  341  CLCTYDDGTELRELPCRHHFHSACIEKWLYINATCPLCKLNILKNGNLSGGE  392



>ref|XP_006440560.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
 gb|ESR53800.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
Length=380

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 130/172 (76%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+DS  LYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  210  GGQALARDSPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQEG  269

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIERLSK+ F R +  E    ++  GS  G+MT CG +      H LS +DAECCI
Sbjct  270  ASKEDIERLSKFKFRRMVDTEKL-SDDGQGSQGGIMTECGTETPN--EHVLSNEDAECCI  326

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CL AY+DG ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K S +   E
Sbjct  327  CLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDRE  378



>ref|XP_006440561.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
 gb|ESR53801.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
Length=381

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 130/172 (76%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+DS  LYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  211  GGQALARDSPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQEG  270

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIERLSK+ F R +  E    ++  GS  G+MT CG +      H LS +DAECCI
Sbjct  271  ASKEDIERLSKFKFRRMVDTEKL-SDDGQGSQGGIMTECGTETPN--EHVLSNEDAECCI  327

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CL AY+DG ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K S +   E
Sbjct  328  CLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDRE  379



>ref|XP_006477422.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X5 [Citrus sinensis]
Length=380

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 130/172 (76%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+DS  LYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  210  GGQALARDSPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQEG  269

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIERLSK+ F R +  E    ++  GS  G+MT CG +      H LS +DAECCI
Sbjct  270  ASKEDIERLSKFKFRRMVDTEKL-SDDGQGSQGGIMTECGTETPN--EHVLSNEDAECCI  326

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CL AY+DG ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K S +   E
Sbjct  327  CLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDRE  378



>ref|XP_006477419.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Citrus sinensis]
Length=386

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 130/172 (76%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+DS  LYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  216  GGQALARDSPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQEG  275

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIERLSK+ F R +  E    ++  GS  G+MT CG +      H LS +DAECCI
Sbjct  276  ASKEDIERLSKFKFRRMVDTEKL-SDDGQGSQGGIMTECGTETPN--EHVLSNEDAECCI  332

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CL AY+DG ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K S +   E
Sbjct  333  CLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDRE  384



>ref|XP_010112554.1| E3 ubiquitin-protein ligase [Morus notabilis]
 gb|EXC34101.1| E3 ubiquitin-protein ligase [Morus notabilis]
Length=378

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 130/166 (78%), Gaps = 3/166 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  211  GGQSLAQASPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQEG  270

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+LSK+ F++  S E   G+ A G   G+MT CG D  +   H LS +DAECCI
Sbjct  271  ASKEDIEQLSKFKFSKRCSNEKLAGD-AQGPCGGIMTECGTDSPV--EHVLSQEDAECCI  327

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CL AY+DG ELRQLPCGHHFHC+C DKWL INATCPLCK +I+K S
Sbjct  328  CLTAYDDGVELRQLPCGHHFHCSCVDKWLFINATCPLCKYNILKSS  373



>ref|XP_006440562.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
 gb|ESR53802.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
Length=386

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 130/172 (76%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+DS  LYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  216  GGQALARDSPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQEG  275

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIERLSK+ F R +  E    ++  GS  G+MT CG +      H LS +DAECCI
Sbjct  276  ASKEDIERLSKFKFRRMVDTEKL-SDDGQGSQGGIMTECGTETPN--EHVLSNEDAECCI  332

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CL AY+DG ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K S +   E
Sbjct  333  CLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDRE  384



>gb|KJB52052.1| hypothetical protein B456_008G244300 [Gossypium raimondii]
Length=381

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 127/168 (76%), Gaps = 3/168 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+ S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  214  GGQALARTSPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQEG  273

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+LSK+ F R I  +          + G+MT CG D      H LS DDAECCI
Sbjct  274  ASKEDIEQLSKFKF-RKIDNDGKSAVNVQEPVGGIMTECGTDSPR--EHVLSPDDAECCI  330

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYH  235
            CL AY+DG ELR+LPCGHHFHCAC DKWL+INATCPLCK +I+K S H
Sbjct  331  CLSAYDDGVELRELPCGHHFHCACVDKWLRINATCPLCKYNILKSSSH  378



>ref|XP_002511805.1| cleavage and polyadenylation specificity factor, putative [Ricinus 
communis]
 gb|EEF50474.1| cleavage and polyadenylation specificity factor, putative [Ricinus 
communis]
Length=375

 Score =   162 bits (411),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 120/171 (70%), Gaps = 3/171 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +  DS QLYW  I FLAFDV FV+ CI +AC+IGL ICCCLPCI+ +LYA+ D++G
Sbjct  205  GGQNLTNDSPQLYWLCITFLAFDVIFVIICIAVACLIGLAICCCLPCIIGILYAMTDREG  264

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A QE+IE+L  Y F R   FE  + +    +  G+MT C +D       +LS +DAECCI
Sbjct  265  ATQEEIEQLPMYKFRRIGDFEKVNAD-FQATFGGMMTECEIDTPT--ERRLSHEDAECCI  321

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSG  226
            CL AYEDG ELRQLPC HHFH  C DKWL INATCPLCK +I+K S H +G
Sbjct  322  CLSAYEDGTELRQLPCQHHFHSTCIDKWLYINATCPLCKLNILKASNHIAG  372



>ref|XP_010661149.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Vitis vinifera]
Length=384

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 131/173 (76%), Gaps = 3/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+DS QLYW  IIFL FDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  215  GGQALARDSPQLYWLCIIFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAILYAVADQEG  274

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI++LS++ F +    E  DG+   G+  G+MT CG D      H LS +DAECCI
Sbjct  275  ASKEDIDQLSRFKFRKVGDIEKIDGD-IQGACGGIMTECGTDAPT--EHVLSQEDAECCI  331

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AY+DG ELR+LPCGHHFHC C DKWL INATCPLCK +I+K S +   EV
Sbjct  332  CLSAYDDGVELRELPCGHHFHCTCVDKWLYINATCPLCKYNILKSSSNGREEV  384



>ref|XP_003631422.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Vitis vinifera]
Length=383

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 131/173 (76%), Gaps = 3/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+DS QLYW  IIFL FDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  214  GGQALARDSPQLYWLCIIFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAILYAVADQEG  273

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI++LS++ F +    E  DG+   G+  G+MT CG D      H LS +DAECCI
Sbjct  274  ASKEDIDQLSRFKFRKVGDIEKIDGD-IQGACGGIMTECGTDAPT--EHVLSQEDAECCI  330

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AY+DG ELR+LPCGHHFHC C DKWL INATCPLCK +I+K S +   EV
Sbjct  331  CLSAYDDGVELRELPCGHHFHCTCVDKWLYINATCPLCKYNILKSSSNGREEV  383



>ref|XP_008360211.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase At1g63170-like, 
partial [Malus domestica]
Length=184

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 116/173 (67%), Gaps = 7/173 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A  S QLYW  IIFL FDVFFV+FC+ LAC+I + +CCCLPCI  +LYAVADQDG
Sbjct  19   GGQSLASASLQLYWLCIIFLGFDVFFVIFCVALACMIDIAVCCCLPCIFTLLYAVADQDG  78

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A  EDIE+LSK+ F +       + + A     GVMT CG D  +   H LS +DAECCI
Sbjct  79   ASXEDIEQLSKFRFXKV-----ANEKVAXDVQGGVMTECGTDSPI--XHVLSXEDAECCI  131

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL  Y+DG ELRQLPC HHFHC   +KWL IN   PL K +I+K S    GEV
Sbjct  132  CLSCYDDGVELRQLPCAHHFHCXXINKWLFINXXXPLXKYNILKSSSQNXGEV  184



>gb|KHN35002.1| E3 ubiquitin-protein ligase [Glycine soja]
Length=302

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 129/173 (75%), Gaps = 3/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQDS QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAV DQ+G
Sbjct  133  GGQALAQDSPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVTDQEG  192

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+LSK+ F R  S E   G    G + G+MT C  D  +   H L+ +DAECCI
Sbjct  193  ASKEDIEQLSKFKFRRIESNEKLTGT-IQGPVGGIMTECQADSPI--EHALAEEDAECCI  249

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL +Y+DG ELR+LPCGHHFHC C DKWL INATCPLCK +I+K S  +  EV
Sbjct  250  CLSSYDDGVELRELPCGHHFHCVCVDKWLYINATCPLCKYNILKSSNLSQEEV  302



>ref|XP_011463818.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=387

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 134/174 (77%), Gaps = 5/174 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +A+ S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ D
Sbjct  218  GGQTLARASPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQQD  277

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDIE+LSK+ F R  + +   GE+  G   GVMT CG D  +   H LS +DAECC
Sbjct  278  GASKEDIEQLSKFKFRRVSNEKIAAGEQ--GPHGGVMTECGTDSPI--EHVLSPEDAECC  333

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ICL +Y+DGAELRQLPCGHHFHC+C DKWL INATCPLCK +I+K S +  GEV
Sbjct  334  ICLSSYDDGAELRQLPCGHHFHCSCIDKWLFINATCPLCKYNILKSSSNEQGEV  387



>ref|XP_008438088.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X2 [Cucumis 
melo]
Length=384

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 126/175 (72%), Gaps = 8/175 (5%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ + + S QLYW SI FLAFDV FV+ C+ +AC++G+ ICCCLPCI+AVLYAV DQ+G
Sbjct  216  GGQELIEGSPQLYWLSITFLAFDVVFVLICVAIACLVGVAICCCLPCIIAVLYAVTDQEG  275

Query  558  ADQEDIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAEC  385
            A +E+IERL KY F RT   E  NGD +E+ G   G+MT C  D        L  +D+ C
Sbjct  276  ATKEEIERLPKYKFNRTGDVEKVNGDIQESSG---GIMTNC--DTEAPTERFLRPEDS-C  329

Query  384  CICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CICL AYE+GAELR+LPC HHFHC C DKWL +NATCPLCK +I+K +  +S EV
Sbjct  330  CICLSAYENGAELRELPCNHHFHCNCIDKWLHMNATCPLCKFNILKPNSSSSEEV  384



>ref|XP_002889965.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66224.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
Length=335

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 132/173 (76%), Gaps = 2/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ+S ++YW SI+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  165  GGQELAQESPRIYWLSIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  224

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L+K+ F +        G+EA G+  G+MT CG D  +   H L  +DAECCI
Sbjct  225  ASKEDIEQLTKFKFRKVGDANRHTGDEAQGTTEGIMTECGTDSPI--EHTLLQEDAECCI  282

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AYEDG ELR+LPCGHHFHC+C DKWL INATCPLCK +I+K S     EV
Sbjct  283  CLSAYEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREEV  335



>ref|XP_010553509.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X5 [Tarenaya hassleriana]
Length=398

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 121/166 (73%), Gaps = 9/166 (5%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+ S QLYW  I+FL FDVFF VFC+ LA VIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  237  GGQDLARGSPQLYWLCIVFLGFDVFFAVFCVALAFVIGIAVCCCLPCIIAVLYAVADQEG  296

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L+K+ F R        G++  G++ G+M  CG D  +   H L  +DAECCI
Sbjct  297  ASKEDIEQLTKFKFRRA-------GDDVQGNVGGIMIECGTDSPI--EHTLLQEDAECCI  347

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CL  YE+G E+R+L CGHHFHC C DKWL +N+TCPLCK +I+  S
Sbjct  348  CLSEYEEGVEVRELTCGHHFHCECVDKWLYMNSTCPLCKYNILHHS  393



>ref|XP_010553507.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Tarenaya hassleriana]
Length=399

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 121/166 (73%), Gaps = 9/166 (5%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+ S QLYW  I+FL FDVFF VFC+ LA VIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  238  GGQDLARGSPQLYWLCIVFLGFDVFFAVFCVALAFVIGIAVCCCLPCIIAVLYAVADQEG  297

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L+K+ F R        G++  G++ G+M  CG D  +   H L  +DAECCI
Sbjct  298  ASKEDIEQLTKFKFRRA-------GDDVQGNVGGIMIECGTDSPI--EHTLLQEDAECCI  348

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CL  YE+G E+R+L CGHHFHC C DKWL +N+TCPLCK +I+  S
Sbjct  349  CLSEYEEGVEVRELTCGHHFHCECVDKWLYMNSTCPLCKYNILHHS  394



>ref|XP_010553505.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Tarenaya hassleriana]
Length=413

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 121/166 (73%), Gaps = 9/166 (5%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+ S QLYW  I+FL FDVFF VFC+ LA VIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  252  GGQDLARGSPQLYWLCIVFLGFDVFFAVFCVALAFVIGIAVCCCLPCIIAVLYAVADQEG  311

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L+K+ F R        G++  G++ G+M  CG D  +   H L  +DAECCI
Sbjct  312  ASKEDIEQLTKFKFRRA-------GDDVQGNVGGIMIECGTDSPI--EHTLLQEDAECCI  362

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CL  YE+G E+R+L CGHHFHC C DKWL +N+TCPLCK +I+  S
Sbjct  363  CLSEYEEGVEVRELTCGHHFHCECVDKWLYMNSTCPLCKYNILHHS  408



>gb|KHG00725.1| hypothetical protein F383_22058 [Gossypium arboreum]
Length=381

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 129/171 (75%), Gaps = 9/171 (5%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+ S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  214  GGQALARTSPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQEG  273

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEA---HGSIAGVMTLCGVDVAMGMAHQLSVDDAE  388
            A +EDIE+LSK+ F +T    + DG+ A      + G+MT CG D      H LS DDAE
Sbjct  274  ASKEDIEQLSKFKFRKT----DDDGKSAVNVQEPVGGIMTECGTDSPR--EHVLSPDDAE  327

Query  387  CCICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYH  235
            CCICL AY+DG ELR+LPCGHHFHCAC DKWL INA CPLCK +I+K S H
Sbjct  328  CCICLSAYDDGVELRELPCGHHFHCACVDKWLHINANCPLCKYNILKSSSH  378



>ref|XP_008238809.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X1 [Prunus 
mume]
Length=383

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 131/173 (76%), Gaps = 6/173 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+ S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQDG
Sbjct  217  GGQALARASPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQDG  276

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+LSK+ F R +  E   G+   G   GVMT CG D  +   H LS DDAECCI
Sbjct  277  ASKEDIEQLSKFKF-RKVGNEKVAGDTQGG---GVMTECGTDSPI--EHVLSQDDAECCI  330

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL +Y+DG ELRQLPCGHHFHC+C DKWL INATCPLCK +I+K + H   EV
Sbjct  331  CLSSYDDGVELRQLPCGHHFHCSCIDKWLYINATCPLCKYNILKSTSHDQVEV  383



>ref|XP_008358659.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Malus 
domestica]
Length=381

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 118/164 (72%), Gaps = 3/164 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GG+ + Q+S QLYW  I FLA DV FVV C++LA ++G+ +C CLPCI+A+LY V DQ+G
Sbjct  211  GGENLTQESPQLYWICITFLALDVVFVVICVVLASLVGIAVCFCLPCIIAILYVVTDQEG  270

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +E+I+RL KY F +   F+   GE    S  GVMT C  D      H LS +DAECCI
Sbjct  271  ATKEEIDRLPKYKFRKIPDFDKVSGE-IQESFGGVMTEC--DTTTPTEHVLSPEDAECCI  327

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIK  247
            CLCAYEDG ELR+LPC HHFHC C DKWLQINATCPLCK +I+K
Sbjct  328  CLCAYEDGTELRELPCCHHFHCTCIDKWLQINATCPLCKYNILK  371



>ref|XP_008238810.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X2 [Prunus 
mume]
Length=382

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 131/173 (76%), Gaps = 6/173 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+ S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQDG
Sbjct  216  GGQALARASPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQDG  275

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+LSK+ F R +  E   G+   G   GVMT CG D  +   H LS DDAECCI
Sbjct  276  ASKEDIEQLSKFKF-RKVGNEKVAGDTQGG---GVMTECGTDSPI--EHVLSQDDAECCI  329

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL +Y+DG ELRQLPCGHHFHC+C DKWL INATCPLCK +I+K + H   EV
Sbjct  330  CLSSYDDGVELRQLPCGHHFHCSCIDKWLYINATCPLCKYNILKSTSHDQVEV  382



>emb|CDY60265.1| BnaC05g49290D [Brassica napus]
Length=359

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 134/175 (77%), Gaps = 4/175 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ+S ++YW SI+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  187  GGQELAQESPRIYWLSIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  246

Query  558  ADQEDIERLSKYTFTRTISFENGDG--EEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAEC  385
            A +EDIE+L+K+ F +     N  G  +EA G+  G+MT CG D  +   H L  +DAEC
Sbjct  247  ASKEDIEQLTKFKFRKVGGDVNKHGGDDEAQGNTEGIMTECGTDSPV--EHTLLQEDAEC  304

Query  384  CICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CICLCAYEDG+ELR+LPCGHHFHCAC DKWL INATCPLCK  I+K S     EV
Sbjct  305  CICLCAYEDGSELRELPCGHHFHCACVDKWLYINATCPLCKYDILKSSNLDGEEV  359



>ref|XP_004252582.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Solanum 
lycopersicum]
Length=354

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 119/166 (72%), Gaps = 2/166 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +  +S QLYW  I+FLAFDVFFV+F ++LAC IGLGICCC PCI+AVLY VAD+ G
Sbjct  185  GGQRIVDESPQLYWLCIVFLAFDVFFVIFLLVLACAIGLGICCCFPCIIAVLYIVADKKG  244

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +ED+E+LSKY F R    E     E  G IAG MTLCG +      H +S+DD+EC I
Sbjct  245  ATKEDVEKLSKYIFQRNDFTEKKCTSENQG-IAGFMTLCGGNTPTD-EHAVSIDDSECSI  302

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CL  Y+DG ELR+LPCGH FHC C DKWL ++ATCPLCK ++   S
Sbjct  303  CLSTYDDGDELRELPCGHLFHCPCIDKWLYMSATCPLCKRNVFGAS  348



>ref|XP_003538385.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Glycine max]
Length=387

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 129/173 (75%), Gaps = 3/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQDS QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAV DQ+G
Sbjct  218  GGQALAQDSPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVTDQEG  277

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+LSK+ F R  S E   G    G + G+MT C  D  +   H L+ +DAECCI
Sbjct  278  ASKEDIEQLSKFKFRRIESNEKLTGT-IQGPVGGIMTECQADSPI--EHALAEEDAECCI  334

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL +Y+DG ELR+LPCGHHFHC C DKWL INATCPLCK +I+K S  +  EV
Sbjct  335  CLSSYDDGVELRELPCGHHFHCVCVDKWLYINATCPLCKYNILKSSNLSQEEV  387



>ref|XP_006590532.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Glycine max]
Length=388

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 129/173 (75%), Gaps = 3/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQDS QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAV DQ+G
Sbjct  219  GGQALAQDSPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVTDQEG  278

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+LSK+ F R  S E   G    G + G+MT C  D  +   H L+ +DAECCI
Sbjct  279  ASKEDIEQLSKFKFRRIESNEKLTGT-IQGPVGGIMTECQADSPI--EHALAEEDAECCI  335

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL +Y+DG ELR+LPCGHHFHC C DKWL INATCPLCK +I+K S  +  EV
Sbjct  336  CLSSYDDGVELRELPCGHHFHCVCVDKWLYINATCPLCKYNILKSSNLSQEEV  388



>ref|XP_003517458.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Glycine 
max]
Length=385

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 130/173 (75%), Gaps = 3/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQDS QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  216  GGQALAQDSPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQEG  275

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+LSK+ F R  S E   G    G + G+MT C  D  +   H L+ +DAECCI
Sbjct  276  ASKEDIEQLSKFKFRRIESNEKLTGT-IQGPVGGIMTECQADSPI--EHVLAEEDAECCI  332

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL +Y+DG ELR+LPCGHHFHC C DKWL INATCPLCK +I+K +  +  EV
Sbjct  333  CLSSYDDGVELRELPCGHHFHCVCVDKWLYINATCPLCKYNILKSNTLSQEEV  385



>ref|XP_010933860.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Elaeis guineensis]
Length=377

 Score =   160 bits (406),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 125/173 (72%), Gaps = 3/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ + + + QLYW  I+FLAFDVFFV+FC+ LACV+G+ +CCCLPCI+A+LYAVADQ G
Sbjct  208  GGQVLTRHAPQLYWLCIVFLAFDVFFVIFCVALACVVGVAVCCCLPCIIAILYAVADQAG  267

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI +L KY F R IS          GS  G++T CG D  +   H LS +DAECCI
Sbjct  268  ASEEDIRQLPKYQF-RKISDSEKLVGGISGSFGGIITECGSDPPI--EHVLSGEDAECCI  324

