BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF023A11

Length=683
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP03931.1|  unnamed protein product                                286   4e-91   Coffea canephora [robusta coffee]
ref|XP_009777271.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    282   5e-89   Nicotiana sylvestris
ref|XP_009610543.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    278   2e-87   Nicotiana tomentosiformis
ref|XP_006366999.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    275   2e-86   Solanum tuberosum [potatoes]
ref|XP_004247041.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    275   3e-86   Solanum lycopersicum
ref|XP_006484802.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    270   2e-84   Citrus sinensis [apfelsine]
gb|KHG25787.1|  putative glucan endo-1,3-beta-glucosidase A6 -lik...    270   2e-84   Gossypium arboreum [tree cotton]
ref|XP_006437250.1|  hypothetical protein CICLE_v10031440mg             269   5e-84   Citrus clementina [clementine]
ref|XP_003632052.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    269   8e-84   Vitis vinifera
gb|KJB10880.1|  hypothetical protein B456_001G230200                    266   1e-83   Gossypium raimondii
gb|KJB10878.1|  hypothetical protein B456_001G230200                    266   4e-83   Gossypium raimondii
ref|XP_007049652.1|  O-Glycosyl hydrolases family 17 protein isof...    262   6e-83   
gb|KEH22560.1|  glucan endo-1,3-beta-glucosidase-like protein           263   1e-82   Medicago truncatula
ref|XP_007199923.1|  hypothetical protein PRUPE_ppa006984mg             263   2e-82   
gb|KHG02504.1|  putative glucan endo-1,3-beta-glucosidase A6 -lik...    265   2e-82   Gossypium arboreum [tree cotton]
ref|XP_008244679.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    264   4e-82   Prunus mume [ume]
ref|XP_007049651.1|  O-Glycosyl hydrolases family 17 protein isof...    263   6e-82   
gb|KEH22559.1|  glucan endo-1,3-beta-glucosidase-like protein           263   9e-82   Medicago truncatula
ref|XP_002534357.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    261   1e-81   Ricinus communis
ref|XP_008460404.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    261   6e-81   Cucumis melo [Oriental melon]
ref|XP_010100789.1|  putative glucan endo-1,3-beta-glucosidase A6       261   6e-81   Morus notabilis
ref|XP_010246533.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    261   6e-81   Nelumbo nucifera [Indian lotus]
gb|KJB84083.1|  hypothetical protein B456_N004800                       261   9e-81   Gossypium raimondii
ref|XP_009372203.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    260   1e-80   Pyrus x bretschneideri [bai li]
ref|XP_011089044.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    260   2e-80   Sesamum indicum [beniseed]
ref|XP_004144397.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    260   2e-80   Cucumis sativus [cucumbers]
ref|XP_008356234.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    261   2e-80   
ref|XP_004290162.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    259   4e-80   Fragaria vesca subsp. vesca
ref|XP_004492271.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    257   2e-79   Cicer arietinum [garbanzo]
ref|XP_010036769.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    256   5e-79   Eucalyptus grandis [rose gum]
ref|XP_006386885.1|  3-glucanase family protein                         256   5e-79   Populus trichocarpa [western balsam poplar]
ref|XP_011024595.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    256   5e-79   Populus euphratica
dbj|BAA89481.1|  beta-1,3-glucanase                                     254   5e-78   Salix gilgiana
gb|KDP45279.1|  hypothetical protein JCGZ_15144                         253   1e-77   Jatropha curcas
ref|XP_008382581.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    251   3e-77   
gb|KJB10879.1|  hypothetical protein B456_001G230200                    249   2e-76   Gossypium raimondii
ref|XP_007140788.1|  hypothetical protein PHAVU_008G142200g             249   3e-76   Phaseolus vulgaris [French bean]
ref|XP_004510238.1|  PREDICTED: putative copper-transporting ATPa...    259   7e-76   
ref|XP_002303070.2|  3-glucanase family protein                         248   1e-75   
gb|KEH18116.1|  O-glycosyl hydrolase family 17 protein                  245   1e-75   Medicago truncatula
ref|XP_010685101.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    247   2e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003626949.1|  Beta-1 3-glucanase                                 246   4e-75   Medicago truncatula
gb|KFK38190.1|  hypothetical protein AALP_AA3G081000                    246   4e-75   Arabis alpina [alpine rockcress]
ref|XP_009147086.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    247   5e-75   Brassica rapa
emb|CDY28063.1|  BnaC05g44650D                                          245   8e-75   Brassica napus [oilseed rape]