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AY+DG EL +LPCGH FHCAC DKWL INATCPLCK +I+K + H   EV
Sbjct  325  CLSAYDDGVELHRLPCGHQFHCACIDKWLLINATCPLCKFNIVKSNSHGREEV  377



>ref|XP_010458710.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Camelina sativa]
Length=408

 Score =   161 bits (407),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 132/173 (76%), Gaps = 2/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ+S ++YW SI+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  238  GGQELAQESPRIYWLSIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  297

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L+K+ F +        G+EA G+  G+MT CG D  +   H L  +DAECCI
Sbjct  298  ASKEDIEQLTKFKFRKVGDANKHTGDEAQGTTEGIMTECGTDSPI--EHTLLQEDAECCI  355

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AYEDG ELR+LPCGHHFHC+C DKWL INATCPLCK +I+K S     EV
Sbjct  356  CLSAYEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREEV  408



>ref|XP_009346865.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Pyrus 
x bretschneideri]
Length=380

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 120/172 (70%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GG+ + +DS +LYW  I FLA DV FVV C+ +  +IG+ +C CLPCI+A+LY V DQ+G
Sbjct  210  GGESLIRDSPELYWICITFLALDVVFVVICVAVVSLIGIAVCFCLPCIIAILYVVTDQEG  269

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +E+I+ L KY F +   F+  +GE    S  GVMT C  D A    H LS +DAECCI
Sbjct  270  ATKEEIDHLPKYKFHKIPDFDKVNGEIQESS-GGVMTEC--DTATPTEHVLSAEDAECCI  326

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CLCAYEDG ELR+LPC HHFHC C DKWLQINATCPLCK +I+K    + GE
Sbjct  327  CLCAYEDGTELRELPCCHHFHCTCIDKWLQINATCPLCKFNILKSVSQSGGE  378



>ref|XP_010476241.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Camelina 
sativa]
Length=405

 Score =   161 bits (407),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 132/173 (76%), Gaps = 2/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ+S ++YW SI+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  235  GGQELAQESPRIYWLSIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  294

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L+K+ F +        G+EA G+  G+MT CG D  +   H L  +DAECCI
Sbjct  295  ASKEDIEQLTKFKFRKVGDANKHTGDEAQGTTEGIMTECGTDSPI--EHTLLQEDAECCI  352

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AYEDG ELR+LPCGHHFHC+C DKWL INATCPLCK +I+K S     EV
Sbjct  353  CLSAYEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREEV  405



>gb|KDO63537.1| hypothetical protein CISIN_1g020491mg [Citrus sinensis]
Length=325

 Score =   159 bits (401),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 130/173 (75%), Gaps = 4/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +A+DS  LYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ +
Sbjct  154  GGQALARDSPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQQE  213

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDIERLSK+ F R +  E    ++  GS  G+MT CG +      H LS +DAECC
Sbjct  214  GASKEDIERLSKFKFRRMVDTEKL-SDDGQGSQGGIMTECGTETPN--EHVLSNEDAECC  270

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            ICL AY+DG ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K S +   E
Sbjct  271  ICLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDRE  323



>emb|CDY26592.1| BnaA09g46850D [Brassica napus]
Length=384

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 133/173 (77%), Gaps = 2/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ+S ++YW SI+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  214  GGQELAQESPRIYWLSIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  273

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L+K+ F +        G+EA G+  G+M  CG D  +   H L  +DAECCI
Sbjct  274  ASKEDIEQLTKFKFRKVGDVNKHAGDEAQGNTDGIMIECGTDSPV--EHTLLQEDAECCI  331

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AYEDGAELR+LPCGHHFHC+C DKWL INATCPLCK++I+K S     EV
Sbjct  332  CLSAYEDGAELRELPCGHHFHCSCVDKWLYINATCPLCKHNILKSSNLDREEV  384



>ref|XP_004295567.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Fragaria 
vesca subsp. vesca]
Length=418

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 121/172 (70%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GG+ +  DS QLYW +I FLA DV FVV C+ +A +IG+ +C CLPCI+A+LY V DQ+G
Sbjct  248  GGESLTTDSPQLYWITITFLALDVVFVVICVAVASLIGIAVCFCLPCIIAILYVVTDQEG  307

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +E+I+ L KY F +   FE  +GE    S  G+MT C  D      H LS +DAECCI
Sbjct  308  ATKEEIDHLPKYKFRKISDFEKVNGEIQESS-GGIMTECDTDAPT--EHALSQEDAECCI  364

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CLCAY+DG ELR+LPC HHFHC C DKWLQINATCPLCK +I+K +  +S +
Sbjct  365  CLCAYDDGTELRELPCRHHFHCTCIDKWLQINATCPLCKFNILKSAGQSSSD  416



>ref|XP_007158469.1| hypothetical protein PHAVU_002G155000g [Phaseolus vulgaris]
 gb|ESW30463.1| hypothetical protein PHAVU_002G155000g [Phaseolus vulgaris]
Length=390

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 130/173 (75%), Gaps = 3/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ+S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  221  GGQELAQESPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQEG  280

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+LSK+ F R  S E   G    G + GVMT C  +  +   H L+ +DAECCI
Sbjct  281  ASKEDIEQLSKFKFRRIESNEKHTGT-IQGPVGGVMTECQAESPI--EHVLAEEDAECCI  337

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL +Y+DG ELR+LPCGHHFHC C DKWL INATCPLCK +I+K S  +  EV
Sbjct  338  CLSSYDDGVELRELPCGHHFHCVCVDKWLYINATCPLCKYNILKSSNISQEEV  390



>gb|KFK43535.1| hypothetical protein AALP_AA1G139400 [Arabis alpina]
Length=397

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 132/173 (76%), Gaps = 2/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A++S ++YW SI+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  227  GGQDLARESPRIYWLSIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  286

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L+K+ F +        G+EA G+  GVMT CG D  +   H L  +DAECCI
Sbjct  287  ASKEDIEQLTKFKFRKVGDVNKHAGDEAQGNTEGVMTECGTDSPV--EHTLLQEDAECCI  344

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AYEDG ELR+LPCGHHFHC+C DKWL INATCPLCK +I+K S     EV
Sbjct  345  CLSAYEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREEV  397



>ref|XP_006402511.1| hypothetical protein EUTSA_v10006041mg [Eutrema salsugineum]
 gb|ESQ43964.1| hypothetical protein EUTSA_v10006041mg [Eutrema salsugineum]
Length=374

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 121/173 (70%), Gaps = 7/173 (4%)
 Frame = -3

Query  735  GQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGA  556
             + +AQ S QLYW  + FLAFDV FVV C+ +A +IG+ +CCCLPCI+A+LYA+ADQ+GA
Sbjct  205  AEALAQASPQLYWLCVAFLAFDVIFVVICVAVASLIGIAVCCCLPCIIAILYALADQEGA  264

Query  555  DQEDIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
              E+IERLSK+ F    + E  NG+  E  G   G+MT  GVD        ++ DDAEC 
Sbjct  265  PDEEIERLSKFKFLTVKNSEKVNGEVRETQG---GIMTELGVDSQT--ERVIASDDAECS  319

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            ICLCAYEDG ELR+LPC HHFH  C DKWL+INATCPLCK +I+K   H+  E
Sbjct  320  ICLCAYEDGVELRELPCRHHFHSLCVDKWLRINATCPLCKFNILKNGEHSGSE  372



>ref|NP_001031032.1| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
 dbj|BAH20087.1| AT1G12760 [Arabidopsis thaliana]
 gb|AEE28925.1| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
Length=337

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 131/173 (76%), Gaps = 2/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ+S ++YW SI+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  167  GGQELAQESPRIYWLSIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  226

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L+K+ F +         +EA G+  G+MT CG D  +   H L  +DAECCI
Sbjct  227  ASKEDIEQLTKFKFRKLGDANKHTNDEAQGTTEGIMTECGTDSPI--EHTLLQEDAECCI  284

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AYEDG ELR+LPCGHHFHC+C DKWL INATCPLCK +I+K S     EV
Sbjct  285  CLSAYEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREEV  337



>emb|CDY16029.1| BnaC08g40940D [Brassica napus]
Length=380

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 132/173 (76%), Gaps = 2/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ+S ++YW SI+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  210  GGQDLAQESPRIYWLSIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  269

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L+K+ F +        G+EA G+  G+MT CG D  +   H L  +DAECCI
Sbjct  270  ASKEDIEQLTKFKFRKVGDVNKHAGDEAQGNADGIMTECGTDSPV--EHTLLQEDAECCI  327

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AYEDG ELR+LPCGHHFHC+C DKWL INATCPLCK +I+K S     EV
Sbjct  328  CLSAYEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDHEEV  380



>ref|XP_006477420.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Citrus sinensis]
Length=382

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 130/173 (75%), Gaps = 4/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +A+DS  LYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ +
Sbjct  211  GGQALARDSPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQQE  270

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDIERLSK+ F R +  E    ++  GS  G+MT CG +      H LS +DAECC
Sbjct  271  GASKEDIERLSKFKFRRMVDTEKL-SDDGQGSQGGIMTECGTETPN--EHVLSNEDAECC  327

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            ICL AY+DG ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K S +   E
Sbjct  328  ICLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDRE  380



>ref|XP_010053666.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Eucalyptus 
grandis]
 gb|KCW78019.1| hypothetical protein EUGRSUZ_D02250 [Eucalyptus grandis]
Length=401

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 121/172 (70%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ + +DS QLYW  I FLAFDV FVV CI +AC+IG+ ICCCLPCI+A+LYAVADQ+G
Sbjct  230  GGQDLIRDSPQLYWLCISFLAFDVVFVVICIAIACLIGIAICCCLPCIIAILYAVADQEG  289

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A QE+I +L +Y F R++   +   EE   S  G+M  C  D    +   LS +DAECCI
Sbjct  290  ATQEEINQLPRYKF-RSVGDYDKTNEETQPSSGGIMMEC--DGGTSIERALSQEDAECCI  346

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CL AYEDG+ELR+LPC HHFHC C DKWL INA CPLCK +I+K    +  E
Sbjct  347  CLSAYEDGSELRELPCRHHFHCGCIDKWLYINAICPLCKFNILKSQNQSGSE  398



>ref|XP_010494577.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Camelina 
sativa]
Length=399

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 131/173 (76%), Gaps = 2/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ+S ++YW SI+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLY VADQ+G
Sbjct  229  GGQELAQESPRIYWLSIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYVVADQEG  288

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L+K+ F +        G+EA G+  G+MT CG D  +   H L  +DAECCI
Sbjct  289  ASKEDIEQLTKFKFRKVGDANKHTGDEAQGTTEGIMTECGTDSPI--EHTLLQEDAECCI  346

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AYEDG ELR+LPCGHHFHC+C DKWL INATCPLCK +I+K S     EV
Sbjct  347  CLSAYEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREEV  399



>ref|XP_006440563.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
 gb|ESR53803.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
Length=382

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 130/173 (75%), Gaps = 4/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +A+DS  LYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ +
Sbjct  211  GGQALARDSPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQQE  270

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDIERLSK+ F R +  E    ++  GS  G+MT CG +      H LS +DAECC
Sbjct  271  GASKEDIERLSKFKFRRMVDTEKL-SDDGQGSQGGIMTECGTETPN--EHVLSNEDAECC  327

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            ICL AY+DG ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K S +   E
Sbjct  328  ICLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDRE  380



>ref|XP_006304987.1| hypothetical protein CARUB_v10009353mg [Capsella rubella]
 gb|EOA37885.1| hypothetical protein CARUB_v10009353mg [Capsella rubella]
Length=397

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 132/173 (76%), Gaps = 2/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ+S ++YW SI+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  227  GGQELAQESPRIYWLSIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  286

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L+K+ F +        G++A G+  G+MT CG D  +   H L  +DAECCI
Sbjct  287  ASKEDIEQLTKFKFRKVGDANKHTGDDAQGTTEGIMTECGTDSPI--EHTLLQEDAECCI  344

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AYEDG ELR+LPCGHHFHC+C DKWL INATCPLCK +I+K S     EV
Sbjct  345  CLSAYEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREEV  397



>gb|KJB39631.1| hypothetical protein B456_007G022500 [Gossypium raimondii]
Length=381

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 129/168 (77%), Gaps = 3/168 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ MA  S QLYW  I+FL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  214  GGQAMAGGSPQLYWLCIVFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQEG  273

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI++L KY F R I  ++    +  GSI GVMT CG D  M  A  LS DDAECCI
Sbjct  274  ASKEDIDQLPKYKF-RKIGNDDKVAGDVQGSIGGVMTECGTDSPMERA--LSEDDAECCI  330

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYH  235
            CL +Y+DG ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K S H
Sbjct  331  CLSSYDDGVELRELPCGHHFHCACVDKWLHINATCPLCKYNILKSSTH  378



>ref|XP_006477418.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Citrus sinensis]
Length=387

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 130/173 (75%), Gaps = 4/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +A+DS  LYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ +
Sbjct  216  GGQALARDSPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQQE  275

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDIERLSK+ F R +  E    ++  GS  G+MT CG +      H LS +DAECC
Sbjct  276  GASKEDIERLSKFKFRRMVDTEKL-SDDGQGSQGGIMTECGTETPN--EHVLSNEDAECC  332

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            ICL AY+DG ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K S +   E
Sbjct  333  ICLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDRE  385



>ref|XP_011023403.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Populus euphratica]
Length=378

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 120/172 (70%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            G Q  A+DS QLYW  I FLA D  FV+ CI +AC+IG+ +CC LPCI+ +LYA+ADQ+G
Sbjct  208  GRQNAAKDSPQLYWLCIAFLAADTLFVIICIAVACLIGIAVCCFLPCIIGILYAMADQEG  267

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +E+I+RL KY F R  + E  + +E+  S  G+MT C  D  +  A  LS +D ECCI
Sbjct  268  ATKEEIDRLLKYKFHRIGNCEKVN-DESQESFGGIMTECDADTPIERA--LSREDTECCI  324

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CL AYEDG+ELR+LPCGHHFHC C DKWL INATCPLCK  I+K    +  E
Sbjct  325  CLSAYEDGSELRELPCGHHFHCMCIDKWLCINATCPLCKFDILKADSQSGSE  376



>ref|XP_002301335.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE80608.1| zinc finger family protein [Populus trichocarpa]
Length=378

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 121/172 (70%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            G Q +A+DS QLYW  I FLA D  FV+ CI +AC+IG+ +CC LPCI+ +LYA+ADQ+G
Sbjct  208  GRQNVAKDSPQLYWLCIAFLAADTLFVIICIAVACLIGIAVCCFLPCIIGILYAMADQEG  267

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +E+I+RL KY F R  + E  + +E+  S  G+MT C  D  +  A  LS +D ECCI
Sbjct  268  ATKEEIDRLLKYKFHRIGNCEKVN-DESQESFGGMMTECDTDTPIERA--LSREDTECCI  324

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CL AYEDG+ELR+LPCGHHFHC C DKWL INATCPLCK  I+K    +  E
Sbjct  325  CLSAYEDGSELRELPCGHHFHCMCIDKWLCINATCPLCKFDILKADSQSGSE  376



>ref|XP_009369024.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Pyrus x bretschneideri]
Length=385

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 131/173 (76%), Gaps = 6/173 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+ S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQDG
Sbjct  219  GGQSLARASPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQDG  278

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+LSK+ F R ++ E   G+   G   GVMT CG D  +   H LS +DAECCI
Sbjct  279  ASKEDIEQLSKFKF-RKVANEKVAGDVLGG---GVMTECGTDSPI--EHVLSQEDAECCI  332

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL +Y+DG ELRQLPC HHFHC+C DKWL INATCPLCK +I+K S    GEV
Sbjct  333  CLSSYDDGVELRQLPCSHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGEV  385



>ref|XP_009369026.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X4 [Pyrus x bretschneideri]
Length=384

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 131/173 (76%), Gaps = 6/173 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+ S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQDG
Sbjct  218  GGQSLARASPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQDG  277

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+LSK+ F R ++ E   G+   G   GVMT CG D  +   H LS +DAECCI
Sbjct  278  ASKEDIEQLSKFKF-RKVANEKVAGDVLGG---GVMTECGTDSPI--EHVLSQEDAECCI  331

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL +Y+DG ELRQLPC HHFHC+C DKWL INATCPLCK +I+K S    GEV
Sbjct  332  CLSSYDDGVELRQLPCSHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGEV  384



>gb|KJB20720.1| hypothetical protein B456_003G161000 [Gossypium raimondii]
Length=381

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 128/170 (75%), Gaps = 11/170 (6%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+ S QLYW  IIFLAFDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  214  GGQALARGSPQLYWLCIIFLAFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQEG  273

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEA----HGSIAGVMTLCGVDVAMGMAHQLSVDDA  391
            A +E+I++LSK+ F +     NGD E+      G + G+M  CG D  M     LS DDA
Sbjct  274  ASKEEIDQLSKFKFQK-----NGDNEKPAGDVQGPVGGIMIECGTDSPMEQV--LSQDDA  326

Query  390  ECCICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            ECCICL AYEDG ELR+LPC HHFHCAC DKWL INATCPLCK +I+K S
Sbjct  327  ECCICLSAYEDGVELRELPCRHHFHCACVDKWLYINATCPLCKYNILKSS  376



>ref|NP_172736.2| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
 sp|Q9LN71.1|RING1_ARATH RecName: Full=E3 ubiquitin-protein ligase At1g12760; AltName: 
Full=RING finger protein At1g12760 [Arabidopsis thaliana]
 gb|AAF88088.1|AC025417_16 T12C24.29 [Arabidopsis thaliana]
 gb|AAM97036.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15598.1| unknown protein [Arabidopsis thaliana]
 gb|AAY63561.1| RING domain protein [Arabidopsis thaliana]
 gb|AEE28924.1| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
Length=408

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 131/173 (76%), Gaps = 2/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ+S ++YW SI+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  238  GGQELAQESPRIYWLSIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  297

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L+K+ F +         +EA G+  G+MT CG D  +   H L  +DAECCI
Sbjct  298  ASKEDIEQLTKFKFRKLGDANKHTNDEAQGTTEGIMTECGTDSPI--EHTLLQEDAECCI  355

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AYEDG ELR+LPCGHHFHC+C DKWL INATCPLCK +I+K S     EV
Sbjct  356  CLSAYEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREEV  408



>emb|CDX71761.1| BnaC08g31130D [Brassica napus]
Length=370

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 119/165 (72%), Gaps = 7/165 (4%)
 Frame = -3

Query  726  MAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGADQE  547
            +AQ S +LYW  + FLAFDV FVV C+ +A +IG+ +CCCLPCI+A+LYA+ADQ+GA  E
Sbjct  205  LAQSSPRLYWLCVAFLAFDVIFVVICVAVASLIGIAVCCCLPCIIAILYALADQEGAPDE  264

Query  546  DIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCICL  373
            +IERLSK+ F      E  NG+ +E  G   G+MT  GVD        +S DDAEC ICL
Sbjct  265  EIERLSKFKFLTVKDSEKVNGEVQETQG---GIMTELGVDSQTERV--ISSDDAECSICL  319

Query  372  CAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSY  238
            CAYEDGAELR+LPC HHFH  C DKWL+INATCPLCK +I+K  +
Sbjct  320  CAYEDGAELRELPCRHHFHSVCVDKWLRINATCPLCKFNILKNEH  364



>gb|KHN29414.1| E3 ubiquitin-protein ligase [Glycine soja]
Length=289

 Score =   156 bits (394),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 122/169 (72%), Gaps = 6/169 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ + +DS QLYW  I FL+FDV  V+ C+ +AC+IG+ +CCCLPCILA+LY VADQ+G
Sbjct  122  GGQSLTRDSPQLYWLCITFLSFDVMIVLICVAVACLIGIAVCCCLPCILAILYVVADQEG  181

Query  558  ADQEDIERLSKYTFTRTISFEN-GDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            A +E+IE+L KY F     F+  GD EE   S  G+MT    + A    H ++++DAECC
Sbjct  182  ATKEEIEQLPKYKFIIIKEFKKEGDIEE---SSRGIMTESESETAT--EHVIALEDAECC  236

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYH  235
            ICL AY+DGAELR+LPC HHFHC C DKWL INATCPLCK +I++   H
Sbjct  237  ICLSAYDDGAELRELPCNHHFHCTCIDKWLLINATCPLCKFNILRTGNH  285



>ref|XP_006417201.1| hypothetical protein EUTSA_v10007780mg [Eutrema salsugineum]
 gb|ESQ35554.1| hypothetical protein EUTSA_v10007780mg [Eutrema salsugineum]
Length=408

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 131/173 (76%), Gaps = 2/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ+S ++YW SI+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  238  GGQELAQESPRIYWLSIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  297

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L+K+ F +        G+EA  S  G+MT CG D  +   H L  +DAECCI
Sbjct  298  ASKEDIEQLTKFKFRKVGDVNKHAGDEAQVSTEGIMTECGTDSPV--EHTLLQEDAECCI  355

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AYEDG ELR+LPCGHHFHC+C DKWL INATCPLCK +I+K S     EV
Sbjct  356  CLSAYEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREEV  408



>ref|XP_009118057.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X1 [Brassica 
rapa]
Length=383

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 131/173 (76%), Gaps = 2/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ+S ++YW SI+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  213  GGQELAQESPRIYWLSIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  272

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L+K+ F +        G+EA G+  G+M  CG D  +   H L  +DAECCI
Sbjct  273  ASKEDIEQLTKFKFRKVGDVNKHAGDEAQGNTDGIMIECGTDSPV--EHTLLQEDAECCI  330

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AYEDG ELR+LPCGHHFHC+C DKWL INATCPLCK +I+K S     EV
Sbjct  331  CLSAYEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREEV  383



>ref|XP_008392389.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Malus domestica]
Length=385

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 130/173 (75%), Gaps = 6/173 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+ S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQDG
Sbjct  219  GGQSLARASPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQDG  278

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+LSK+ F R ++ E   G    G   GVMT CG D  +   H LS +DAECCI
Sbjct  279  ASKEDIEQLSKFKF-RKVANEKVAGNVLGG---GVMTECGTDSPI--EHVLSQEDAECCI  332

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL +Y+DG ELRQLPC HHFHC+C DKWL INATCPLCK +I+K S    GEV
Sbjct  333  CLSSYDDGVELRQLPCSHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGEV  385



>ref|XP_008392391.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X4 [Malus domestica]
Length=384

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 130/173 (75%), Gaps = 6/173 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+ S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQDG
Sbjct  218  GGQSLARASPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQDG  277

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+LSK+ F R ++ E   G    G   GVMT CG D  +   H LS +DAECCI
Sbjct  278  ASKEDIEQLSKFKF-RKVANEKVAGNVLGG---GVMTECGTDSPI--EHVLSQEDAECCI  331

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL +Y+DG ELRQLPC HHFHC+C DKWL INATCPLCK +I+K S    GEV
Sbjct  332  CLSSYDDGVELRQLPCSHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGEV  384



>ref|XP_009118058.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X2 [Brassica 
rapa]
Length=382

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 131/173 (76%), Gaps = 2/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ+S ++YW SI+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  212  GGQELAQESPRIYWLSIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  271

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L+K+ F +        G+EA G+  G+M  CG D  +   H L  +DAECCI
Sbjct  272  ASKEDIEQLTKFKFRKVGDVNKHAGDEAQGNTDGIMIECGTDSPV--EHTLLQEDAECCI  329

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AYEDG ELR+LPCGHHFHC+C DKWL INATCPLCK +I+K S     EV
Sbjct  330  CLSAYEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREEV  382



>ref|XP_009352819.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Pyrus 
x bretschneideri]
Length=381

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 119/164 (73%), Gaps = 3/164 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GG+ + ++S QLYW  I FLA DV FVV C++LA ++G+ +C CLPCI+A+LY V DQ+G
Sbjct  211  GGENLTEESPQLYWICITFLALDVVFVVICVVLASLVGIAVCFCLPCIIAILYVVTDQEG  270

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +E+I+RL KY F +   F+  +GE    S  GVMT C  D      + LS +DAECCI
Sbjct  271  ATKEEIDRLPKYKFRKIPDFDKVNGE-IQESFGGVMTEC--DTTTPTENVLSPEDAECCI  327

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIK  247
            CLCAYEDG ELR+LPC HHFHC C DKWLQINATCPLCK +I+K
Sbjct  328  CLCAYEDGIELRELPCCHHFHCTCIDKWLQINATCPLCKFNILK  371



>ref|XP_009116780.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Brassica rapa]
Length=373

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 119/165 (72%), Gaps = 7/165 (4%)
 Frame = -3

Query  726  MAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGADQE  547
            +AQ S +LYW  + FLAFDV FVV C+ +A +IG+ +CCCLPCI+A+LYA+ADQ+GA  E
Sbjct  208  LAQSSPRLYWLCVAFLAFDVIFVVICVAVASLIGIAVCCCLPCIIAILYALADQEGAPDE  267

Query  546  DIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCICL  373
            +IERLSK+ F      E  NG+ +E  G   G+MT  GVD        +S DDAEC ICL
Sbjct  268  EIERLSKFKFLTVKDSEKVNGEVQETQG---GIMTELGVDSQTERV--ISSDDAECSICL  322

Query  372  CAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSY  238
            CAYEDGAELR+LPC HHFH  C DKWL+INATCPLCK +I+K  +
Sbjct  323  CAYEDGAELRELPCRHHFHSVCVDKWLRINATCPLCKFNILKNEH  367



>emb|CDY52328.1| BnaA09g38770D [Brassica napus]
Length=373

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 119/165 (72%), Gaps = 7/165 (4%)
 Frame = -3

Query  726  MAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGADQE  547
            +AQ S +LYW  + FLAFDV FVV C+ +A +IG+ +CCCLPCI+A+LYA+ADQ+GA  E
Sbjct  208  LAQSSPRLYWLCVAFLAFDVIFVVICVAVASLIGIAVCCCLPCIIAILYALADQEGAPDE  267

Query  546  DIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCICL  373
            +IERLSK+ F      E  NG+ +E  G   G+MT  GVD        +S DDAEC ICL
Sbjct  268  EIERLSKFKFLTVKDSEKVNGEVQETQG---GIMTELGVDSQTERV--ISSDDAECSICL  322

Query  372  CAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSY  238
            CAYEDGAELR+LPC HHFH  C DKWL+INATCPLCK +I+K  +
Sbjct  323  CAYEDGAELRELPCRHHFHSVCVDKWLRINATCPLCKFNILKNEH  367



>gb|ABR17177.1| unknown [Picea sitchensis]
Length=373

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 123/174 (71%), Gaps = 5/174 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GG+ +A+D+ +LYW  I+FLAFDVFFV FC  +AC+IG+ +CCCLPCI+A+LYAVA+QDG
Sbjct  204  GGKSLAEDAPRLYWLCIVFLAFDVFFVAFCAAVACMIGIAVCCCLPCIIAILYAVANQDG  263

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTL-CGVDVAMGMAHQLSVDDAECC  382
            A + +I  L KY F R    E  + E++  S  GVMTL CG   +      L  +DAECC
Sbjct  264  ASETEINLLPKYRFCRIGPSEKNNSEKSP-SYGGVMTLICGESTS---ERVLGAEDAECC  319

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ICL AYEDG EL +LPC HHFHC C  KWL+INATCPLCK +++K   + S +V
Sbjct  320  ICLSAYEDGVELYELPCNHHFHCGCIAKWLRINATCPLCKYNVVKNDDNGSEDV  373



>gb|ABR18161.1| unknown [Picea sitchensis]
Length=373

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 123/174 (71%), Gaps = 5/174 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GG+ +A+D+ +LYW  I+FLAFDVFFV FC  +AC+IG+ +CCCLPCI+A+LYAVA+QDG
Sbjct  204  GGKSLAEDAPRLYWLCIVFLAFDVFFVAFCAAVACMIGIAVCCCLPCIIAILYAVANQDG  263

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTL-CGVDVAMGMAHQLSVDDAECC  382
            A + +I  L KY F R    E  + E++  S  GVMTL CG   +      L  +DAECC
Sbjct  264  ASETEINLLPKYRFCRIGPSEKNNSEKSP-SYGGVMTLICGESTS---ERVLGAEDAECC  319

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ICL AYEDG EL +LPC HHFHC C  KWL+INATCPLCK +++K   + S +V
Sbjct  320  ICLSAYEDGVELYELPCNHHFHCGCIAKWLRINATCPLCKYNVVKNDDNGSEDV  373



>gb|KJB25759.1| hypothetical protein B456_004G208600 [Gossypium raimondii]
 gb|KJB25760.1| hypothetical protein B456_004G208600 [Gossypium raimondii]
Length=381

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 126/168 (75%), Gaps = 3/168 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ MA+ S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  214  GGQAMARSSPQLYWLCIIFLGFDVFFVVFCVALACIIGMAVCCCLPCIIAILYAVADQEG  273

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI++LSK+ F + I  +     +    + G+MT CG D  +     L +DDAECCI
Sbjct  274  ALKEDIDQLSKFKFKK-IGSDKKSAADVQEPVGGIMTECGTDSPL--ERVLPMDDAECCI  330

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYH  235
            CL AYE+G ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K   H
Sbjct  331  CLSAYEEGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSQNH  378



>ref|XP_010553504.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Tarenaya hassleriana]
Length=414

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 121/167 (72%), Gaps = 10/167 (6%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +A+ S QLYW  I+FL FDVFF VFC+ LA VIG+ +CCCLPCI+AVLYAVADQ +
Sbjct  252  GGQDLARGSPQLYWLCIVFLGFDVFFAVFCVALAFVIGIAVCCCLPCIIAVLYAVADQQE  311

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDIE+L+K+ F R        G++  G++ G+M  CG D  +   H L  +DAECC
Sbjct  312  GASKEDIEQLTKFKFRRA-------GDDVQGNVGGIMIECGTDSPI--EHTLLQEDAECC  362

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            ICL  YE+G E+R+L CGHHFHC C DKWL +N+TCPLCK +I+  S
Sbjct  363  ICLSEYEEGVEVRELTCGHHFHCECVDKWLYMNSTCPLCKYNILHHS  409



>ref|XP_010553508.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X4 [Tarenaya hassleriana]
Length=399

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 121/167 (72%), Gaps = 10/167 (6%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +A+ S QLYW  I+FL FDVFF VFC+ LA VIG+ +CCCLPCI+AVLYAVADQ +
Sbjct  237  GGQDLARGSPQLYWLCIVFLGFDVFFAVFCVALAFVIGIAVCCCLPCIIAVLYAVADQQE  296

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDIE+L+K+ F R        G++  G++ G+M  CG D  +   H L  +DAECC
Sbjct  297  GASKEDIEQLTKFKFRRA-------GDDVQGNVGGIMIECGTDSPI--EHTLLQEDAECC  347

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            ICL  YE+G E+R+L CGHHFHC C DKWL +N+TCPLCK +I+  S
Sbjct  348  ICLSEYEEGVEVRELTCGHHFHCECVDKWLYMNSTCPLCKYNILHHS  394



>emb|CDY31275.1| BnaC08g15700D [Brassica napus]
Length=394

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 130/173 (75%), Gaps = 2/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ+S ++YW SI+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  224  GGQELAQESPRIYWLSIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  283

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L+K+ F +        G+EA  +  G+MT CG D  +   H +  +DAECCI
Sbjct  284  ASKEDIEQLTKFKFRKVGGVNKHAGDEAQANTVGIMTECGTDSPL--EHTILQEDAECCI  341

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AYEDG ELR+LPCGHHFHC C DKWL +NATCPLCK +I+K S     EV
Sbjct  342  CLSAYEDGTELRELPCGHHFHCLCVDKWLYVNATCPLCKYNILKSSNLDREEV  394



>ref|XP_008232745.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Prunus mume]
Length=365

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 120/166 (72%), Gaps = 4/166 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +  DS  LYW  + FLAFD+ FVV C+ +AC++G+ +CCCLPCI+A+LYAV DQ+G
Sbjct  196  GGQTLLCDSPHLYWLCVTFLAFDMLFVVICVAVACLVGIAVCCCLPCIIAILYAVTDQEG  255

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A  E+I+RL K+ F RT +FE  +GE A  S  G+MT C         H +S DDAECCI
Sbjct  256  ATDEEIDRLPKFKFRRTGNFEKLNGE-AQAS-EGLMTECNTHAPT--EHVISQDDAECCI  311

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CL  Y++GAELR LPC HHFHC+C DKWL INATCPLCK +I+K S
Sbjct  312  CLSVYDNGAELRGLPCHHHFHCSCIDKWLYINATCPLCKFNILKPS  357



>emb|CDY66607.1| BnaA06g38090D [Brassica napus]
Length=399

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 134/174 (77%), Gaps = 3/174 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ+S ++YW S++FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  228  GGQELAQESPRIYWLSVVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  287

Query  558  ADQEDIERLSKYTFTRTISFENGD-GEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            A +EDIE+L+K+ F +     N   G+EA G+  GVMT CG D  +   H +  +DAECC
Sbjct  288  ASKEDIEQLTKFKFRKVGGDVNKHAGDEAQGNAEGVMTECGTDSPV--EHTILQEDAECC  345

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ICLCAYEDG+ELR+LPCGHHFHC+C DKWL INATCPLCK  I+K S     EV
Sbjct  346  ICLCAYEDGSELRELPCGHHFHCSCVDKWLYINATCPLCKYDILKSSNLDREEV  399



>ref|XP_010545928.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X2 [Tarenaya hassleriana]
Length=412

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 127/166 (77%), Gaps = 2/166 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ S QLYW  I+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQDG
Sbjct  241  GGQVLAQGSPQLYWLCIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQDG  300

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L+K+ F R    +    +E  G++ GVMT CG D  +   H L  +D+ECCI
Sbjct  301  ATKEDIEQLTKFNFRRVCDTDKLASDEVQGNVGGVMTECGTDTPI--EHTLLQEDSECCI  358

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CL AYEDG ELR+LPCGHHFHC C DKWL INATCPLCK +I+K +
Sbjct  359  CLSAYEDGVELRELPCGHHFHCECVDKWLFINATCPLCKYNILKST  404



>ref|XP_010545944.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X4 [Tarenaya hassleriana]
Length=411

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 127/166 (77%), Gaps = 2/166 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ S QLYW  I+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQDG
Sbjct  240  GGQVLAQGSPQLYWLCIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQDG  299

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L+K+ F R    +    +E  G++ GVMT CG D  +   H L  +D+ECCI
Sbjct  300  ATKEDIEQLTKFNFRRVCDTDKLASDEVQGNVGGVMTECGTDTPI--EHTLLQEDSECCI  357

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CL AYEDG ELR+LPCGHHFHC C DKWL INATCPLCK +I+K +
Sbjct  358  CLSAYEDGVELRELPCGHHFHCECVDKWLFINATCPLCKYNILKST  403



>gb|KHG14407.1| hypothetical protein F383_04260 [Gossypium arboreum]
Length=381

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 128/168 (76%), Gaps = 3/168 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ MA  S QLYW  I+FL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  214  GGQAMAGGSPQLYWLCIVFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQEG  273

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI++L KY F + ++ +   G+   GS+ GVMT CG D  M     LS DDAECCI
Sbjct  274  ASKEDIDQLPKYKFRKIVNDDKVAGD-VQGSVGGVMTECGTDSPM--ERVLSEDDAECCI  330

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYH  235
            CL  Y+DG ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K S H
Sbjct  331  CLSGYDDGVELRELPCGHHFHCACVDKWLHINATCPLCKYNILKSSTH  378



>ref|XP_009148567.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Brassica rapa]
Length=400

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 134/174 (77%), Gaps = 3/174 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ+S ++YW S++FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  229  GGQELAQESPRIYWLSVVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  288

Query  558  ADQEDIERLSKYTFTRTISFENGD-GEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            A +EDIE+L+K+ F +     N   G+EA G+  GVMT CG D  +   H +  +DAECC
Sbjct  289  ASKEDIEQLTKFKFRKVGGDVNKHAGDEAQGNAEGVMTECGTDSPV--EHTILQEDAECC  346

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ICLCAYEDG+ELR+LPCGHHFHC+C DKWL INATCPLCK  I+K S     EV
Sbjct  347  ICLCAYEDGSELRELPCGHHFHCSCVDKWLYINATCPLCKYDILKSSNLDREEV  400



>gb|KHF98416.1| hypothetical protein F383_13016 [Gossypium arboreum]
Length=379

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 114/165 (69%), Gaps = 7/165 (4%)
 Frame = -3

Query  735  GQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGA  556
            GQ +   + +LYW  + FLA DV FV  C  +AC+IGL +CCCLPCI+A+LYA+ D+DGA
Sbjct  219  GQVLTHQAPKLYWLCVTFLALDVVFVFICFAVACLIGLAVCCCLPCIIAILYALTDRDGA  278

Query  555  DQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCIC  376
              E+I+RL KY F RT     GD E+ HG I  +MT    D        LS +DAECCIC
Sbjct  279  TDEEIDRLPKYRFQRT-----GDLEKVHGEIYNIMTESNTDTPT--ERILSREDAECCIC  331

Query  375  LCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            L AYEDG ELR+LPC HHFHC C DKWL INATCPLCK +I+KGS
Sbjct  332  LSAYEDGTELRELPCDHHFHCNCIDKWLYINATCPLCKFNILKGS  376



>ref|XP_010933858.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Elaeis guineensis]
Length=378

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 125/174 (72%), Gaps = 4/174 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQD-  562
            GGQ + + + QLYW  I+FLAFDVFFV+FC+ LACV+G+ +CCCLPCI+A+LYAVADQ  
Sbjct  208  GGQVLTRHAPQLYWLCIVFLAFDVFFVIFCVALACVVGVAVCCCLPCIIAILYAVADQQA  267

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDI +L KY F R IS          GS  G++T CG D  +   H LS +DAECC
Sbjct  268  GASEEDIRQLPKYQF-RKISDSEKLVGGISGSFGGIITECGSDPPI--EHVLSGEDAECC  324

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ICL AY+DG EL +LPCGH FHCAC DKWL INATCPLCK +I+K + H   EV
Sbjct  325  ICLSAYDDGVELHRLPCGHQFHCACIDKWLLINATCPLCKFNIVKSNSHGREEV  378



>emb|CDY21061.1| BnaA08g24640D [Brassica napus]
Length=324

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 130/173 (75%), Gaps = 2/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ+S ++YW SI+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  154  GGQELAQESPRIYWLSIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  213

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L+K+ F +        G++A  +  G MT CG D  +   H +  +DAECCI
Sbjct  214  ASKEDIEQLTKFKFRKVGRVNKHAGDDAQANTEGKMTECGTDSPL--EHTILQEDAECCI  271

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AYEDG ELR+LPCGHHFHC+C DKWL INATCPLCK +I+K S     EV
Sbjct  272  CLSAYEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREEV  324



>ref|XP_007220471.1| hypothetical protein PRUPE_ppa007521mg [Prunus persica]
 gb|EMJ21670.1| hypothetical protein PRUPE_ppa007521mg [Prunus persica]
Length=365

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 121/166 (73%), Gaps = 4/166 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +  DS  LYW  + FLAFD+ FVV C+ +AC++G+ +CCCLPCI+A+LYAV DQ+G
Sbjct  196  GGQTLLCDSPHLYWLCVTFLAFDMLFVVICVAVACLVGIAVCCCLPCIIAILYAVTDQEG  255

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +E+I+RL K+ F +T +FE  +GE A  S  G+MT C         H +S DDAECCI
Sbjct  256  ATEEEIDRLPKFKFRKTGNFEKLNGE-AQAS-EGLMTECNTHAPA--EHVISQDDAECCI  311

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CL  Y++GAELR LPC HHFHC+C DKWL INATCPLCK +I+K S
Sbjct  312  CLSVYDNGAELRGLPCHHHFHCSCIDKWLYINATCPLCKFNILKPS  357



>emb|CDY37062.1| BnaA04g26400D [Brassica napus]
Length=367

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 119/166 (72%), Gaps = 7/166 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            G + +AQ S QLYW  + FLAFDV F+V C+ +A +I + +CCCLPCI+AVLYA+A+Q+G
Sbjct  197  GSEELAQSSPQLYWLCVAFLAFDVIFLVLCVAVASLIAIAVCCCLPCIIAVLYALAEQEG  256

Query  558  ADQEDIERLSKYTFTRTISFENGDGE--EAHGSIAGVMTLCGVDVAMGMAHQLSVDDAEC  385
            A  E+IERL ++ F    + E  +GE  E HG   G+MT  GVD        LS D+AEC
Sbjct  257  ASDEEIERLPRFKFLTVRNSEKVNGEILETHG---GIMTQLGVDSPSERV--LSSDEAEC  311

Query  384  CICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIK  247
            C+CLC YEDG ELR+L C HHFH AC DKWL+INATCPLCK++I+K
Sbjct  312  CVCLCEYEDGTELRELWCRHHFHEACIDKWLRINATCPLCKSNILK  357



>ref|XP_007051906.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOX96063.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=389

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 119/172 (69%), Gaps = 3/172 (2%)
 Frame = -3

Query  735  GQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGA  556
            GQ + + S  LYW  + FLAFDV FV+ C  +AC+IG+ +CCCLPCI+A+LYA+ D++GA
Sbjct  221  GQALIRHSPGLYWLCVTFLAFDVVFVMICAAVACLIGIAVCCCLPCIIAILYALTDREGA  280