emb|CDY45466.1|  BnaC09g12840D                                          245   1e-74   Brassica napus [oilseed rape]
ref|XP_010464351.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    244   1e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010486278.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    244   2e-74   Camelina sativa [gold-of-pleasure]
emb|CDY24629.1|  BnaA05g30280D                                          244   2e-74   Brassica napus [oilseed rape]
ref|XP_010451138.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    244   3e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010906169.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    235   6e-74   Elaeis guineensis
ref|XP_002884642.1|  glycosyl hydrolase family 17 protein               242   9e-74   Arabidopsis lyrata subsp. lyrata
ref|XP_010547131.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    242   1e-73   Tarenaya hassleriana [spider flower]
ref|XP_006407848.1|  hypothetical protein EUTSA_v10020660mg             242   1e-73   Eutrema salsugineum [saltwater cress]
ref|XP_007134153.1|  hypothetical protein PHAVU_010G0238001g            238   1e-73   Phaseolus vulgaris [French bean]
ref|NP_683538.1|  O-Glycosyl hydrolases family 17 protein               242   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009385472.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    242   2e-73   
ref|XP_010247391.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    242   2e-73   Nelumbo nucifera [Indian lotus]
ref|XP_006297636.1|  hypothetical protein CARUB_v10013655mg             241   3e-73   Capsella rubella
gb|AAM65039.1|  putative glucan endo-1-3-beta-glucosidase               241   4e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011024596.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    241   4e-73   Populus euphratica
gb|EYU39188.1|  hypothetical protein MIMGU_mgv1a006049mg                237   8e-72   Erythranthe guttata [common monkey flower]
ref|XP_006407849.1|  hypothetical protein EUTSA_v10020660mg             237   2e-71   
emb|CDY08004.1|  BnaC03g35190D                                          236   2e-71   Brassica napus [oilseed rape]
ref|XP_010552026.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    236   3e-71   Tarenaya hassleriana [spider flower]
ref|XP_003552101.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    234   1e-70   Glycine max [soybeans]
ref|XP_003530849.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    234   2e-70   Glycine max [soybeans]
ref|XP_008792941.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    231   3e-70   
ref|XP_009134961.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    233   4e-70   Brassica rapa
ref|XP_006830552.1|  hypothetical protein AMTR_s00117p00097230          232   9e-70   
ref|XP_008792940.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    232   1e-69   
ref|XP_008792939.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    232   1e-69   Phoenix dactylifera
ref|XP_009411847.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    228   3e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006492526.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    226   4e-68   
gb|KDP32593.1|  hypothetical protein JCGZ_13143                         228   4e-68   Jatropha curcas
ref|XP_009411846.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    228   5e-68   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS58986.1|  hypothetical protein M569_15824                         226   9e-68   Genlisea aurea
ref|XP_006373100.1|  hypothetical protein POPTR_0017s08720g             226   3e-67   Populus trichocarpa [western balsam poplar]
ref|XP_002298669.2|  glucan endo-1 family protein                       224   3e-67   
ref|XP_003632055.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    225   4e-67   Vitis vinifera
ref|XP_011010072.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    224   1e-66   Populus euphratica
emb|CBI39414.3|  unnamed protein product                                221   2e-66   Vitis vinifera
ref|XP_011045808.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    223   2e-66   Populus euphratica
ref|XP_007034194.1|  O-Glycosyl hydrolases family 17 protein            225   3e-66   
ref|XP_009383834.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    223   4e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383833.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    223   4e-66   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB28087.1|  hypothetical protein B456_005G026800                    223   4e-66   Gossypium raimondii
gb|ACR37660.1|  unknown                                                 214   8e-66   Zea mays [maize]
dbj|BAJ88052.1|  predicted protein                                      222   1e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDO96794.1|  unnamed protein product                                221   1e-65   Coffea canephora [robusta coffee]