Query  555  DQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCIC  376
             +E+I+R  KY F R   FE  +GE    S  G+MT C  D        LS +DAECCIC
Sbjct  281  TEEEIDRWPKYKFRRVGDFEKVNGE-IQESREGIMTECNTDTPA--ERILSHEDAECCIC  337

Query  375  LCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            LCAYEDG+ELR+LPC HHFHC C DKWL INATCPLCK +I+K    +  EV
Sbjct  338  LCAYEDGSELRELPCHHHFHCTCIDKWLYINATCPLCKFNILKTCNLSGSEV  389



>ref|XP_009345444.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X2 [Pyrus 
x bretschneideri]
Length=385

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 129/173 (75%), Gaps = 6/173 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A  S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQDG
Sbjct  219  GGQSLANASPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQDG  278

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L K+ F + +  E   G+   G   GVMT CG D  +   H LS +DAECCI
Sbjct  279  ASKEDIEQLPKFKFGK-VGNEKVAGD---GQGGGVMTECGTDSPI--EHVLSQEDAECCI  332

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL +Y+DG ELRQLPCGHHFHC+C DKWL INATCPLCK +I+K S    GEV
Sbjct  333  CLSSYDDGVELRQLPCGHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGEV  385



>ref|XP_009345446.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X4 [Pyrus 
x bretschneideri]
Length=384

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 129/173 (75%), Gaps = 6/173 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A  S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQDG
Sbjct  218  GGQSLANASPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQDG  277

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L K+ F + +  E   G+   G   GVMT CG D  +   H LS +DAECCI
Sbjct  278  ASKEDIEQLPKFKFGK-VGNEKVAGD---GQGGGVMTECGTDSPI--EHVLSQEDAECCI  331

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL +Y+DG ELRQLPCGHHFHC+C DKWL INATCPLCK +I+K S    GEV
Sbjct  332  CLSSYDDGVELRQLPCGHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGEV  384



>gb|KHN24279.1| E3 ubiquitin-protein ligase [Glycine soja]
Length=184

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 120/169 (71%), Gaps = 6/169 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ + +DS QLYW  I FLAFDV  V+ C+ +AC+IG+ +CCCLPCILA+LY VAD +G
Sbjct  17   GGQSLTRDSPQLYWLCITFLAFDVVIVLICVSVACLIGIAVCCCLPCILAILYVVADPEG  76

Query  558  ADQEDIERLSKYTFTRTISFEN-GDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            A +E+I++L KY F     F+  GD EE   S  G+MT    +      H ++++DAECC
Sbjct  77   ATKEEIDQLPKYKFRIIKEFKKEGDIEE---SSRGIMT--ETESETAAEHVIALEDAECC  131

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYH  235
            ICL AY++GAELR+LPC HHFHC C DKWL INATCPLCK +I++   H
Sbjct  132  ICLSAYDNGAELRELPCNHHFHCTCIDKWLLINATCPLCKFNILRTGNH  180



>gb|KFK40526.1| hypothetical protein AALP_AA2G007300 [Arabis alpina]
Length=359

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 126/172 (73%), Gaps = 2/172 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ S QLYW  I+FL FDVFFVVFC+ LACVIG+ +C CLPCI+AVLYAVA+Q+G
Sbjct  188  GGQELAQGSPQLYWLCIVFLGFDVFFVVFCVALACVIGIAVCYCLPCIIAVLYAVAEQEG  247

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI++L+KY F +    E    +E  G   GVMT CG D  +   H L  DDAECCI
Sbjct  248  ASKEDIDQLTKYKFRKVADSEKHTVDEEEGEAGGVMTECGTDSPI--EHTLPHDDAECCI  305

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CL AYED  ELR+LPCGHHFHC C DKWL +NATCPLCK +I+K S +  GE
Sbjct  306  CLSAYEDETELRELPCGHHFHCNCVDKWLYLNATCPLCKYNILKSSNYEEGE  357



>ref|XP_011035074.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X4 [Populus euphratica]
Length=374

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 117/172 (68%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            G Q + ++S QLYW  + FLAFD  FV+ C   AC+IG+ +CCCLPCI+ +LYA+ D +G
Sbjct  204  GRQDLEENSPQLYWLCVTFLAFDALFVIICAAAACLIGIAVCCCLPCIIGILYAMTDPEG  263

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A  E+I+RL KY F R  +FE  DGE       G+MT C  D  +  A  +S +DAECCI
Sbjct  264  ATAEEIDRLPKYKFCRAEAFEKVDGENPE-ICGGMMTECDTDTPIERA--VSHEDAECCI  320

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CL AYE+G+ELR+LPC HHFHC C DKWL INATCPLCK +I+K    +  E
Sbjct  321  CLSAYENGSELRELPCNHHFHCMCIDKWLCINATCPLCKFNIVKAGNRSGNE  372



>gb|KHG00577.1| hypothetical protein F383_17805 [Gossypium arboreum]
 gb|KHG12148.1| hypothetical protein F383_00012 [Gossypium arboreum]
Length=382

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 125/166 (75%), Gaps = 3/166 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A  S QLYW  IIFLAFDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  215  GGQALAHGSPQLYWLCIIFLAFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQEG  274

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +E+I++LSK+ F +    E   G+   G + G+M  CG D  M     LS DDAECCI
Sbjct  275  ASKEEIDQLSKFKFQKIGDNEKPAGD-VQGPVGGIMIECGTDSPMEQV--LSQDDAECCI  331

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CL AYEDG ELR+LPC HHFHCAC DKWL INATCPLCK +I+K S
Sbjct  332  CLSAYEDGVELRELPCRHHFHCACVDKWLYINATCPLCKYNILKSS  377



>ref|XP_003533627.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Glycine 
max]
Length=369

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 122/169 (72%), Gaps = 6/169 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ + +DS QLYW  I FL+FDV  V+ C+ +AC+IG+ +CCCLPCILA+LY VADQ+G
Sbjct  202  GGQSLTRDSPQLYWLCITFLSFDVMIVLICVAVACLIGIAVCCCLPCILAILYVVADQEG  261

Query  558  ADQEDIERLSKYTFTRTISFEN-GDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            A +E+IE+L KY F     F+  GD EE   S  G+MT    + A    H ++++DAECC
Sbjct  262  ATKEEIEQLPKYKFIIIKEFKKEGDIEE---SSRGIMTESESETAT--EHVIALEDAECC  316

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYH  235
            ICL AY+DGAELR+LPC HHFHC C DKWL INATCPLCK +I++   H
Sbjct  317  ICLSAYDDGAELRELPCNHHFHCTCIDKWLLINATCPLCKFNILRTGNH  365



>emb|CDY27362.1| BnaC04g50430D [Brassica napus]
Length=1009

 Score =   161 bits (408),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 92/166 (55%), Positives = 119/166 (72%), Gaps = 7/166 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            G + +AQ S QLYW  + FLAFDV F+V C+ +A +I + +CCCLPCI+AVLYA+A+++G
Sbjct  839  GSEELAQSSPQLYWLCVAFLAFDVIFLVLCVAVASLIAIAVCCCLPCIIAVLYALAEREG  898

Query  558  ADQEDIERLSKYTFTRTISFENGDGE--EAHGSIAGVMTLCGVDVAMGMAHQLSVDDAEC  385
            A  E+IERL ++ F    + E  +GE  E HG   G+MT  GVD        LS D+AEC
Sbjct  899  ASDEEIERLPRFKFLTVRNSEKVNGEILETHG---GIMTQLGVDSPS--ERVLSSDEAEC  953

Query  384  CICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIK  247
            C+CLC YEDG ELR+L C HHFH AC DKWL+INATCPLCK++I+K
Sbjct  954  CVCLCEYEDGTELRELWCRHHFHEACIDKWLRINATCPLCKSNILK  999



>ref|XP_007209235.1| hypothetical protein PRUPE_ppa007012mg [Prunus persica]
 gb|EMJ10434.1| hypothetical protein PRUPE_ppa007012mg [Prunus persica]
Length=386

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 130/174 (75%), Gaps = 7/174 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +A  S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ D
Sbjct  219  GGQALAHTSPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQQD  278

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +ED+E+LSK+ F R +  E   G+   G   GVMT CG D  +   H LS DDAECC
Sbjct  279  GASKEDVEQLSKFKF-RKVGNEKVAGDTQGG---GVMTECGTDSPI--EHVLSQDDAECC  332

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ICL +Y+DG ELRQLPCGHHFHC+C DKWL INATCPLCK +I+K + H   EV
Sbjct  333  ICLSSYDDGVELRQLPCGHHFHCSCIDKWLYINATCPLCKYNILKSTSHDQVEV  386



>ref|XP_009411463.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Musa acuminata 
subsp. malaccensis]
Length=374

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 128/173 (74%), Gaps = 4/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ + +D+ QLYW  I+FLAFDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYA+ADQ+G
Sbjct  206  GGQALTRDAPQLYWLCIVFLAFDVFFVVFCVALACVIGIAVCCCLPCIIAILYAIADQEG  265

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A ++DI +LSKY F +    E  D  E  G   G+MT CG D  +     LS DDAECCI
Sbjct  266  ASEDDISQLSKYKFRKIGDSEKID--EISGPFGGIMTECGSDPPV--ERTLSADDAECCI  321

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CLC YEDG ELR+LPCGHHFHC C DKWL INATCPLCK +IIK + H   EV
Sbjct  322  CLCTYEDGVELRELPCGHHFHCGCIDKWLHINATCPLCKFNIIKNNNHGREEV  374



>ref|XP_008345901.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Malus 
domestica]
Length=380

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 117/172 (68%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GG+ + +DS QLYW  I FLA DV FVV C+ +  +IG+ +C CLPCI+A+LY V DQ+G
Sbjct  210  GGESLTRDSPQLYWICITFLALDVVFVVICVAVVSLIGIAVCFCLPCIIAILYVVTDQEG  269

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +E+I+ L KY F +   F+  +GE    S  GVMT    D      H LS +DAECCI
Sbjct  270  ATKEEIDHLPKYKFHKIPDFDKVNGEILESS-GGVMT--ESDTTTPTEHVLSAEDAECCI  326

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CLCAYEDG ELR+LPC HHFHC C DKWLQINATCPLCK +I+K    +  E
Sbjct  327  CLCAYEDGTELRELPCCHHFHCTCIDKWLQINATCPLCKFNILKSVSQSGSE  378



>ref|XP_009110629.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Brassica rapa]
Length=389

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 130/173 (75%), Gaps = 2/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ+S ++YW SI+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  219  GGQELAQESPRIYWLSIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  278

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L+K+ F +        G++A  +  G MT CG D  +   H +  +DAECCI
Sbjct  279  ASKEDIEQLTKFKFRKVGRVNKHAGDDAQANTEGKMTECGTDSPL--EHTILQEDAECCI  336

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AYEDG ELR+LPCGHHFHC+C DKWL INATCPLCK +I+K S     EV
Sbjct  337  CLSAYEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREEV  389



>ref|XP_010671755.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Beta vulgaris 
subsp. vulgaris]
Length=404

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 127/166 (77%), Gaps = 3/166 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GG  +A D+ +LYW +I FLAFDVFFVV C+++AC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  236  GGPTLADDAPKLYWLTISFLAFDVFFVVICVVVACIIGIAVCCCLPCIIAILYAVADQEG  295

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI+RL KY F R++   +    +   S  G+MT CG D  +   H LS +DAEC I
Sbjct  296  ATREDIDRLPKYKF-RSLGQTDKKSGDIQESFGGIMTQCGTDPPI--EHTLSAEDAECVI  352

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CL +YEDG++LR+LPC H+FHCAC DKWL +NATCPLCK +I+KGS
Sbjct  353  CLSSYEDGSDLRELPCQHNFHCACIDKWLHLNATCPLCKYNILKGS  398



>ref|XP_009110628.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Brassica rapa]
Length=390

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 130/173 (75%), Gaps = 2/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ+S ++YW SI+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ+G
Sbjct  220  GGQELAQESPRIYWLSIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQEG  279

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L+K+ F +        G++A  +  G MT CG D  +   H +  +DAECCI
Sbjct  280  ASKEDIEQLTKFKFRKVGRVNKHAGDDAQANTEGKMTECGTDSPL--EHTILQEDAECCI  337

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AYEDG ELR+LPCGHHFHC+C DKWL INATCPLCK +I+K S     EV
Sbjct  338  CLSAYEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREEV  390



>gb|KDP25486.1| hypothetical protein JCGZ_20642 [Jatropha curcas]
Length=389

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 130/177 (73%), Gaps = 13/177 (7%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A+ S QLYW  IIFL FDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  222  GGQALARGSPQLYWLCIIFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAILYAVADQEG  281

Query  558  ADQEDIERLSKYTFTRTISFENGDGEE----AHGSIAGVMTLCGVDVAMGMAHQLSVDDA  391
            A +EDI++LSK+ F R      GD E+    A G   G+MT C  D  +   H LS +DA
Sbjct  282  ASKEDIDQLSKFKFRRI-----GDSEKLADDAQG--GGIMTECSTDSPV--EHVLSEEDA  332

Query  390  ECCICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ECCICL AY+DG ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K S     EV
Sbjct  333  ECCICLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSRDREEV  389



>ref|XP_004515807.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Cicer 
arietinum]
Length=379

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 130/172 (76%), Gaps = 4/172 (2%)
 Frame = -3

Query  735  GQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGA  556
            GQ + QDS +LYW  I+FL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+GA
Sbjct  212  GQALIQDSPKLYWLCIVFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQEGA  271

Query  555  DQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCIC  376
             +EDIE+LSK+TF R  S E   G    G I G+MT C  D  +   H L+ +DAECCIC
Sbjct  272  TKEDIEQLSKFTFQRK-SKEKLAGN-TQGPIGGIMTECQADSPI--EHVLADEDAECCIC  327

Query  375  LCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            L AY+DG ELRQLPCGHHFHCAC DKWL INATCPLCK +I+K + H   EV
Sbjct  328  LSAYDDGVELRQLPCGHHFHCACVDKWLHINATCPLCKYNILKSTIHGQEEV  379



>ref|XP_010540663.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X2 [Tarenaya hassleriana]
Length=404

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 122/166 (73%), Gaps = 2/166 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A DS QLYW  IIFL FDVFFVVFC+ LA VIGL +CCCLPCI+A+LYAVADQ+G
Sbjct  238  GGQTLAHDSPQLYWLCIIFLGFDVFFVVFCVALAFVIGLAVCCCLPCIIAILYAVADQEG  297

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A ++DIE+L K+ F      E   G+    +  G+MT  G D  +   H LS +DAECCI
Sbjct  298  ASKDDIEQLPKFIFRSIGDDEKSSGDAQRSTARGIMTENGTDSPI--EHALSAEDAECCI  355

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CLC YEDG ELR+LPCGHHFHCAC DKWL IN+ CPLCK +I+K +
Sbjct  356  CLCDYEDGVELRELPCGHHFHCACIDKWLHINSHCPLCKFNILKNT  401



>ref|XP_009393489.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Musa acuminata 
subsp. malaccensis]
Length=384

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ + +D+ QLYW  I+FLAFDVFF++FC+ LACVIG+ +CCCLPCI+A+LYAVADQ +
Sbjct  214  GGQALTRDAPQLYWLCIVFLAFDVFFIIFCVALACVIGIAVCCCLPCIIAILYAVADQQE  273

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA  EDI +L KY F R IS     G  A   + G M  C  D  +   H LS ++ ECC
Sbjct  274  GASDEDIHQLPKYKFRR-ISNSEKLGAGAQRPVGGSMIECDTDSPI--EHVLSAENVECC  330

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ICL AY+DG ELR+LPC HHFH AC DKWL INATCPLCK +I K +     EV
Sbjct  331  ICLSAYDDGVELRELPCKHHFHRACVDKWLFINATCPLCKYNIAKITNQGGEEV  384



>ref|XP_010540680.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X4 [Tarenaya hassleriana]
Length=403

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 122/166 (73%), Gaps = 2/166 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A DS QLYW  IIFL FDVFFVVFC+ LA VIGL +CCCLPCI+A+LYAVADQ+G
Sbjct  237  GGQTLAHDSPQLYWLCIIFLGFDVFFVVFCVALAFVIGLAVCCCLPCIIAILYAVADQEG  296

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A ++DIE+L K+ F      E   G+    +  G+MT  G D  +   H LS +DAECCI
Sbjct  297  ASKDDIEQLPKFIFRSIGDDEKSSGDAQRSTARGIMTENGTDSPI--EHALSAEDAECCI  354

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CLC YEDG ELR+LPCGHHFHCAC DKWL IN+ CPLCK +I+K +
Sbjct  355  CLCDYEDGVELRELPCGHHFHCACIDKWLHINSHCPLCKFNILKNT  400



>ref|XP_009369023.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Pyrus x bretschneideri]
Length=386

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 131/174 (75%), Gaps = 7/174 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +A+ S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ D
Sbjct  219  GGQSLARASPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQQD  278

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDIE+LSK+ F R ++ E   G+   G   GVMT CG D  +   H LS +DAECC
Sbjct  279  GASKEDIEQLSKFKF-RKVANEKVAGDVLGG---GVMTECGTDSPI--EHVLSQEDAECC  332

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ICL +Y+DG ELRQLPC HHFHC+C DKWL INATCPLCK +I+K S    GEV
Sbjct  333  ICLSSYDDGVELRQLPCSHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGEV  386



>ref|XP_009369025.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Pyrus x bretschneideri]
Length=385

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 131/174 (75%), Gaps = 7/174 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +A+ S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ D
Sbjct  218  GGQSLARASPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQQD  277

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDIE+LSK+ F R ++ E   G+   G   GVMT CG D  +   H LS +DAECC
Sbjct  278  GASKEDIEQLSKFKF-RKVANEKVAGDVLGG---GVMTECGTDSPI--EHVLSQEDAECC  331

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ICL +Y+DG ELRQLPC HHFHC+C DKWL INATCPLCK +I+K S    GEV
Sbjct  332  ICLSSYDDGVELRQLPCSHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGEV  385



>ref|XP_010919263.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X1 [Elaeis 
guineensis]
Length=377

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 129/173 (75%), Gaps = 3/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ + +D+ QLYW  I+FLAFDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  208  GGQVLTRDAPQLYWLCIVFLAFDVFFVVFCVALACVIGIAVCCCLPCIIAILYAVADQEG  267

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI +L KY F +    E   GE   GS  G+M  CG +  M   H LS +DAECCI
Sbjct  268  ASEEDIRQLPKYKFCKIGESEKLAGE-ISGSFGGIMMECGSNPPM--EHALSGEDAECCI  324

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AY+DG ELRQLPCGHHFHCAC DKWL INATCPLCK +IIK S H   EV
Sbjct  325  CLSAYDDGVELRQLPCGHHFHCACIDKWLFINATCPLCKFNIIKSSNHGREEV  377



>ref|XP_011035066.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X3 [Populus euphratica]
Length=375

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 118/173 (68%), Gaps = 4/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVAD-QD  562
            G Q + ++S QLYW  + FLAFD  FV+ C   AC+IG+ +CCCLPCI+ +LYA+ D Q+
Sbjct  204  GRQDLEENSPQLYWLCVTFLAFDALFVIICAAAACLIGIAVCCCLPCIIGILYAMTDPQE  263

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA  E+I+RL KY F R  +FE  DGE       G+MT C  D  +  A  +S +DAECC
Sbjct  264  GATAEEIDRLPKYKFCRAEAFEKVDGENPE-ICGGMMTECDTDTPIERA--VSHEDAECC  320

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            ICL AYE+G+ELR+LPC HHFHC C DKWL INATCPLCK +I+K    +  E
Sbjct  321  ICLSAYENGSELRELPCNHHFHCMCIDKWLCINATCPLCKFNIVKAGNRSGNE  373



>ref|XP_008392388.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Malus domestica]
Length=386

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 130/174 (75%), Gaps = 7/174 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +A+ S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ D
Sbjct  219  GGQSLARASPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQQD  278

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDIE+LSK+ F R ++ E   G    G   GVMT CG D  +   H LS +DAECC
Sbjct  279  GASKEDIEQLSKFKF-RKVANEKVAGNVLGG---GVMTECGTDSPI--EHVLSQEDAECC  332

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ICL +Y+DG ELRQLPC HHFHC+C DKWL INATCPLCK +I+K S    GEV
Sbjct  333  ICLSSYDDGVELRQLPCSHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGEV  386



>gb|KDO86036.1| hypothetical protein CISIN_1g017405mg [Citrus sinensis]
Length=372

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 119/172 (69%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
             G+ +   S QLYW  + FLAFDV FV+ C+ +AC+IG+ +CCCLPCIL +LYA+ +++G
Sbjct  202  SGETLISCSPQLYWLCVTFLAFDVVFVMICVGVACLIGIAVCCCLPCILGILYALTEREG  261

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +E+I+RL K+ F+R    E  +GE       G+M  C  D  M M H +S DDAECCI
Sbjct  262  ATEEEIDRLPKFKFSRIDGLEKVNGE-IQEPFGGIMIECDTD--MPMEHVISEDDAECCI  318

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CL AY+DG ELR+LPC HHFHC+C DKWL IN+TCPLCK +I+K S     E
Sbjct  319  CLSAYDDGTELRELPCLHHFHCSCLDKWLYINSTCPLCKFNILKMSNERGSE  370



>ref|XP_006491024.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Citrus 
sinensis]
Length=365

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 119/172 (69%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
             G+ +   S QLYW  + FLAFDV FV+ C+ +AC+IG+ +CCCLPCIL +LYA+ +++G
Sbjct  195  SGETLISCSPQLYWLCVTFLAFDVVFVMICVGVACLIGIAVCCCLPCILGILYALTEREG  254

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +E+I+RL K+ F+R    E  +GE       G+M  C  D  M M H +S DDAECCI
Sbjct  255  ATEEEIDRLPKFKFSRIDGLEKVNGE-IQEPFGGIMIECDTD--MPMEHVISEDDAECCI  311

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CL AY+DG ELR+LPC HHFHC+C DKWL IN+TCPLCK +I+K S     E
Sbjct  312  CLSAYDDGTELRELPCLHHFHCSCLDKWLYINSTCPLCKFNILKMSNERGSE  363



>ref|XP_006445135.1| hypothetical protein CICLE_v10020664mg [Citrus clementina]
 gb|ESR58375.1| hypothetical protein CICLE_v10020664mg [Citrus clementina]
Length=372

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 119/172 (69%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
             G+ +   S QLYW  + FLAFDV FV+ C+ +AC+IG+ +CCCLPCIL +LYA+ +++G
Sbjct  202  SGETLISCSPQLYWLCVTFLAFDVVFVMICVGVACLIGIAVCCCLPCILGILYALTEREG  261

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +E+I+RL K+ F+R    E  +GE       G+M  C  D  M M H +S DDAECCI
Sbjct  262  ATEEEIDRLPKFKFSRIDGLEKVNGE-IQEPFGGIMIECDTD--MPMEHVISEDDAECCI  318

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CL AY+DG ELR+LPC HHFHC+C DKWL IN+TCPLCK +I+K S     E
Sbjct  319  CLSAYDDGTELRELPCLHHFHCSCLDKWLYINSTCPLCKFNILKMSNERGSE  370



>ref|XP_008392390.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Malus domestica]
Length=385

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 130/174 (75%), Gaps = 7/174 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +A+ S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ D
Sbjct  218  GGQSLARASPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQQD  277

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDIE+LSK+ F R ++ E   G    G   GVMT CG D  +   H LS +DAECC
Sbjct  278  GASKEDIEQLSKFKF-RKVANEKVAGNVLGG---GVMTECGTDSPI--EHVLSQEDAECC  331

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ICL +Y+DG ELRQLPC HHFHC+C DKWL INATCPLCK +I+K S    GEV
Sbjct  332  ICLSSYDDGVELRQLPCSHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGEV  385



>gb|KHG06982.1| hypothetical protein F383_33104 [Gossypium arboreum]
Length=381

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 125/168 (74%), Gaps = 3/168 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ MA+ S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  214  GGQAMARSSPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQEG  273

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI++L K+ F + I  +     +    + G+MT CG D  +     L +DDAECCI
Sbjct  274  ALKEDIDQLLKFKFKK-IGSDKKSAADVQEPVGGIMTECGTDSPL--ERVLPMDDAECCI  330

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYH  235
            CL AY++G ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K   H
Sbjct  331  CLSAYDEGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSQNH  378



>gb|KCW77597.1| hypothetical protein EUGRSUZ_D01910 [Eucalyptus grandis]
Length=329

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A D+ QLYW  IIFL FDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYAV DQ+G
Sbjct  159  GGQTLAHDAPQLYWLCIIFLGFDVFFVVFCVALACVIGIAVCCCLPCIIALLYAVTDQEG  218

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L K+ F R I        +  G + G+MT CG   +    H LS DDAECCI
Sbjct  219  ASKEDIEQLPKFKF-RKIGDSEKHISDVEGPLGGMMTECGTKES-PTGHYLSQDDAECCI  276

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AY+DG +LR+LPC HHFHC C DKWL INATCPLCK +I+K + + S EV
Sbjct  277  CLSAYDDGVDLRELPCRHHFHCTCVDKWLYINATCPLCKYNILKSTNNGSEEV  329



>gb|KCW77596.1| hypothetical protein EUGRSUZ_D01910 [Eucalyptus grandis]
Length=328

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A D+ QLYW  IIFL FDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYAV DQ+G
Sbjct  158  GGQTLAHDAPQLYWLCIIFLGFDVFFVVFCVALACVIGIAVCCCLPCIIALLYAVTDQEG  217

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L K+ F R I        +  G + G+MT CG   +    H LS DDAECCI
Sbjct  218  ASKEDIEQLPKFKF-RKIGDSEKHISDVEGPLGGMMTECGTKES-PTGHYLSQDDAECCI  275

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AY+DG +LR+LPC HHFHC C DKWL INATCPLCK +I+K + + S EV
Sbjct  276  CLSAYDDGVDLRELPCRHHFHCTCVDKWLYINATCPLCKYNILKSTNNGSEEV  328



>emb|CDY70309.1| BnaCnng67740D [Brassica napus]
Length=366

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 119/165 (72%), Gaps = 7/165 (4%)
 Frame = -3

Query  735  GQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGA  556
             + +AQ S QLYW  + FLAFDV FVV C+ +AC++G+ +CCCLPCI+AVLYA+AD++GA
Sbjct  197  AEELAQSSPQLYWLCVAFLAFDVIFVVLCVAVACLVGIAVCCCLPCIIAVLYALADREGA  256

Query  555  DQEDIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
              E+IERL K+ F    + E  NG+  E HG   G+MT  GVD        LS D+AECC
Sbjct  257  SDEEIERLPKFKFLTLKNSEKVNGEIRETHG---GIMTQLGVDSPS--ERVLSSDEAECC  311

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIK  247
            ICLC YEDG ELR+L C HHFH AC DKWL+INATCPLCK +I+K
Sbjct  312  ICLCDYEDGTELRELSCRHHFHEACIDKWLRINATCPLCKFNILK  356



>emb|CAB71048.1| putative protein [Arabidopsis thaliana]
Length=362

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 118/172 (69%), Gaps = 7/172 (4%)
 Frame = -3

Query  732  QPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGAD  553
            + +AQ S QLYW  + FLAFDV FVV C+ +A +IG+ +CCCLPCI+A+LYA+ADQ+GA 
Sbjct  194  EALAQSSPQLYWLCVAFLAFDVMFVVICVAVASLIGIAVCCCLPCIIAILYALADQEGAP  253

Query  552  QEDIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
             E+IERL K+ F    + E  NG+  E  G   G+MT  G+D        L  +DAEC I
Sbjct  254  DEEIERLLKFKFLTVKNSEKVNGEIRETQG---GIMT--GLDTESQTERMLLSEDAECSI  308

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CLCAYEDG ELR+LPC HHFH  C DKWL+INATCPLCK +I+K    +  E
Sbjct  309  CLCAYEDGVELRELPCRHHFHSLCVDKWLRINATCPLCKFNILKNGEPSGSE  360



>ref|NP_567110.1| RING/U-box superfamily protein [Arabidopsis thaliana]
 gb|AAL24312.1| putative protein [Arabidopsis thaliana]
 gb|AAL47351.1| putative protein [Arabidopsis thaliana]
 gb|AEE80168.1| RING/U-box superfamily protein [Arabidopsis thaliana]
Length=379

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 118/172 (69%), Gaps = 7/172 (4%)
 Frame = -3

Query  732  QPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGAD  553
            + +AQ S QLYW  + FLAFDV FVV C+ +A +IG+ +CCCLPCI+A+LYA+ADQ+GA 
Sbjct  211  EALAQSSPQLYWLCVAFLAFDVMFVVICVAVASLIGIAVCCCLPCIIAILYALADQEGAP  270

Query  552  QEDIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
             E+IERL K+ F    + E  NG+  E  G   G+MT  G+D        L  +DAEC I
Sbjct  271  DEEIERLLKFKFLTVKNSEKVNGEIRETQG---GIMT--GLDTESQTERMLLSEDAECSI  325

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CLCAYEDG ELR+LPC HHFH  C DKWL+INATCPLCK +I+K    +  E
Sbjct  326  CLCAYEDGVELRELPCRHHFHSLCVDKWLRINATCPLCKFNILKNGEPSGSE  377



>ref|NP_567379.1| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
 sp|Q93Z92.1|RING4_ARATH RecName: Full=E3 ubiquitin-protein ligase At4g11680; AltName: 
Full=RING finger protein At4g11680 [Arabidopsis thaliana]
 gb|AAL15343.1| AT4g11680/T5C23_110 [Arabidopsis thaliana]
 gb|AAR23720.1| At4g11680/T5C23_110 [Arabidopsis thaliana]
 gb|AAY57607.1| RING finger family protein [Arabidopsis thaliana]
 gb|AEE83038.1| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
Length=390

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 124/166 (75%), Gaps = 7/166 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ ++ DS QLYW  IIFL FDVFFVVFC+ LACVIGL +CCCLPCI+A+LYAVADQ+G
Sbjct  228  GGQTLSSDSPQLYWLCIIFLGFDVFFVVFCVALACVIGLAVCCCLPCIIAILYAVADQEG  287

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A + DI+++ K+ FT+T     G+ E+  G   G+MT CG D  +     LS +DAECCI
Sbjct  288  ASKNDIDQMPKFRFTKT-----GNVEKLSGKARGIMTECGTDSPI--ERSLSPEDAECCI  340

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CLC YEDG ELR+LPC HHFHC C DKWL IN+ CPLCK +I+K +
Sbjct  341  CLCEYEDGVELRELPCNHHFHCTCIDKWLHINSRCPLCKFNILKNA  386



>ref|XP_002320753.2| hypothetical protein POPTR_0014s07110g [Populus trichocarpa]
 gb|EEE99068.2| hypothetical protein POPTR_0014s07110g [Populus trichocarpa]
Length=375

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 118/173 (68%), Gaps = 4/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVAD-QD  562
            G Q + ++S QLYW  + FLAFD  FV+ C   AC+IG+ +CCCLPCI+ +LYA+ D Q+
Sbjct  204  GRQDLEENSPQLYWLCVTFLAFDALFVIICAAAACLIGIAVCCCLPCIIGILYAMTDPQE  263

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA  E+I+RL KY F R  +FE  DGE       G+MT C  D  +  A  +S +DAECC
Sbjct  264  GATAEEIDRLPKYKFCRAEAFEKVDGENPE-ICGGMMTECDNDTPIERA--VSHEDAECC  320

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            ICL AYE+G+ELR+LPC HHFHC C DKWL INATCPLCK +I+K    +  E
Sbjct  321  ICLSAYENGSELRELPCNHHFHCMCIDKWLCINATCPLCKFNIVKAGNRSGNE  373



>ref|XP_006391773.1| hypothetical protein EUTSA_v10023515mg [Eutrema salsugineum]
 gb|ESQ29059.1| hypothetical protein EUTSA_v10023515mg [Eutrema salsugineum]
Length=388

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 129/174 (74%), Gaps = 4/174 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ S QLYW  I+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVA+Q+G
Sbjct  215  GGQELAQGSPQLYWLCIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVAEQEG  274

Query  558  ADQEDIERLSKYTFTRTISFENG--DGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAEC  385
            A +EDI++L+K+ F +    E    D E+A G   GVMT CG D  +   H L  +DAEC
Sbjct  275  ASKEDIDQLTKFKFRKVGDSEKQSFDEEQAQGDSGGVMTECGTDSPV--EHTLPHEDAEC  332

Query  384  CICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CICL AYED  ELR+LPCGHHFHC C DKWL INATCPLCK +I+K S +  GE
Sbjct  333  CICLSAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKSSNYEDGE  386



>ref|XP_006391774.1| hypothetical protein EUTSA_v10023515mg [Eutrema salsugineum]
 gb|ESQ29060.1| hypothetical protein EUTSA_v10023515mg [Eutrema salsugineum]
Length=389

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 129/174 (74%), Gaps = 4/174 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ S QLYW  I+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVA+Q+G
Sbjct  216  GGQELAQGSPQLYWLCIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVAEQEG  275

Query  558  ADQEDIERLSKYTFTRTISFENG--DGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAEC  385
            A +EDI++L+K+ F +    E    D E+A G   GVMT CG D  +   H L  +DAEC
Sbjct  276  ASKEDIDQLTKFKFRKVGDSEKQSFDEEQAQGDSGGVMTECGTDSPV--EHTLPHEDAEC  333

Query  384  CICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CICL AYED  ELR+LPCGHHFHC C DKWL INATCPLCK +I+K S +  GE
Sbjct  334  CICLSAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKSSNYEDGE  387



>ref|XP_003611137.1| E3 ubiquitin-protein ligase [Medicago truncatula]
 gb|AES94095.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
 gb|AFK41451.1| unknown [Medicago truncatula]
Length=387

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 130/173 (75%), Gaps = 3/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQDS QLYW  I+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  218  GGQALAQDSPQLYWLCIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIALLYAVADQEG  277

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+LSK+ F +  S E    +   G + G+MT C  D  +   H L+ +DAECCI
Sbjct  278  ASKEDIEQLSKFKFRKVESNEK-QTDNNQGPVGGIMTECRADSPI--EHVLAEEDAECCI  334

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL +Y+DG ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K S     EV
Sbjct  335  CLSSYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSNLGQEEV  387



>ref|XP_004493023.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Cicer 
arietinum]
Length=355

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 118/164 (72%), Gaps = 10/164 (6%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ + ++S +LYW  I FLAFD   V+ C  +AC++G+ +CCCLPCILA+LYAVADQ+G
Sbjct  194  GGQSLTRESPRLYWLCITFLAFDFVIVLICAAVACLVGIAVCCCLPCILAILYAVADQEG  253

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +E+I++L KY F +      GD +E   S  GVMT C  D A    H ++ +DAECCI
Sbjct  254  ATKEEIDQLPKYKFKK-----EGDAQE---SSRGVMTECDSDTAS--EHVIASEDAECCI  303

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIK  247
            CL AY+DGAELR+LPC HHFHC C DKWL INATCPLCK +I+ 
Sbjct  304  CLSAYDDGAELRELPCNHHFHCTCIDKWLLINATCPLCKFNILN  347



>ref|XP_010545919.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Tarenaya hassleriana]
Length=413

 Score =   153 bits (386),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 127/167 (76%), Gaps = 3/167 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +AQ S QLYW  I+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ D
Sbjct  241  GGQVLAQGSPQLYWLCIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQQD  300

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDIE+L+K+ F R    +    +E  G++ GVMT CG D  +   H L  +D+ECC
Sbjct  301  GATKEDIEQLTKFNFRRVCDTDKLASDEVQGNVGGVMTECGTDTPI--EHTLLQEDSECC  358

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            ICL AYEDG ELR+LPCGHHFHC C DKWL INATCPLCK +I+K +
Sbjct  359  ICLSAYEDGVELRELPCGHHFHCECVDKWLFINATCPLCKYNILKST  405



>ref|XP_010545936.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X3 [Tarenaya hassleriana]
Length=412

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 127/167 (76%), Gaps = 3/167 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +AQ S QLYW  I+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVADQ D
Sbjct  240  GGQVLAQGSPQLYWLCIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQQD  299

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDIE+L+K+ F R    +    +E  G++ GVMT CG D  +   H L  +D+ECC
Sbjct  300  GATKEDIEQLTKFNFRRVCDTDKLASDEVQGNVGGVMTECGTDTPI--EHTLLQEDSECC  357

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            ICL AYEDG ELR+LPCGHHFHC C DKWL INATCPLCK +I+K +
Sbjct  358  ICLSAYEDGVELRELPCGHHFHCECVDKWLFINATCPLCKYNILKST  404



>ref|XP_011035060.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X2 [Populus euphratica]
Length=382

 Score =   152 bits (384),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 118/178 (66%), Gaps = 7/178 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            G Q + ++S QLYW  + FLAFD  FV+ C   AC+IG+ +CCCLPCI+ +LYA+ D +G
Sbjct  204  GRQDLEENSPQLYWLCVTFLAFDALFVIICAAAACLIGIAVCCCLPCIIGILYAMTDPEG  263

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAM--GMAHQ----LSVD  397
            A  E+I+RL KY F R  +FE  DGE       G+MT C  D  +   ++H+    +S  
Sbjct  264  ATAEEIDRLPKYKFCRAEAFEKVDGENPE-ICGGMMTECDTDTPIERAVSHEDAVSISTS  322

Query  396  DAECCICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            + ECCICL AYE+G+ELR+LPC HHFHC C DKWL INATCPLCK +I+K    +  E
Sbjct  323  NLECCICLSAYENGSELRELPCNHHFHCMCIDKWLCINATCPLCKFNIVKAGNRSGNE  380



>ref|XP_010053324.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Eucalyptus 
grandis]
 gb|KCW77595.1| hypothetical protein EUGRSUZ_D01910 [Eucalyptus grandis]
Length=406

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A D+ QLYW  IIFL FDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYAV DQ+G
Sbjct  236  GGQTLAHDAPQLYWLCIIFLGFDVFFVVFCVALACVIGIAVCCCLPCIIALLYAVTDQEG  295

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L K+ F R I        +  G + G+MT CG   +    H LS DDAECCI
Sbjct  296  ASKEDIEQLPKFKF-RKIGDSEKHISDVEGPLGGMMTECGTKES-PTGHYLSQDDAECCI  353

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AY+DG +LR+LPC HHFHC C DKWL INATCPLCK +I+K + + S EV
Sbjct  354  CLSAYDDGVDLRELPCRHHFHCTCVDKWLYINATCPLCKYNILKSTNNGSEEV  406



>ref|XP_009345445.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X3 [Pyrus 
x bretschneideri]
Length=385

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 129/174 (74%), Gaps = 7/174 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +A  S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ D
Sbjct  218  GGQSLANASPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQQD  277

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDIE+L K+ F + +  E   G+   G   GVMT CG D  +   H LS +DAECC
Sbjct  278  GASKEDIEQLPKFKFGK-VGNEKVAGD---GQGGGVMTECGTDSPI--EHVLSQEDAECC  331

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ICL +Y+DG ELRQLPCGHHFHC+C DKWL INATCPLCK +I+K S    GEV
Sbjct  332  ICLSSYDDGVELRQLPCGHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGEV  385



>ref|XP_009345443.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X1 [Pyrus 
x bretschneideri]
Length=386

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 129/174 (74%), Gaps = 7/174 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +A  S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ D
Sbjct  219  GGQSLANASPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQQD  278

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDIE+L K+ F + +  E   G+   G   GVMT CG D  +   H LS +DAECC
Sbjct  279  GASKEDIEQLPKFKFGK-VGNEKVAGD---GQGGGVMTECGTDSPI--EHVLSQEDAECC  332

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ICL +Y+DG ELRQLPCGHHFHC+C DKWL INATCPLCK +I+K S    GEV
Sbjct  333  ICLSSYDDGVELRQLPCGHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGEV  386



>ref|XP_009382298.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Musa acuminata 
subsp. malaccensis]
Length=374

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 124/173 (72%), Gaps = 4/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +  D+ QLYW  IIFLAFDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  206  GGQALTHDAPQLYWLCIIFLAFDVFFVVFCVALACVIGIAVCCCLPCIIAILYAVADQEG  265

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI +LSKY F +    E  D  E   S  G+M  CG D A+     L  +DA CCI
Sbjct  266  ASEEDISQLSKYKFCKIGDSEKLD--ELSSSFGGIMRECGSDPAV--ERVLPAEDAACCI  321

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL  Y+DG ELR+LPCGHHFHC C DKWL+INATCPLCK +I K + H   EV
Sbjct  322  CLSPYDDGVELRELPCGHHFHCGCIDKWLRINATCPLCKFNIAKSNNHGREEV  374



>ref|XP_006279087.1| hypothetical protein CARUB_v10012711mg [Capsella rubella]
 gb|EOA11985.1| hypothetical protein CARUB_v10012711mg [Capsella rubella]
Length=362

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 118/172 (69%), Gaps = 7/172 (4%)
 Frame = -3

Query  732  QPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGAD  553
            + +AQ S QLYW  + FLAFDV FVV C+ +A +IG+ +CCCLPCI+A+LYA+ADQ+GA 
Sbjct  194  EALAQSSPQLYWLCVAFLAFDVMFVVICVAVASLIGIAVCCCLPCIIAILYALADQEGAP  253