ref|XP_011101604.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    221   1e-65   
ref|XP_010238330.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    221   4e-65   Brachypodium distachyon [annual false brome]
gb|ACN28576.1|  unknown                                                 216   4e-65   Zea mays [maize]
ref|XP_002462618.1|  hypothetical protein SORBIDRAFT_02g029080          219   1e-64   Sorghum bicolor [broomcorn]
ref|XP_010023613.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    217   3e-64   
ref|NP_001149815.1|  glucan endo-1,3-beta-glucosidase A6 precursor      216   1e-63   Zea mays [maize]
ref|XP_004505110.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    215   3e-63   
ref|XP_008222761.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    214   8e-63   
gb|KEH30957.1|  glucan endo-1,3-beta-glucosidase-like protein           213   2e-62   Medicago truncatula
emb|CDX74052.1|  BnaA03g29950D                                          215   2e-62   
gb|KDO47456.1|  hypothetical protein CISIN_1g012660mg                   213   3e-62   Citrus sinensis [apfelsine]
ref|XP_006830555.1|  hypothetical protein AMTR_s00117p00104410          212   7e-62   
ref|XP_010314851.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    211   1e-61   
ref|XP_006421038.1|  hypothetical protein CICLE_v10004917mg             211   2e-61   
ref|XP_006349905.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    210   2e-61   Solanum tuberosum [potatoes]
gb|EEC84834.1|  hypothetical protein OsI_31928                          210   3e-61   Oryza sativa Indica Group [Indian rice]
ref|NP_001063586.1|  Os09g0502200                                       210   3e-61   
dbj|BAK04571.1|  predicted protein                                      211   4e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006661404.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    211   6e-61   
ref|XP_007221306.1|  hypothetical protein PRUPE_ppa016789mg             207   2e-60   
gb|EMT13087.1|  Putative glucan endo-1,3-beta-glucosidase A6            205   2e-60   
gb|EYU31522.1|  hypothetical protein MIMGU_mgv1a005774mg                207   2e-60   Erythranthe guttata [common monkey flower]
ref|XP_004957267.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    207   4e-60   Setaria italica
ref|XP_008439043.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    207   4e-60   Cucumis melo [Oriental melon]
ref|XP_010532729.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    207   5e-60   Tarenaya hassleriana [spider flower]
emb|CDY63754.1|  BnaAnng19080D                                          207   6e-60   Brassica napus [oilseed rape]
ref|XP_009102583.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    206   8e-60   Brassica rapa
emb|CDY50110.1|  BnaC01g43580D                                          206   9e-60   Brassica napus [oilseed rape]
emb|CDP15106.1|  unnamed protein product                                206   9e-60   Coffea canephora [robusta coffee]
dbj|BAK05423.1|  predicted protein                                      206   1e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006414816.1|  hypothetical protein EUTSA_v10025081mg             206   1e-59   Eutrema salsugineum [saltwater cress]
gb|AAF20214.1|AC012395_1  putative beta-1,3-glucanase precursor         205   2e-59   Arabidopsis thaliana [mouse-ear cress]
emb|CDY59775.1|  BnaCnng35540D                                          205   2e-59   Brassica napus [oilseed rape]
ref|XP_009373620.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    205   2e-59   
ref|XP_009144683.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    205   3e-59   Brassica rapa
ref|XP_002868315.1|  hypothetical protein ARALYDRAFT_493503             204   5e-59   
emb|CDY67322.1|  BnaA03g57600D                                          197   5e-59   Brassica napus [oilseed rape]
emb|CDY08310.1|  BnaA05g13090D                                          204   9e-59   Brassica napus [oilseed rape]
emb|CDY18092.1|  BnaA01g23530D                                          203   1e-58   Brassica napus [oilseed rape]
gb|KFK36299.1|  hypothetical protein AALP_AA4G104300                    203   1e-58   Arabis alpina [alpine rockcress]
ref|XP_004147671.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    203   1e-58   
ref|XP_009106344.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    203   2e-58   Brassica rapa
emb|CAA49513.1|  beta-1,3-glucanase homologue                           203   2e-58   Brassica napus [oilseed rape]
emb|CDY06469.1|  BnaC06g11750D                                          203   2e-58   
ref|XP_004973968.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    200   3e-58   Setaria italica
ref|XP_009625839.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    201   3e-58   Nicotiana tomentosiformis
ref|XP_009625838.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    202   4e-58   Nicotiana tomentosiformis