Query  552  QEDIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
             E+IERL K+ F    + E  NG+  E  G   G+MT  G+         LS +DAEC I
Sbjct  254  DEEIERLLKFKFLTVKNSEKVNGEIRETQG---GIMT--GLGAESQTERVLSSEDAECSI  308

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CLCAYEDG ELR+LPC HHFH  C DKWL+INATCPLCK +I+K    +  E
Sbjct  309  CLCAYEDGVELRELPCRHHFHSLCVDKWLRINATCPLCKFNILKNGEPSGSE  360



>ref|XP_008355581.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Malus domestica]
Length=385

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 125/173 (72%), Gaps = 6/173 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A  S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQDG
Sbjct  219  GGQSLANASPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQDG  278

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L K+ F +       +         GVMT CG D  +   H LS +DAECCI
Sbjct  279  ASKEDIEQLPKFKFRKV----GNEKVXGDVQGGGVMTECGTDSPI--EHVLSQEDAECCI  332

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL +Y+DG ELRQLPCGHHFHC+C DKWL INATCPLCK +I+K S    GEV
Sbjct  333  CLSSYDDGVELRQLPCGHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGEV  385



>ref|XP_008355584.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X4 [Malus domestica]
Length=384

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 125/173 (72%), Gaps = 6/173 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A  S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQDG
Sbjct  218  GGQSLANASPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQDG  277

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDIE+L K+ F +       +         GVMT CG D  +   H LS +DAECCI
Sbjct  278  ASKEDIEQLPKFKFRKV----GNEKVXGDVQGGGVMTECGTDSPI--EHVLSQEDAECCI  331

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL +Y+DG ELRQLPCGHHFHC+C DKWL INATCPLCK +I+K S    GEV
Sbjct  332  CLSSYDDGVELRQLPCGHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGEV  384



>gb|KJB20719.1| hypothetical protein B456_003G161000 [Gossypium raimondii]
Length=389

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 128/178 (72%), Gaps = 19/178 (11%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ--  565
            GGQ +A+ S QLYW  IIFLAFDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ  
Sbjct  214  GGQALARGSPQLYWLCIIFLAFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQVT  273

Query  564  ------DGADQEDIERLSKYTFTRTISFENGDGEEA----HGSIAGVMTLCGVDVAMGMA  415
                  +GA +E+I++LSK+ F +     NGD E+      G + G+M  CG D  M   
Sbjct  274  FESYLHEGASKEEIDQLSKFKFQK-----NGDNEKPAGDVQGPVGGIMIECGTDSPMEQV  328

Query  414  HQLSVDDAECCICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
              LS DDAECCICL AYEDG ELR+LPC HHFHCAC DKWL INATCPLCK +I+K S
Sbjct  329  --LSQDDAECCICLSAYEDGVELRELPCRHHFHCACVDKWLYINATCPLCKYNILKSS  384



>ref|XP_002876598.1| hypothetical protein ARALYDRAFT_486593 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52857.1| hypothetical protein ARALYDRAFT_486593 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 118/172 (69%), Gaps = 7/172 (4%)
 Frame = -3

Query  732  QPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGAD  553
            + +AQ S QLYW  + FLAFDV FVV C+ +A +IG+ +CCCLPCI+A+LYA+ADQ+GA 
Sbjct  209  EALAQSSPQLYWLCVAFLAFDVMFVVICVAVASLIGIAVCCCLPCIIAILYALADQEGAP  268

Query  552  QEDIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
             E+IERL K+ F    + E  NG+  E  G   G+MT  G+         LS +DAEC I
Sbjct  269  DEEIERLLKFKFLVVKNSEKVNGEIRETQG---GIMT--GLGAESQTERVLSSEDAECSI  323

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CLCAYEDG ELR+LPC HHFH  C DKWL+INATCPLCK +I+K    +  E
Sbjct  324  CLCAYEDGVELRELPCRHHFHSLCVDKWLRINATCPLCKFNILKNGEPSGSE  375



>ref|XP_003563155.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Brachypodium 
distachyon]
Length=359

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 126/166 (76%), Gaps = 3/166 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ ++QD+ QLYW SI+FLAFDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYAV DQ+G
Sbjct  191  GGQTLSQDAPQLYWLSIVFLAFDVFFVVFCVALACVIGIAVCCCLPCIIAILYAVTDQEG  250

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI  LSKY F RT+   +         + GVMT CG +  +   H LS +DAECCI
Sbjct  251  ASEEDINNLSKYKF-RTMGEADKLVAGIAAPVGGVMTECGTNPPV--EHILSAEDAECCI  307

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CLC YEDG ELR+LPC HHFHC C DKWL INATCPLCK +I+KG+
Sbjct  308  CLCPYEDGTELRELPCNHHFHCTCIDKWLHINATCPLCKFNIVKGN  353



>gb|ADK63393.1| C3HC4 type zinc finger protein [Brassica rapa]
Length=313

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 118/165 (72%), Gaps = 7/165 (4%)
 Frame = -3

Query  735  GQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGA  556
             + +AQ S QLYW  + FLAFDV FVV C+ +AC+IG+ +CCCLPCI+AVLYA+AD++GA
Sbjct  144  AEELAQSSPQLYWLCVAFLAFDVIFVVLCVAVACLIGIAVCCCLPCIIAVLYALADREGA  203

Query  555  DQEDIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
              E+IE+L K+ F    + E  NG+  E  G   G+MT  GVD        LS D+AECC
Sbjct  204  SDEEIEKLPKFKFLTVRNSEKVNGEIRETRG---GIMTQLGVDSPS--ERVLSSDEAECC  258

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIK  247
            ICLC YEDG ELR+L C HHFH AC DKWL+INATCPLCK +I+K
Sbjct  259  ICLCDYEDGTELRELSCRHHFHEACIDKWLRINATCPLCKFNILK  303



>ref|XP_008383660.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Malus 
domestica]
Length=381

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 116/164 (71%), Gaps = 3/164 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GG+ + Q+S QLYW  I FLA DV FVV C++LA ++G+ +C CLPCI+A+LY V DQ+G
Sbjct  211  GGENLTQESPQLYWICITFLALDVVFVVICVVLASLVGIAVCFCLPCIIAILYVVTDQEG  270

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +E+I+RL KY F +   F+   GE    S  GVMT C  D      H LS +DAECCI
Sbjct  271  ATKEEIDRLPKYKFRKIPDFDKVSGE-IQESFGGVMTEC--DTTTPTEHVLSPEDAECCI  327

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIK  247
            CLCAY+DG +L +LPC HHFH  C DKWLQINATCPLCK +I+K
Sbjct  328  CLCAYKDGTKLCELPCCHHFHGTCIDKWLQINATCPLCKXNILK  371



>ref|XP_009142362.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Brassica 
rapa]
 ref|XP_009142363.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Brassica 
rapa]
Length=367

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 117/166 (70%), Gaps = 7/166 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            G + ++Q S  LYW  + FLAFDV F+V C+ +A +I + +CCCLPCI+AVLYA+A+Q+G
Sbjct  197  GSEELSQSSPHLYWLCVAFLAFDVIFLVLCVAVASLIAIAVCCCLPCIIAVLYALAEQEG  256

Query  558  ADQEDIERLSKYTFTRTISFENGDGE--EAHGSIAGVMTLCGVDVAMGMAHQLSVDDAEC  385
            A  E+ ERL ++ F    + E  +GE  E HG   G+MT  GVD        LS D+AEC
Sbjct  257  ASDEERERLPRFKFLTVRNSEKVNGEILETHG---GIMTQLGVDSPSERV--LSSDEAEC  311

Query  384  CICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIK  247
            C+CLC YEDG ELR+L C HHFH AC DKWL+INATCPLCK++I+K
Sbjct  312  CVCLCEYEDGTELRELWCRHHFHEACIDKWLRINATCPLCKSNILK  357



>ref|XP_009401775.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=451

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 131/175 (75%), Gaps = 9/175 (5%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +  D+ QLYW  I+FLAFDVFFVVFC+ LACV+G+ +CCCLPCI+A+LYAVADQ+G
Sbjct  284  GGQELTHDAPQLYWLCIVFLAFDVFFVVFCVALACVVGIAVCCCLPCIIAILYAVADQEG  343

Query  558  ADQEDIERLSKYTFTRTISFENGDGE--EAHGSIAGVMTLCGVDVAMGMAHQLSVDDAEC  385
            A +EDI +LSKY F +      GD E  E  G   G+M  CG D  +   H LS +DAEC
Sbjct  344  ASEEDIHQLSKYKFHKV-----GDPEKLEISGPFGGIMIECGSDPPV--EHTLSAEDAEC  396

Query  384  CICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CICL  Y+DG ELR+LPCGHHFHC+C DKWL+INATCPLCK +I+K ++H + EV
Sbjct  397  CICLSPYDDGVELRELPCGHHFHCSCIDKWLRINATCPLCKFNILKSNHHGTEEV  451



>ref|XP_009143169.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Brassica rapa]
Length=364

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 118/165 (72%), Gaps = 7/165 (4%)
 Frame = -3

Query  735  GQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGA  556
             + +AQ S QLYW  + FLAFDV FVV C+ +AC+IG+ +CCCLPCI+AVLYA+AD++GA
Sbjct  195  AEELAQSSPQLYWLCVAFLAFDVIFVVLCVAVACLIGIAVCCCLPCIIAVLYALADREGA  254

Query  555  DQEDIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
              E+IE+L K+ F    + E  NG+  E  G   G+MT  GVD        LS D+AECC
Sbjct  255  SDEEIEKLPKFKFLTVRNSEKVNGEIRETRG---GIMTQLGVDSPT--ERVLSSDEAECC  309

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIK  247
            ICLC YEDG ELR+L C HHFH AC DKWL+INATCPLCK +I+K
Sbjct  310  ICLCDYEDGTELRELSCRHHFHEACIDKWLRINATCPLCKLNILK  354



>emb|CDX74763.1| BnaA05g05090D [Brassica napus]
Length=363

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 118/165 (72%), Gaps = 7/165 (4%)
 Frame = -3

Query  735  GQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGA  556
             + +AQ S QLYW  + FLAFDV FVV C+ +AC+IG+ +CCCLPCI+AVLYA+AD++GA
Sbjct  194  AEELAQSSPQLYWLCVAFLAFDVIFVVLCVAVACLIGIAVCCCLPCIIAVLYALADREGA  253

Query  555  DQEDIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
              E+IE+L K+ F    + E  NG+  E  G   G+MT  GVD        LS D+AECC
Sbjct  254  SDEEIEKLPKFKFLTVRNSEKVNGEIRETRG---GIMTQLGVDSPT--ERVLSSDEAECC  308

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIK  247
            ICLC YEDG ELR+L C HHFH AC DKWL+INATCPLCK +I+K
Sbjct  309  ICLCDYEDGTELRELSCRHHFHEACIDKWLRINATCPLCKFNILK  353



>ref|XP_011033783.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Populus euphratica]
Length=395

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 128/173 (74%), Gaps = 3/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ S QLYW  I+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYAV DQ+G
Sbjct  226  GGQALAQGSPQLYWLCIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAILYAVTDQEG  285

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI++L+K+ F R    +   G++  G   G+MT  G D  M   H LS +DAECCI
Sbjct  286  ASKEDIDQLAKFKFRRDGDIDKLTGDD-QGCFGGIMTEYGTDSPM--EHVLSGEDAECCI  342

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AYEDGAELRQLPCGHHFHC C DKWL INATCPLCK +I+K +     EV
Sbjct  343  CLSAYEDGAELRQLPCGHHFHCTCVDKWLYINATCPLCKYNILKSTSQDREEV  395



>ref|XP_011033785.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Populus euphratica]
Length=394

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 128/173 (74%), Gaps = 3/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ S QLYW  I+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYAV DQ+G
Sbjct  225  GGQALAQGSPQLYWLCIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAILYAVTDQEG  284

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI++L+K+ F R    +   G++  G   G+MT  G D  M   H LS +DAECCI
Sbjct  285  ASKEDIDQLAKFKFRRDGDIDKLTGDD-QGCFGGIMTEYGTDSPM--EHVLSGEDAECCI  341

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AYEDGAELRQLPCGHHFHC C DKWL INATCPLCK +I+K +     EV
Sbjct  342  CLSAYEDGAELRQLPCGHHFHCTCVDKWLYINATCPLCKYNILKSTSQDREEV  394



>ref|XP_002880197.1| hypothetical protein ARALYDRAFT_322232 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56456.1| hypothetical protein ARALYDRAFT_322232 [Arabidopsis lyrata subsp. 
lyrata]
Length=381

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 118/165 (72%), Gaps = 7/165 (4%)
 Frame = -3

Query  735  GQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGA  556
             + ++Q S QLYW  + FLAFDV FVV C+ +AC+IG+ +CCCLPCI+AVLYA+AD+ GA
Sbjct  212  SEELSQSSPQLYWLCVAFLAFDVIFVVLCVAVACLIGIAVCCCLPCIIAVLYALADRGGA  271

Query  555  DQEDIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
              E+IERL K+ F    + E  NG+  E HG   G+MT  GVD        LS D+AECC
Sbjct  272  SDEEIERLPKFKFLTVRNSEKVNGEIRETHG---GIMTQLGVDSPTERV--LSSDEAECC  326

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIK  247
            ICLC YEDG ELR++ C HHFH AC DKWL+INATCPLCK +I+K
Sbjct  327  ICLCDYEDGTELREMSCRHHFHEACIDKWLRINATCPLCKFNILK  371



>ref|XP_002303571.2| hypothetical protein POPTR_0003s12350g [Populus trichocarpa]
 gb|EEE78550.2| hypothetical protein POPTR_0003s12350g [Populus trichocarpa]
Length=397

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 127/173 (73%), Gaps = 3/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +A  S QLYW  I+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYAV DQ+G
Sbjct  228  GGQALALGSPQLYWLCIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAILYAVTDQEG  287

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI++L+K+ F R    +   G++  G   G+MT CG D  M   H LS +DAECCI
Sbjct  288  ASKEDIDQLAKFKFRRDGDIDKLTGDD-QGCSGGIMTECGTDSPM--EHVLSGEDAECCI  344

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AYEDGAELRQLPCGHHFHC C DKWL INATCPLCK  I+K +     EV
Sbjct  345  CLSAYEDGAELRQLPCGHHFHCTCVDKWLYINATCPLCKYDILKSTSQDREEV  397



>ref|XP_011035055.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Populus euphratica]
Length=383

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 119/179 (66%), Gaps = 8/179 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVAD-QD  562
            G Q + ++S QLYW  + FLAFD  FV+ C   AC+IG+ +CCCLPCI+ +LYA+ D Q+
Sbjct  204  GRQDLEENSPQLYWLCVTFLAFDALFVIICAAAACLIGIAVCCCLPCIIGILYAMTDPQE  263

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAM--GMAHQ----LSV  400
            GA  E+I+RL KY F R  +FE  DGE       G+MT C  D  +   ++H+    +S 
Sbjct  264  GATAEEIDRLPKYKFCRAEAFEKVDGENPE-ICGGMMTECDTDTPIERAVSHEDAVSIST  322

Query  399  DDAECCICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
             + ECCICL AYE+G+ELR+LPC HHFHC C DKWL INATCPLCK +I+K    +  E
Sbjct  323  SNLECCICLSAYENGSELRELPCNHHFHCMCIDKWLCINATCPLCKFNIVKAGNRSGNE  381



>ref|XP_010540654.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X1 [Tarenaya hassleriana]
Length=405

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 122/167 (73%), Gaps = 3/167 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +A DS QLYW  IIFL FDVFFVVFC+ LA VIGL +CCCLPCI+A+LYAVADQ +
Sbjct  238  GGQTLAHDSPQLYWLCIIFLGFDVFFVVFCVALAFVIGLAVCCCLPCIIAILYAVADQQE  297

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA ++DIE+L K+ F      E   G+    +  G+MT  G D  +   H LS +DAECC
Sbjct  298  GASKDDIEQLPKFIFRSIGDDEKSSGDAQRSTARGIMTENGTDSPI--EHALSAEDAECC  355

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            ICLC YEDG ELR+LPCGHHFHCAC DKWL IN+ CPLCK +I+K +
Sbjct  356  ICLCDYEDGVELRELPCGHHFHCACIDKWLHINSHCPLCKFNILKNT  402



>ref|XP_010540671.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X3 [Tarenaya hassleriana]
Length=404

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 122/167 (73%), Gaps = 3/167 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +A DS QLYW  IIFL FDVFFVVFC+ LA VIGL +CCCLPCI+A+LYAVADQ +
Sbjct  237  GGQTLAHDSPQLYWLCIIFLGFDVFFVVFCVALAFVIGLAVCCCLPCIIAILYAVADQQE  296

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA ++DIE+L K+ F      E   G+    +  G+MT  G D  +   H LS +DAECC
Sbjct  297  GASKDDIEQLPKFIFRSIGDDEKSSGDAQRSTARGIMTENGTDSPI--EHALSAEDAECC  354

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            ICLC YEDG ELR+LPCGHHFHCAC DKWL IN+ CPLCK +I+K +
Sbjct  355  ICLCDYEDGVELRELPCGHHFHCACIDKWLHINSHCPLCKFNILKNT  401



>gb|KJB41239.1| hypothetical protein B456_007G096300 [Gossypium raimondii]
Length=379

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 112/165 (68%), Gaps = 7/165 (4%)
 Frame = -3

Query  735  GQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGA  556
            GQ +   + +LYW  + FLA DV FV  C+ +AC+IGL +CCCLPCI+A+LYA+ D+DGA
Sbjct  219  GQVLTHQAPKLYWLCVTFLALDVVFVFICVAVACLIGLAVCCCLPCIIAILYALTDRDGA  278

Query  555  DQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCIC  376
              E+I+RL KY F RT   E  DGE     I  +MT    D        LS +DAECCIC
Sbjct  279  TDEEIDRLPKYRFQRTADLEKVDGE-----IYNIMTESNTDTPT--ERILSREDAECCIC  331

Query  375  LCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            L AYEDG ELR+LPC HHFHC C DKWL INATCPLCK +I+K S
Sbjct  332  LSAYEDGTELRELPCHHHFHCNCIDKWLYINATCPLCKFNILKVS  376



>ref|XP_010919264.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X2 [Elaeis 
guineensis]
Length=378

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 129/174 (74%), Gaps = 4/174 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ + +D+ QLYW  I+FLAFDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYAVADQ +
Sbjct  208  GGQVLTRDAPQLYWLCIVFLAFDVFFVVFCVALACVIGIAVCCCLPCIIAILYAVADQQE  267

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDI +L KY F +    E   GE   GS  G+M  CG +  M   H LS +DAECC
Sbjct  268  GASEEDIRQLPKYKFCKIGESEKLAGE-ISGSFGGIMMECGSNPPM--EHALSGEDAECC  324

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ICL AY+DG ELRQLPCGHHFHCAC DKWL INATCPLCK +IIK S H   EV
Sbjct  325  ICLSAYDDGVELRQLPCGHHFHCACIDKWLFINATCPLCKFNIIKSSNHGREEV  378



>ref|XP_006857849.1| hypothetical protein AMTR_s00069p00064990 [Amborella trichopoda]
 gb|ERN19316.1| hypothetical protein AMTR_s00069p00064990 [Amborella trichopoda]
Length=383

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 126/180 (70%), Gaps = 9/180 (5%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +  D+ QLYW  +IFLAFDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  206  GGQALTHDAPQLYWLCVIFLAFDVFFVVFCVALACVIGIAVCCCLPCIIAILYAVADQEG  265

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDA----  391
            A +EDI +L KY F      E  D E+   S  G+MT CG ++   +   LS ++A    
Sbjct  266  ASEEDIRQLPKYKFRSVADIEKFDIEKC-DSFGGIMTACGGEMP-PIERALSAENASPCD  323

Query  390  ---ECCICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
               ECCICL  YEDG +LR+LPC HHFHCAC DKWL INATCPLCK +IIK S H   EV
Sbjct  324  LLQECCICLSPYEDGVDLRELPCSHHFHCACIDKWLHINATCPLCKFNIIKSSNHAREEV  383



>gb|ADK63418.1| C3HC4 type zinc finger protein [Brassica rapa]
Length=363

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 118/165 (72%), Gaps = 7/165 (4%)
 Frame = -3

Query  735  GQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGA  556
             + +AQ S QLYW  + FLAFDV FVV C+ +AC+IG+ +CCCLPCI+AVLYA+AD++GA
Sbjct  194  AEELAQSSPQLYWLCVAFLAFDVIFVVLCVAVACLIGIAVCCCLPCIIAVLYALADREGA  253

Query  555  DQEDIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
              E+IE+L K+ F    + E  NG+  E  G   G+MT  GVD        LS D+AECC
Sbjct  254  SDEEIEKLPKFKFLTVRNSEKVNGEIRETRG---GIMTQLGVD--FPSERVLSSDEAECC  308

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIK  247
            ICLC YEDG ELR+L C HHFH AC DKWL+INATCPLCK +I+K
Sbjct  309  ICLCDYEDGTELRELFCRHHFHEACIDKWLRINATCPLCKFNILK  353



>ref|NP_564810.1| zinc finger, C3HC4 type (RING finger) family protein [Arabidopsis 
thaliana]
 sp|Q8LDB8.2|RING2_ARATH RecName: Full=E3 ubiquitin-protein ligase At1g63170; AltName: 
Full=RING finger protein At1g63170 [Arabidopsis thaliana]
 gb|AAG51597.1|AC010795_1 hypothetical protein; 76801-78300 [Arabidopsis thaliana]
 gb|AEE34064.1| zinc finger, C3HC4 type (RING finger) family protein [Arabidopsis 
thaliana]
Length=381

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 127/174 (73%), Gaps = 4/174 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ S QLYW  I+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVA+Q+G
Sbjct  208  GGQELAQGSPQLYWLCIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVAEQEG  267

Query  558  ADQEDIERLSKYTFTRT--ISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAEC  385
            A +EDI++L+K+ F +         D E+  G   GVMT CG D  +   H L  +DAEC
Sbjct  268  ASKEDIDQLTKFKFRKVGDTMKHTVDEEQGQGDSGGVMTECGTDSPV--EHALPHEDAEC  325

Query  384  CICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CICL AYED  ELR+LPCGHHFHC C DKWL INATCPLCK +I+K S +  GE
Sbjct  326  CICLSAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKSSNYEEGE  379



>gb|AAM63303.1| unknown [Arabidopsis thaliana]
Length=381

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 127/174 (73%), Gaps = 4/174 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ S QLYW  I+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVA+Q+G
Sbjct  208  GGQELAQGSPQLYWLCIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVAEQEG  267

Query  558  ADQEDIERLSKYTFTRT--ISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAEC  385
            A +EDI++L+K+ F +         D E+  G   GVMT CG D  +   H L  +DAEC
Sbjct  268  ASKEDIDQLTKFKFRKVGDTMKHTVDEEQGEGDSGGVMTECGTDSPV--EHALPHEDAEC  325

Query  384  CICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CICL AYED  ELR+LPCGHHFHC C DKWL INATCPLCK +I+K S +  GE
Sbjct  326  CICLSAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKSSNYEEGE  379



>ref|XP_002887973.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64232.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=373

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 126/172 (73%), Gaps = 2/172 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ S QLYW  I+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVA+Q+G
Sbjct  202  GGQELAQGSPQLYWLCIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVAEQEG  261

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI++L+K+ F +         +E  G   G+MT CG D  +   H L  +DAECCI
Sbjct  262  ASKEDIDQLTKFKFRKVGDSVKHTVDEEQGDSGGLMTECGTDSPV--EHTLPHEDAECCI  319

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CL AYED  ELR+LPCGHHFHC C DKWL INATCPLCK +I+K S +  GE
Sbjct  320  CLSAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKSSNYEEGE  371



>ref|XP_010422123.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Camelina 
sativa]
Length=391

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 123/166 (74%), Gaps = 11/166 (7%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ ++ DS QLYW  IIFL FDVFFVVFC+ LACVIGL ICCCLPCI+A+LYAVADQ+G
Sbjct  233  GGQTLSGDSPQLYWLCIIFLGFDVFFVVFCVALACVIGLAICCCLPCIIAILYAVADQEG  292

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A + DIE++ K+ F ++ S E          ++G+MT CG D  +   H LS +DAECCI
Sbjct  293  ASKNDIEQMPKFRFRKSSSDEK---------LSGIMTECGTDSPI--EHSLSPEDAECCI  341

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CLC YEDG ELR+LPC HHFHC C DKWL IN+ CPLCK +I+K +
Sbjct  342  CLCEYEDGVELRELPCNHHFHCTCIDKWLHINSRCPLCKFNILKNA  387



>ref|XP_010092737.1| E3 ubiquitin-protein ligase [Morus notabilis]
 gb|EXB52082.1| E3 ubiquitin-protein ligase [Morus notabilis]
Length=393

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 117/173 (68%), Gaps = 2/173 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GG+ +  DS  +YW  I FLAFDV FV+ C+ +AC++G+ +CCCLPCI+A+L AV DQ+G
Sbjct  202  GGETLTHDSPLIYWLCITFLAFDVVFVLICVAVACIVGIAVCCCLPCIIAILCAVTDQEG  261

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQ-LSVDDAECC  382
            A +E+I+ L  + F    + E   GE    S  G+M  C +D       + L  +DAECC
Sbjct  262  ATKEEIDNLPMFKFCAVSNSEKVSGE-IQESFRGIMVECNIDSRHSSTKRPLFEEDAECC  320

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            ICL AY+DG ELR+LPCGHHFHC C DKWL INATCPLCK +I+K S  +S E
Sbjct  321  ICLSAYDDGTELRELPCGHHFHCTCIDKWLHINATCPLCKFNILKASNQSSSE  373



>ref|XP_004147971.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Cucumis 
sativus]
 gb|KGN55952.1| hypothetical protein Csa_3G038740 [Cucumis sativus]
Length=383

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 124/173 (72%), Gaps = 3/173 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ S  LYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  214  GGQSLAQASPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQEG  273

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +ED+E+LSK+ F R +        +    + GVM+ C  D  +     L  +DAECCI
Sbjct  274  ATKEDVEQLSKFKF-RKVENTEKFSTDVQEPLGGVMSECCTDSPI--ERPLLQEDAECCI  330

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CL AYEDG ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K S     EV
Sbjct  331  CLSAYEDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKNSNLAQEEV  383



>ref|XP_010434567.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Camelina 
sativa]
Length=391

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 123/166 (74%), Gaps = 11/166 (7%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ ++ DS QLYW  IIFL FDVFFVVFC+ LACVIGL +CCCLPCI+A+LYAVADQ+G
Sbjct  233  GGQTLSADSPQLYWLCIIFLGFDVFFVVFCVALACVIGLAVCCCLPCIIAILYAVADQEG  292

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A + DIE++ K+ F ++ + E          ++G+MT CG D  +   H LS +DAECCI
Sbjct  293  ASKNDIEQMPKFRFRKSSNDEK---------LSGIMTECGTDSPI--EHSLSPEDAECCI  341

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CLC YEDG ELR+LPC HHFHC C DKWL IN+ CPLCK +I+K +
Sbjct  342  CLCEYEDGVELRELPCNHHFHCTCIDKWLHINSRCPLCKFNILKNA  387



>ref|XP_010544693.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X2 [Tarenaya 
hassleriana]
Length=375

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 117/169 (69%), Gaps = 7/169 (4%)
 Frame = -3

Query  732  QPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGAD  553
            + ++Q S  LYW  + FLAFDV FVV C+ +AC+IG+ +CCCLPCI+A+LYA+AD++GA 
Sbjct  209  ETLSQSSPLLYWLCVAFLAFDVIFVVICVAVACLIGIAVCCCLPCIIAILYALADREGAT  268

Query  552  QEDIERLSKYTF--TRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
             E+IER+ K+ F   R     NG+  E  G   G+MT  GVD        L  DDAECCI
Sbjct  269  DEEIERIPKFKFLVVRNSEKVNGEIRETQG---GIMTELGVDSPTERV--LPSDDAECCI  323

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHT  232
            CLC YEDGAELR+L C HHFH  C DKWL+INATCPLCK ++IK   H+
Sbjct  324  CLCPYEDGAELRELSCRHHFHSHCIDKWLRINATCPLCKFNVIKTGDHS  372



>ref|XP_010544692.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X1 [Tarenaya 
hassleriana]
Length=379

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 117/169 (69%), Gaps = 7/169 (4%)
 Frame = -3

Query  732  QPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGAD  553
            + ++Q S  LYW  + FLAFDV FVV C+ +AC+IG+ +CCCLPCI+A+LYA+AD++GA 
Sbjct  213  ETLSQSSPLLYWLCVAFLAFDVIFVVICVAVACLIGIAVCCCLPCIIAILYALADREGAT  272

Query  552  QEDIERLSKYTF--TRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
             E+IER+ K+ F   R     NG+  E  G   G+MT  GVD        L  DDAECCI
Sbjct  273  DEEIERIPKFKFLVVRNSEKVNGEIRETQG---GIMTELGVDSPTERV--LPSDDAECCI  327

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHT  232
            CLC YEDGAELR+L C HHFH  C DKWL+INATCPLCK ++IK   H+
Sbjct  328  CLCPYEDGAELRELSCRHHFHSHCIDKWLRINATCPLCKFNVIKTGDHS  376



>ref|XP_006302394.1| hypothetical protein CARUB_v10020462mg [Capsella rubella]
 gb|EOA35292.1| hypothetical protein CARUB_v10020462mg [Capsella rubella]
Length=382

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 129/175 (74%), Gaps = 5/175 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ S QLYW  I+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVA+Q+G
Sbjct  208  GGQELAQGSPQLYWLCIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVAEQEG  267

Query  558  ADQEDIERLSKYTFTRT--ISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAEC  385
            A +EDI++L+K+ F +         D E+A G   GVMT CG D  +   H L  DDAEC
Sbjct  268  ASKEDIDQLTKFKFRKVGDSVKHTVDEEQAQGDSGGVMTECGTDSPI--EHTLPHDDAEC  325

Query  384  CICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIK-GSYHTSGE  223
            CICL AYED  ELR+LPCGHHFHC C DKWL INATCPLCK +I+K G+Y  + E
Sbjct  326  CICLSAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKNGNYEGADE  380



>ref|XP_008448958.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Cucumis 
melo]
Length=383

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 126/175 (72%), Gaps = 7/175 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ S  LYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ+G
Sbjct  214  GGQSLAQASPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQEG  273

Query  558  ADQEDIERLSKYTFTRTISFENGD--GEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAEC  385
            A +ED+E+LSK+ F +    EN +    +    + G+M+ C  D  +     L  +DAEC
Sbjct  274  ATKEDVEQLSKFKFRKV---ENAEKFSSDVQEPLGGIMSECCTDSPI--ERPLLQEDAEC  328

Query  384  CICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CICL AYEDG ELR+LPCGHHFHCAC DKWL INATCPLCK +I+K S     EV
Sbjct  329  CICLSAYEDGVELRELPCGHHFHCACVDKWLYINATCPLCKFNILKNSNLAQEEV  383



>ref|XP_003552356.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Glycine 
max]
Length=375

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 120/169 (71%), Gaps = 6/169 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ + +DS QLYW  I FLAFDV  V+ C+ +AC+IG+ +CCCLPCILA+LY VAD +G
Sbjct  208  GGQSLTRDSPQLYWLCITFLAFDVVIVLICVSVACLIGIAVCCCLPCILAILYVVADPEG  267

Query  558  ADQEDIERLSKYTFTRTISFEN-GDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            A +E+I++L KY F     F+  GD EE   S  G+MT    + A    H ++++DAECC
Sbjct  268  ATKEEIDQLPKYKFRIIKEFKKEGDIEE---SSRGIMTETESETAA--EHVIALEDAECC  322

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYH  235
            ICL AY++ AELR+LPC HHFHC C DKWL INATCPLCK +I++   H
Sbjct  323  ICLSAYDNDAELRELPCNHHFHCTCIDKWLLINATCPLCKFNILRTGNH  371



>ref|XP_010413448.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
Length=359

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 115/170 (68%), Gaps = 7/170 (4%)
 Frame = -3

Query  726  MAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGADQE  547
            + Q S QLYW  + FLAFDV FVV C+ +A +IG+ +CCCLPCI+A+LYA+ADQ+GA  E
Sbjct  193  LPQSSPQLYWLCVAFLAFDVMFVVICVAVASLIGIAVCCCLPCIIAILYALADQEGAADE  252

Query  546  DIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCICL  373
            +I+RL K+ F    + E  NG+  E  G   G+MT  G+         LS +DAEC ICL
Sbjct  253  EIDRLLKFKFLTVKNSEKVNGEIRETQG---GIMT--GLGAESQTERMLSSEDAECSICL  307

Query  372  CAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            C YEDG ELR+LPC HHFH  C DKWL+INATCPLCK +I+K    +  E
Sbjct  308  CGYEDGVELRELPCRHHFHSLCVDKWLRINATCPLCKFNILKNGEPSGSE  357



>ref|NP_001059583.1| Os07g0463400 [Oryza sativa Japonica Group]
 dbj|BAC79657.1| putative RES protein [Oryza sativa Japonica Group]
 dbj|BAF21497.1| Os07g0463400 [Oryza sativa Japonica Group]
 gb|EAZ39717.1| hypothetical protein OsJ_24155 [Oryza sativa Japonica Group]
 dbj|BAG90507.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 129/170 (76%), Gaps = 11/170 (6%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ ++ D+ QLYW SI+FLAFDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYAV DQ+G
Sbjct  193  GGQALSHDAPQLYWLSIVFLAFDVFFVVFCVALACVIGIAVCCCLPCIIAILYAVTDQEG  252

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIA----GVMTLCGVDVAMGMAHQLSVDDA  391
            A +EDI  LSK+ F RT+    GD ++    IA    GVMT CG +  +   H LS +DA
Sbjct  253  ASEEDINNLSKFKF-RTM----GDADKLVAGIAAPVGGVMTECGTNPPV--EHFLSAEDA  305

Query  390  ECCICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            ECCICLC YEDGAELR+LPC HHFHC C DKWL INATCPLCK +IIK +
Sbjct  306  ECCICLCPYEDGAELRELPCNHHFHCTCIDKWLHINATCPLCKFNIIKSN  355



>gb|EEC81984.1| hypothetical protein OsI_25906 [Oryza sativa Indica Group]
Length=361

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 129/170 (76%), Gaps = 11/170 (6%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ ++ D+ QLYW SI+FLAFDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYAV DQ+G
Sbjct  193  GGQALSHDAPQLYWLSIVFLAFDVFFVVFCVALACVIGIAVCCCLPCIIAILYAVTDQEG  252

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIA----GVMTLCGVDVAMGMAHQLSVDDA  391
            A +EDI  LSK+ F RT+    GD ++    IA    GVMT CG +  +   H LS +DA
Sbjct  253  ASEEDINNLSKFKF-RTM----GDADKLVAGIAAPVGGVMTECGTNPPV--EHFLSAEDA  305

Query  390  ECCICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            ECCICLC YEDGAELR+LPC HHFHC C DKWL INATCPLCK +IIK +
Sbjct  306  ECCICLCPYEDGAELRELPCNHHFHCTCIDKWLHINATCPLCKFNIIKSN  355



>ref|XP_006294289.1| hypothetical protein CARUB_v10023298mg, partial [Capsella rubella]
 gb|EOA27187.1| hypothetical protein CARUB_v10023298mg, partial [Capsella rubella]
Length=417

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 118/165 (72%), Gaps = 7/165 (4%)
 Frame = -3

Query  735  GQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGA  556
             + +A  S +LYW  + FLAFDV FVV C+ +AC+IG+ +CCCLPCI+AVLYA+AD++GA
Sbjct  248  SEELAHSSPKLYWLCVAFLAFDVIFVVLCVAVACLIGIAVCCCLPCIIAVLYALADREGA  307

Query  555  DQEDIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
              E+IERL K+ F    + E  NG+  E+HG   G+MT   VD        LS D+AECC
Sbjct  308  SDEEIERLPKFKFLTVRNSEKVNGEIRESHG---GIMTQLSVDSPSERV--LSSDEAECC  362

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIK  247
            ICLC YEDG ELR+L C HHFH AC DKWL+INATCPLCK +I+K
Sbjct  363  ICLCDYEDGTELRELSCRHHFHEACIDKWLRINATCPLCKFNILK  407



>ref|XP_007139958.1| hypothetical protein PHAVU_008G073000g [Phaseolus vulgaris]
 gb|ESW11952.1| hypothetical protein PHAVU_008G073000g [Phaseolus vulgaris]
Length=363

 Score =   147 bits (370),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 120/168 (71%), Gaps = 8/168 (5%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +  D+ QLYW  I FL+FDV  V+ C+ +AC+IG+ +CCCLPCILA+LYAV DQ+G
Sbjct  201  GGQSLTTDAPQLYWVCIAFLSFDVLIVLICVAVACLIGIAVCCCLPCILALLYAVTDQEG  260

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +E+I++L KY F R I  + GD EE      G+MT    + A    H ++++DAECCI
Sbjct  261  ATKEEIDQLPKYKF-RII--KEGDIEEPS---RGIMTESESETATD--HVVALEDAECCI  312

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYH  235
            CL  Y+DGAELR+LPC HHFH  C DKWL INATCPLCK  I+ GS+H
Sbjct  313  CLSPYDDGAELRELPCNHHFHRTCIDKWLLINATCPLCKLDILIGSHH  360



>gb|KFK31927.1| hypothetical protein AALP_AA6G177200 [Arabis alpina]
Length=389

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 122/166 (73%), Gaps = 5/166 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ ++ D+ QLYW  IIFL FDVFFVVFC+ LACVIGL +CCCLPCI+A+LYAVADQ+G
Sbjct  226  GGQTLSNDAPQLYWLCIIFLGFDVFFVVFCVALACVIGLAVCCCLPCIIAILYAVADQEG  285

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A + DI+++ K+ F +  + E   GE    S  G MT CG D  +     LS +DAECCI
Sbjct  286  ASKNDIDQMPKFRFKKLGNDEKLPGE---ASNRGTMTECGTDSPI--ERSLSPEDAECCI  340

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CLC YEDGAELR+LPC HHFHC C DKWL IN+ CPLCK +I+K +
Sbjct  341  CLCEYEDGAELRELPCNHHFHCTCIDKWLHINSRCPLCKFNILKNT  386



>ref|XP_004956145.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Setaria italica]
Length=352

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 126/166 (76%), Gaps = 3/166 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ ++ D+ QLYW SI+FLAFDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYAV DQ+G
Sbjct  184  GGQALSHDAPQLYWLSIVFLAFDVFFVVFCVALACVIGIAVCCCLPCIIAILYAVTDQEG  243

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A +EDI  LSK+ F RT+   +         + GVMT CG +  +   H LS +DAECCI
Sbjct  244  ASEEDINNLSKFKF-RTMGDHDKLVAGIAAPVGGVMTECGTNPPV--EHILSAEDAECCI  300

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CLC YEDGAELR+LPC HHFHC+C DKWL INATCPLCK +I+K +
Sbjct  301  CLCPYEDGAELRELPCNHHFHCSCIDKWLHINATCPLCKFNIVKSN  346



>ref|XP_010430403.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Camelina sativa]
Length=383

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 132/175 (75%), Gaps = 5/175 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ S QLYW  I+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVA+Q+G
Sbjct  209  GGQELAQGSPQLYWLCIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVAEQEG  268

Query  558  ADQEDIERLSKYTFTRT-ISFENG-DGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAEC  385
            A +EDI++L+K+ F +   S ++  D E+A G   GVMT CG D  +   H L  +DAEC
Sbjct  269  ASKEDIDQLTKFKFRKVGDSVKHAVDEEQAQGDSGGVMTECGTDSPV--EHTLPHEDAEC  326

Query  384  CICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIK-GSYHTSGE  223
            CICL AYED  ELR+LPCGHHFHC C DKWL INATCPLCK +I+K G+Y  + E
Sbjct  327  CICLSAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKSGNYEGADE  381



>ref|XP_010455583.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Camelina 
sativa]
Length=392

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 124/166 (75%), Gaps = 11/166 (7%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ ++ DS QLYW  IIFL FDVFFVVFC+ LACVIGL +CCCLPCI+A+LYAVADQ+G
Sbjct  234  GGQTLSGDSPQLYWLCIIFLGFDVFFVVFCVALACVIGLAVCCCLPCIIAILYAVADQEG  293

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A ++DIE++ K+ F ++ S E          ++G+MT CG+D  +     LS +DAECCI
Sbjct  294  ASKKDIEQMPKFRFRKSSSDEK---------LSGIMTECGMDSPI--ERSLSPEDAECCI  342

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CLC YEDG ELR+LPC HHFHC C DKWL IN+ CPLCK +I+K +
Sbjct  343  CLCEYEDGVELRELPCNHHFHCTCIDKWLHINSRCPLCKFNILKNA  388



>ref|XP_010473550.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
Length=382

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 132/175 (75%), Gaps = 5/175 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ S QLYW  I+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVA+Q+G
Sbjct  208  GGQELAQGSPQLYWLCIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVAEQEG  267