gb|KFK39673.1|  a6 anther-specific protein                              202   4e-58   Arabis alpina [alpine rockcress]
emb|CDP15107.1|  unnamed protein product                                197   6e-58   Coffea canephora [robusta coffee]
ref|XP_010435194.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    201   6e-58   Camelina sativa [gold-of-pleasure]
ref|XP_009777293.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    201   6e-58   Nicotiana sylvestris
ref|XP_008380636.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    201   7e-58   
emb|CDY12371.1|  BnaC08g08340D                                          201   9e-58   Brassica napus [oilseed rape]
ref|NP_189019.1|  O-glycosyl hydrolases family 17 protein               201   1e-57   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28569.1|  unknown                                                 201   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010450129.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    200   3e-57   
ref|XP_010450110.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    200   3e-57   Camelina sativa [gold-of-pleasure]
gb|AAM64490.1|  beta-1,3-glucanase, putative                            200   3e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193144.1|  putative glucan endo-1,3-beta-glucosidase A6          199   4e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299757.1|  hypothetical protein CARUB_v10015952mg             199   4e-57   Capsella rubella
ref|XP_009135862.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    198   1e-56   Brassica rapa
ref|XP_009108090.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    198   2e-56   Brassica rapa
ref|XP_002883459.1|  hypothetical protein ARALYDRAFT_479892             197   2e-56   
ref|XP_006418839.1|  hypothetical protein EUTSA_v10002513mg             197   3e-56   Eutrema salsugineum [saltwater cress]
emb|CDY53213.1|  BnaC03g74070D                                          197   3e-56   Brassica napus [oilseed rape]
emb|CAK18899.1|  glucan 1,3-beta glucosidase                            188   3e-56   Cocos nucifera
ref|XP_006282877.1|  hypothetical protein CARUB_v10006945mg             196   5e-56   Capsella rubella
emb|CDY27122.1|  BnaA08g07600D                                          196   7e-56   Brassica napus [oilseed rape]
gb|KJB37880.1|  hypothetical protein B456_006G224700                    196   9e-56   Gossypium raimondii
ref|XP_010512882.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    196   1e-55   Camelina sativa [gold-of-pleasure]
gb|KCW48409.1|  hypothetical protein EUGRSUZ_K02112                     194   1e-55   Eucalyptus grandis [rose gum]
gb|ADE76604.1|  unknown                                                 195   2e-55   Picea sitchensis
ref|XP_010488453.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    194   2e-55   Camelina sativa [gold-of-pleasure]
ref|NP_001168659.1|  uncharacterized protein LOC100382447               192   4e-55   Zea mays [maize]
ref|XP_009139564.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    194   6e-55   Brassica rapa
emb|CDY12732.1|  BnaC04g29090D                                          193   7e-55   Brassica napus [oilseed rape]
emb|CDY01191.1|  BnaA04g06280D                                          193   1e-54   
ref|XP_008643986.1|  PREDICTED: uncharacterized protein LOC100382...    192   2e-54   Zea mays [maize]
ref|XP_010466734.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    192   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010527440.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    192   3e-54   Tarenaya hassleriana [spider flower]
gb|KGN57233.1|  hypothetical protein Csa_3G172380                       187   1e-52   Cucumis sativus [cucumbers]
ref|XP_010673323.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    187   2e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008669802.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    187   2e-52   Zea mays [maize]
ref|XP_003581305.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    181   3e-50   Brachypodium distachyon [annual false brome]
gb|EEC76518.1|  hypothetical protein OsI_14304                          172   5e-50   Oryza sativa Indica Group [Indian rice]
emb|CAA49515.1|  beta-1,3-glucanase homologue                           167   1e-48   Brassica napus [oilseed rape]
ref|XP_001777261.1|  predicted protein                                  176   2e-48   
dbj|BAG16366.1|  tapetum-specific protein A6 family protein             173   8e-48   Brassica rapa var. perviridis [kabuna]
dbj|BAG16359.1|  tapetum-specific protein A6 family protein             172   2e-47   Brassica oleracea var. italica [asparagus broccoli]
gb|EEC76519.1|  hypothetical protein OsI_14305                          173   2e-47   Oryza sativa Indica Group [Indian rice]
ref|NP_001051879.1|  Os03g0845600                                       173   2e-47   
ref|XP_003572424.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    173   1e-46   Brachypodium distachyon [annual false brome]
ref|XP_001780045.1|  predicted protein                                  171   1e-46   
ref|XP_002444717.1|  hypothetical protein SORBIDRAFT_07g026540          171   2e-46   Sorghum bicolor [broomcorn]
dbj|BAE80092.1|  glycosyl hydrolase family 17                           164   6e-44   Silene latifolia
ref|XP_002972033.1|  hypothetical protein SELMODRAFT_96745              160   2e-42   
ref|XP_002972579.1|  hypothetical protein SELMODRAFT_97838              160   2e-42   
ref|XP_001784285.1|  predicted protein                                  159   3e-42   
ref|XP_002520622.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    159   3e-42   
ref|XP_002463526.1|  hypothetical protein SORBIDRAFT_01g001430          159   7e-42   Sorghum bicolor [broomcorn]
ref|NP_001062294.2|  Os08g0525800                                       157   3e-41   
dbj|BAC75423.1|  putative beta-1,3-glucanase                            155   1e-40   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ07710.1|  hypothetical protein OsI_29967                          159   1e-40   Oryza sativa Indica Group [Indian rice]
gb|KHG21190.1|  hypothetical protein F383_01641                         150   5e-39   Gossypium arboreum [tree cotton]
ref|XP_003544773.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    150   7e-39   Glycine max [soybeans]
gb|ABR16205.1|  unknown                                                 150   7e-39   Picea sitchensis
gb|KJB13749.1|  hypothetical protein B456_002G092600                    150   8e-39   Gossypium raimondii
ref|XP_002961854.1|  hypothetical protein SELMODRAFT_437767             149   1e-38   Selaginella moellendorffii
ref|XP_002980798.1|  hypothetical protein SELMODRAFT_444643             148   3e-38   Selaginella moellendorffii
gb|KJB62900.1|  hypothetical protein B456_009G442700                    147   2e-37   Gossypium raimondii
ref|XP_001781801.1|  predicted protein                                  145   4e-37   
gb|KHG04965.1|  hypothetical protein F383_30444                         145   8e-37   Gossypium arboreum [tree cotton]
ref|XP_004491104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    145   9e-37   Cicer arietinum [garbanzo]
ref|XP_006595830.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   9e-37   Glycine max [soybeans]
gb|ADU15553.1|  GLU                                                     144   1e-36   Gossypium hirsutum [American cotton]
ref|XP_006575581.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    143   3e-36   Glycine max [soybeans]
ref|XP_008449141.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     142   5e-36   Cucumis melo [Oriental melon]
ref|XP_003616906.1|  Glucan endo-1,3-beta-glucosidase                   142   5e-36   Medicago truncatula
gb|KHN23902.1|  Glucan endo-1,3-beta-glucosidase 12                     141   1e-35   Glycine soja [wild soybean]
ref|XP_009137621.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     141   1e-35   Brassica rapa
gb|KHN38251.1|  Glucan endo-1,3-beta-glucosidase 12                     139   2e-35   Glycine soja [wild soybean]
ref|XP_003519593.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   3e-35   
ref|XP_002884972.1|  glycosyl hydrolase family 17 protein               140   3e-35   
ref|XP_011085458.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      140   3e-35   Sesamum indicum [beniseed]
emb|CDY14214.1|  BnaA08g13450D                                          140   5e-35   Brassica napus [oilseed rape]
ref|XP_008450796.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     140   6e-35   Cucumis melo [Oriental melon]
gb|KFK29190.1|  hypothetical protein AALP_AA7G101400                    139   7e-35   Arabis alpina [alpine rockcress]
gb|KHG21189.1|  hypothetical protein F383_01641                         139   7e-35   Gossypium arboreum [tree cotton]
ref|XP_004135678.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   8e-35   Cucumis sativus [cucumbers]
emb|CDX92794.1|  BnaC07g40520D                                          139   1e-34   
ref|XP_009595038.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   1e-34   Nicotiana tomentosiformis
ref|XP_010482941.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010675772.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   3e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006280442.1|  hypothetical protein CARUB_v10026374mg             137   3e-34   Capsella rubella
ref|XP_010539314.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     137   3e-34   Tarenaya hassleriana [spider flower]
ref|XP_006297495.1|  hypothetical protein CARUB_v10013514mg             137   3e-34   Capsella rubella
ref|XP_004294998.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      137   4e-34   Fragaria vesca subsp. vesca