Query  558  ADQEDIERLSKYTFTRT-ISFENG-DGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAEC  385
            A +EDI++L+K+ F +   S ++  D E+A G   GVMT CG D  +   H L  +DAEC
Sbjct  268  ASKEDIDQLTKFKFRKVGDSVKHAVDEEQAQGDSGGVMTECGTDSPV--EHTLPHEDAEC  325

Query  384  CICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIK-GSYHTSGE  223
            CICL AYED  ELR+LPCGHHFHC C DKWL INATCPLCK +I+K G+Y  + E
Sbjct  326  CICLSAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKSGNYEGADE  380



>ref|XP_008355582.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Malus domestica]
Length=385

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 125/174 (72%), Gaps = 7/174 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +A  S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ D
Sbjct  218  GGQSLANASPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQQD  277

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDIE+L K+ F +       +         GVMT CG D  +   H LS +DAECC
Sbjct  278  GASKEDIEQLPKFKFRKV----GNEKVXGDVQGGGVMTECGTDSPI--EHVLSQEDAECC  331

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ICL +Y+DG ELRQLPCGHHFHC+C DKWL INATCPLCK +I+K S    GEV
Sbjct  332  ICLSSYDDGVELRQLPCGHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGEV  385



>ref|XP_008355580.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Malus domestica]
Length=386

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 125/174 (72%), Gaps = 7/174 (4%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +A  S QLYW  IIFL FDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAVADQ D
Sbjct  219  GGQSLANASPQLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIALLYAVADQQD  278

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDIE+L K+ F +       +         GVMT CG D  +   H LS +DAECC
Sbjct  279  GASKEDIEQLPKFKFRKV----GNEKVXGDVQGGGVMTECGTDSPI--EHVLSQEDAECC  332

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ICL +Y+DG ELRQLPCGHHFHC+C DKWL INATCPLCK +I+K S    GEV
Sbjct  333  ICLSSYDDGVELRQLPCGHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGEV  386



>gb|KFK37366.1| hypothetical protein AALP_AA4G247400 [Arabis alpina]
Length=361

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 114/165 (69%), Gaps = 7/165 (4%)
 Frame = -3

Query  735  GQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGA  556
             + + Q S QLYW  + FLAFDV FVV C+ +AC+IG+ +CC LPCI+AVLYA+AD++GA
Sbjct  192  AEELVQSSPQLYWLCVAFLAFDVIFVVLCVAVACLIGIAVCCFLPCIIAVLYALADREGA  251

Query  555  DQEDIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
               +IE L K+ F      E  NG+ +E HG   G+MT  G D        LS D+AECC
Sbjct  252  SDAEIESLPKFKFITVRHSEKVNGELQETHG---GIMTQLGTDSPTERV--LSSDEAECC  306

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIK  247
            ICLC YEDG ELR+L C HHFH AC DKWL+INATCPLCK +I+K
Sbjct  307  ICLCDYEDGTELRELSCRHHFHDACIDKWLRINATCPLCKFNILK  351



>ref|XP_006287901.1| hypothetical protein CARUB_v10001135mg [Capsella rubella]
 gb|EOA20799.1| hypothetical protein CARUB_v10001135mg [Capsella rubella]
Length=395

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 124/166 (75%), Gaps = 11/166 (7%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ ++ DS QLYW  IIFL FDVFFVVFC+ LACVIGL +CCCLPCI+A+LYAVADQ+G
Sbjct  236  GGQTLSGDSPQLYWLCIIFLGFDVFFVVFCVALACVIGLAVCCCLPCIIAILYAVADQEG  295

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A + DI+++ K+ F ++ + E          ++G+MT CG D  +     LS +D ECCI
Sbjct  296  ASKNDIDQIPKFRFRKSSNNEK---------LSGIMTECGTDSPI--ERSLSPEDTECCI  344

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            CLC YEDGAELR+LPC HHFHCAC DKWL+IN+ CPLCK +I+K +
Sbjct  345  CLCEYEDGAELRELPCNHHFHCACIDKWLRINSRCPLCKFNILKNA  390



>emb|CAN65431.1| hypothetical protein VITISV_017099 [Vitis vinifera]
Length=342

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 111/156 (71%), Gaps = 3/156 (2%)
 Frame = -3

Query  690  IIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGADQEDIERLSKYTFTR  511
            I+FLAFDVFFVV C+ +ACVIG+ +CCCLPCI+A+LY VADQ+GA +E+IERL KY F R
Sbjct  188  IVFLAFDVFFVVICVAVACVIGIAVCCCLPCIIAILYTVADQEGATKEEIERLPKYKFRR  247

Query  510  TISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCICLCAYEDGAELRQLPC  331
                E  +GE    S  G+MT C  D  M   H +  +DAECCICL AYED  ELR+LPC
Sbjct  248  IGESEKLNGE-IQESFGGIMTECDTDTPM--EHVIPQEDAECCICLSAYEDETELRELPC  304

Query  330  GHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
             H FHC C DKWL INATCPLCK +I+K +  +  E
Sbjct  305  RHRFHCTCIDKWLYINATCPLCKLNILKNASQSGCE  340



>ref|XP_010469042.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
Length=360

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 114/170 (67%), Gaps = 7/170 (4%)
 Frame = -3

Query  726  MAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGADQE  547
            + Q S QLYW  + FLAFDV FVV C+ +A +IG+ +CCCLPCI+A+LYA+ADQ+GA  E
Sbjct  194  LPQSSPQLYWLCVAFLAFDVMFVVICVAVASLIGIAVCCCLPCIIAILYALADQEGAADE  253

Query  546  DIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCICL  373
            +IERL K+ F    + E  NG+  E  G   G+MT  G+         L  +DAEC ICL
Sbjct  254  EIERLLKFKFLTVKNSEKVNGEIRETQG---GIMT--GLGAESQTERVLCSEDAECSICL  308

Query  372  CAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            C YEDG ELR+LPC HHFH  C DKWL+INATCPLCK +I+K    +  E
Sbjct  309  CGYEDGVELRELPCRHHFHSLCVDKWLRINATCPLCKFNILKNGEPSGSE  358



>ref|XP_009401774.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=452

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 131/176 (74%), Gaps = 10/176 (6%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +  D+ QLYW  I+FLAFDVFFVVFC+ LACV+G+ +CCCLPCI+A+LYAVADQ +
Sbjct  284  GGQELTHDAPQLYWLCIVFLAFDVFFVVFCVALACVVGIAVCCCLPCIIAILYAVADQQE  343

Query  561  GADQEDIERLSKYTFTRTISFENGDGE--EAHGSIAGVMTLCGVDVAMGMAHQLSVDDAE  388
            GA +EDI +LSKY F +      GD E  E  G   G+M  CG D  +   H LS +DAE
Sbjct  344  GASEEDIHQLSKYKFHKV-----GDPEKLEISGPFGGIMIECGSDPPV--EHTLSAEDAE  396

Query  387  CCICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            CCICL  Y+DG ELR+LPCGHHFHC+C DKWL+INATCPLCK +I+K ++H + EV
Sbjct  397  CCICLSPYDDGVELRELPCGHHFHCSCIDKWLRINATCPLCKFNILKSNHHGTEEV  452



>ref|XP_006396865.1| hypothetical protein EUTSA_v10028703mg [Eutrema salsugineum]
 gb|ESQ38318.1| hypothetical protein EUTSA_v10028703mg [Eutrema salsugineum]
Length=402

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 121/165 (73%), Gaps = 2/165 (1%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ ++ DS QLYW  IIFL FDVFFVVFC+ LACVIGL +CCCLPCI+A+LYAVAD++G
Sbjct  236  GGQTLSSDSPQLYWLCIIFLGFDVFFVVFCVALACVIGLAVCCCLPCIIAILYAVADEEG  295

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A + DI+++ K+ F +  + E   G+    S  G+MT CG D  +     +S +DAECCI
Sbjct  296  ASKNDIDQMPKFRFRKIGNDEKLPGKAQATSDRGIMTECGTDSPI--ERSISPEDAECCI  353

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKG  244
            CLC YEDG ELR+LPC HHFHC C DKWL IN+ CPLCK +I+K 
Sbjct  354  CLCEYEDGVELRELPCNHHFHCTCIDKWLHINSRCPLCKFNILKN  398



>ref|XP_010418331.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
Length=382

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 132/175 (75%), Gaps = 5/175 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +AQ S QLYW  I+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+AVLYAVA+Q+G
Sbjct  208  GGQEVAQGSPQLYWLCIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVAEQEG  267

Query  558  ADQEDIERLSKYTFTRT-ISFENG-DGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAEC  385
            A +EDI++L+K+ F +   S ++  D E+A G   GVMT CG D  +   H L  +DAEC
Sbjct  268  ASKEDIDQLTKFKFRKVGDSVKHAVDEEQAQGDSGGVMTECGTDSPV--EHTLPHEDAEC  325

Query  384  CICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIK-GSYHTSGE  223
            CICL AYED  ELR+LPCGHHFHC C DKWL INATCPLCK +I+K G+Y  + E
Sbjct  326  CICLSAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKSGNYEGADE  380



>ref|XP_011033784.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Populus euphratica]
Length=395

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 128/174 (74%), Gaps = 4/174 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQ-D  562
            GGQ +AQ S QLYW  I+FL FDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYAV DQ +
Sbjct  225  GGQALAQGSPQLYWLCIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAILYAVTDQQE  284

Query  561  GADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECC  382
            GA +EDI++L+K+ F R    +   G++  G   G+MT  G D  M   H LS +DAECC
Sbjct  285  GASKEDIDQLAKFKFRRDGDIDKLTGDD-QGCFGGIMTEYGTDSPM--EHVLSGEDAECC  341

Query  381  ICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ICL AYEDGAELRQLPCGHHFHC C DKWL INATCPLCK +I+K +     EV
Sbjct  342  ICLSAYEDGAELRQLPCGHHFHCTCVDKWLYINATCPLCKYNILKSTSQDREEV  395



>ref|XP_010512452.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Camelina 
sativa]
Length=360

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 114/170 (67%), Gaps = 7/170 (4%)
 Frame = -3

Query  726  MAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGADQE  547
            + Q S QLYW  + FLAFDV FVV C+ +A +IG+ +CCCLPCI+A+LYA+ADQ+GA  E
Sbjct  194  LPQSSPQLYWLCVAFLAFDVMFVVICVAVASLIGIAVCCCLPCIIAILYALADQEGAADE  253

Query  546  DIERLSKYTFTRTISFE--NGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCICL  373
            +IERL K+ F    + E  NG+  E  G   G+MT  G+         L  +DAEC ICL
Sbjct  254  EIERLLKFKFLTVKNSEKVNGEIRETQG---GIMT--GLGAESQTERVLCSEDAECNICL  308

Query  372  CAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            C YEDG ELR+LPC HHFH  C DKWL+INATCPLCK +I+K    +  E
Sbjct  309  CGYEDGVELRELPCRHHFHSLCVDKWLRINATCPLCKFNILKNGEPSGSE  358



>ref|XP_010533709.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Tarenaya hassleriana]
Length=401

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 124/170 (73%), Gaps = 5/170 (3%)
 Frame = -3

Query  732  QPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDGAD  553
            Q +A+ S QLYW  I+FL FDVFFVVFC+ LACVIG+ +CCCLP ++AVLYA AD++GA 
Sbjct  235  QDLARGSPQLYWLCIVFLGFDVFFVVFCVALACVIGMAVCCCLPFVIAVLYAAADREGAT  294

Query  552  QEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCICL  373
            +EDIE LSK+ F R    + G   E  G+I GV+T CG D  +   H L  +DAECCICL
Sbjct  295  KEDIEELSKFKFRRVGDSDKG---EVQGNIGGVLTECGTDSPI--EHTLLQEDAECCICL  349

Query  372  CAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
             AYEDG ELR+LPCGHHFHCAC DKWL IN+TCPLCK +I+K S     E
Sbjct  350  SAYEDGDELRELPCGHHFHCACVDKWLFINSTCPLCKFNILKSSNDDRAE  399



>emb|CDX86759.1| BnaA09g21490D [Brassica napus]
Length=411

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 122/165 (74%), Gaps = 5/165 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ ++ DS QLYW  IIFL FDVFFVVFC+ LACV+GL +CCCLPCI+A+LYAVAD++G
Sbjct  248  GGQTLSSDSPQLYWLCIIFLGFDVFFVVFCVALACVVGLAVCCCLPCIIAILYAVADEEG  307

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A ++DI+++ K+ + +  + E   GE  +    G+MT CG D  +     LS +DAECCI
Sbjct  308  ASKKDIDQMPKFRYRKISNDEKLPGETTN---RGIMTECGTDSPI--ERSLSSEDAECCI  362

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKG  244
            CLC YEDG ELR+LPC HHFHC C DKWL IN+ CPLCK +I+K 
Sbjct  363  CLCEYEDGVELRELPCNHHFHCTCIDKWLHINSRCPLCKFNILKN  407



>emb|CDY57781.1| BnaCnng32440D [Brassica napus]
Length=391

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 122/165 (74%), Gaps = 5/165 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ ++ DS QLYW  IIFL FDVFFVVFC+ LACV+GL +CCCLPCI+A+LYAVAD++G
Sbjct  228  GGQTLSSDSPQLYWLCIIFLGFDVFFVVFCVALACVVGLAVCCCLPCIIAILYAVADEEG  287

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A ++DI+++ K+ + +  + E   GE  +    G+MT CG D  +     LS +DAECCI
Sbjct  288  ASKKDIDQMPKFRYRKISNDEKLQGETTN---RGIMTECGTDSPI--ERSLSSEDAECCI  342

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKG  244
            CLC YEDG ELR+LPC HHFHC C DKWL IN+ CPLCK +I+K 
Sbjct  343  CLCEYEDGVELRELPCNHHFHCTCIDKWLHINSRCPLCKFNILKN  387



>ref|NP_001147541.1| protein binding protein [Zea mays]
 gb|ACG27868.1| protein binding protein [Zea mays]
Length=375

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 124/172 (72%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GG+ + +D+ QLYW  IIFLAFDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAV+DQ+G
Sbjct  205  GGEVLTRDAPQLYWLCIIFLAFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVSDQEG  264

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A ++DI ++ KY F R +           GS  G+M  CG +    +   L+ +DAECCI
Sbjct  265  ASEDDIRQIPKYKF-RKMEEPEKQSVGVPGSSGGIMIECGTN--QPIEKVLAAEDAECCI  321

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            CL AY+DGAELR+LPCGHHFHC C DKWL INATCPLCK ++ K S  +  E
Sbjct  322  CLSAYDDGAELRELPCGHHFHCVCIDKWLHINATCPLCKYNVRKNSSSSGSE  373



>ref|XP_010934468.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Elaeis guineensis]
Length=383

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 126/177 (71%), Gaps = 11/177 (6%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +  D+ QLYW  I+FLAFDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYAV DQ+G
Sbjct  214  GGQALTSDAPQLYWLCIVFLAFDVFFVVFCVALACVIGIAVCCCLPCIIAILYAVGDQEG  273

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIA----GVMTLCGVDVAMGMAHQLSVDDA  391
            A  EDI +L KY F R      GD E+  G I+    G+MT CG D  +   + LS +D 
Sbjct  274  ASDEDIRQLPKYKFRRI-----GDPEKIGGDISRPSGGIMTECGSDPPI--ENVLSAEDV  326

Query  390  ECCICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGEV  220
            ECCICL +YEDG ELR+LPC HHFHC C DKWL INATCPLCK +IIK S H   EV
Sbjct  327  ECCICLSSYEDGVELRELPCSHHFHCTCIDKWLYINATCPLCKFNIIKSSNHGREEV  383



>ref|XP_006658537.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Oryza 
brachyantha]
Length=315

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 128/170 (75%), Gaps = 11/170 (6%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ ++ D+ QLYW SI+FLAFDVFFVVFC+ LACVIG+ +CCCLPCI+A+LYAV DQ+G
Sbjct  147  GGQDLSHDAPQLYWLSIVFLAFDVFFVVFCVALACVIGIAVCCCLPCIIAILYAVTDQEG  206

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIA----GVMTLCGVDVAMGMAHQLSVDDA  391
            A +EDI  LSK+ F RT+    GD ++    IA    GVMT CG +  +     LS +DA
Sbjct  207  ASEEDINNLSKFKF-RTM----GDADKLVAGIAAPVGGVMTECGTNPPVD--RFLSAEDA  259

Query  390  ECCICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            ECCICLC YEDGAELR+LPC HHFHC C DKWL INATCPLCK +IIK +
Sbjct  260  ECCICLCPYEDGAELRELPCNHHFHCTCIDKWLHINATCPLCKFNIIKSN  309



>dbj|BAK01729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 129/172 (75%), Gaps = 3/172 (2%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GG+ + +D+ QLYW  I+FLAFDVFFVVFC+ LAC+IG+ +CCCLPCI+A+LYAV+DQ+G
Sbjct  207  GGEEVIRDAPQLYWLCIVFLAFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVSDQEG  266

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A ++DI ++ KY F R    E  D  +A  S  G+MT CG +  +  A  L+ +DAECCI
Sbjct  267  ASEDDIRQIPKYKFRRVDEPEK-DSADATESSGGIMTECGTNQPIEKA--LAAEDAECCI  323

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGSYHTSGE  223
            C+ AY+DGAELR+LPCGHHFHCAC DKWL INATCPLCK SI KG   +  E
Sbjct  324  CISAYDDGAELRELPCGHHFHCACIDKWLHINATCPLCKFSIRKGGSSSGSE  375



>gb|KHN21610.1| E3 ubiquitin protein ligase RIE1 [Glycine soja]
Length=305

 Score =   143 bits (360),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 119/166 (72%), Gaps = 5/166 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GG  + QD+ +LYW S++FLAFDVFF +FC++LAC+IG+ +CCCLPCI+A+LYAVA Q+G
Sbjct  142  GGDILLQDAPRLYWLSVVFLAFDVFFAIFCVVLACLIGIALCCCLPCIIAILYAVAGQEG  201

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A + D+  L KY F + +S E   GE   GS+  + T  G  V       LS +DAECCI
Sbjct  202  ASESDLSILPKYRF-QLLSNEETPGE-GGGSMIPMETSNGYSVN---ERTLSPEDAECCI  256

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKGS  241
            C+ +YEDGAEL  LPC HHFH  C  KWL++NATCPLCK +I+KG+
Sbjct  257  CISSYEDGAELHVLPCNHHFHSTCIVKWLKMNATCPLCKYNILKGN  302



>ref|XP_009124794.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Brassica rapa]
Length=387

 Score =   144 bits (364),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 122/165 (74%), Gaps = 5/165 (3%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ ++ DS QLYW  IIFL FDVFFVVFC+ LACV+GL +CCCLPCI+A+LYAVAD++G
Sbjct  224  GGQTLSSDSPQLYWLCIIFLGFDVFFVVFCVALACVVGLAVCCCLPCIIAILYAVADEEG  283

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSIAGVMTLCGVDVAMGMAHQLSVDDAECCI  379
            A ++DI+++ K+ + +  + E   GE  +    G+MT CG D  +     L+ +DAECCI
Sbjct  284  ASKKDIDQMPKFRYRKISNDEKLPGETTN---RGIMTECGTDSPI--ERSLTSEDAECCI  338

Query  378  CLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIKG  244
            CLC YEDG ELR+LPC HHFHC C DKWL IN+ CPLCK +I+K 
Sbjct  339  CLCEYEDGVELRELPCNHHFHCTCIDKWLHINSRCPLCKFNILKN  383



>ref|XP_008389094.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Malus 
domestica]
Length=227

 Score =   140 bits (354),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 109/167 (65%), Gaps = 10/167 (6%)
 Frame = -3

Query  738  GGQPMAQDSXQLYWASIIFLAFDVFFVVFciilacviglgiccclpcilAVLYAVADQDG  559
            GGQ +   S +LYW  + FL FDV F++  +  +C++G+ ICC LPCI+ +L AV DQDG
Sbjct  58   GGQTLLSSSPRLYWLCVSFLVFDVTFIIVYVAASCLVGIAICCFLPCIIGILCAVTDQDG  117

Query  558  ADQEDIERLSKYTFTRTISFENGDGEEAHGSI---AGVMTLCGVDVAMGMAHQLSVDDAE  388
            A +E+I+ L K+ F R      GD E+ +G +    G M  C  D        +S+ DAE
Sbjct  118  ATEEEIDGLPKFKFRRV-----GDSEKVNGEVQAFEGFMIEC--DTNAPTERPISLVDAE  170

Query  387  CCICLCAYEDGAELRQLPCGHHFHCACADKWLQINATCPLCKNSIIK  247
            CCICL  YE+GAELR+LPC HHFHC C DKWL INATCP+CK +I+K
Sbjct  171  CCICLSVYENGAELRELPCLHHFHCTCIDKWLYINATCPMCKFNILK  217



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515