ref|XP_010545233.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     137   5e-34   Tarenaya hassleriana [spider flower]
ref|XP_007142328.1|  hypothetical protein PHAVU_008G271000g             137   6e-34   Phaseolus vulgaris [French bean]
ref|XP_009375652.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   6e-34   Pyrus x bretschneideri [bai li]
ref|XP_010063042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   6e-34   Eucalyptus grandis [rose gum]
ref|XP_002864380.1|  glycosyl hydrolase family 17 protein               136   6e-34   
dbj|BAF01977.1|  putative beta-1,3-glucanase                            134   7e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009794437.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   7e-34   Nicotiana sylvestris
dbj|BAB17320.1|  elicitor inducible beta-1,3-glucanase NtEIG-E76        136   7e-34   Nicotiana tabacum [American tobacco]
emb|CDY46679.1|  BnaA03g48290D                                          136   7e-34   Brassica napus [oilseed rape]
ref|XP_004140121.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   7e-34   Cucumis sativus [cucumbers]
ref|XP_006447645.1|  hypothetical protein CICLE_v10015086mg             136   8e-34   Citrus clementina [clementine]
ref|XP_007014685.1|  O-Glycosyl hydrolases family 17 protein isof...    136   8e-34   
ref|XP_008352033.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    136   8e-34   
ref|XP_007020717.1|  O-Glycosyl hydrolases family 17 protein            136   9e-34   
ref|XP_008354983.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   1e-33   
gb|ACN39797.1|  unknown                                                 136   1e-33   Picea sitchensis
ref|XP_007141644.1|  hypothetical protein PHAVU_008G213400g             136   1e-33   Phaseolus vulgaris [French bean]
ref|XP_008354986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   1e-33   
ref|XP_004161885.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    135   1e-33   
ref|XP_010914932.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   1e-33   Elaeis guineensis
ref|XP_006469612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   1e-33   
ref|XP_004149346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   1e-33   Cucumis sativus [cucumbers]
ref|XP_010924450.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     135   1e-33   Elaeis guineensis
ref|XP_006488904.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   2e-33   Citrus sinensis [apfelsine]
ref|XP_002867539.1|  hydrolase, hydrolyzing O-glycosyl compounds        135   2e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_011009861.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     135   2e-33   Populus euphratica
emb|CDP14397.1|  unnamed protein product                                135   2e-33   Coffea canephora [robusta coffee]
ref|XP_006445640.1|  hypothetical protein CICLE_v10015028mg             135   2e-33   
gb|KDP33779.1|  hypothetical protein JCGZ_07350                         135   2e-33   Jatropha curcas
ref|XP_001761806.1|  predicted protein                                  135   2e-33   
ref|XP_010443128.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    135   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006357966.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   2e-33   Solanum tuberosum [potatoes]
ref|XP_010688353.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   2e-33   Beta vulgaris subsp. vulgaris [field beet]
gb|AAM66024.1|  beta-1,3-glucanase-like protein                         135   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010552278.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   3e-33   Tarenaya hassleriana [spider flower]
ref|XP_010449211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010270042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     134   4e-33   Nelumbo nucifera [Indian lotus]
gb|KDP39185.1|  hypothetical protein JCGZ_00942                         134   4e-33   Jatropha curcas
ref|XP_004243515.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     134   4e-33   Solanum lycopersicum
ref|XP_009628676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     134   4e-33   Nicotiana tomentosiformis
ref|NP_568822.1|  O-Glycosyl hydrolases family 17 protein               134   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007205107.1|  hypothetical protein PRUPE_ppa004732mg             134   5e-33   Prunus persica
ref|XP_008229211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      134   5e-33   Prunus mume [ume]
ref|NP_194413.2|  O-Glycosyl hydrolases family 17 protein               134   5e-33   Arabidopsis thaliana [mouse-ear cress]
gb|AAL77689.1|  AT5g55180/MCO15_13                                      134   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010249473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     134   5e-33   Nelumbo nucifera [Indian lotus]
ref|XP_006371969.1|  glycosyl hydrolase family 17 family protein        134   5e-33   Populus trichocarpa [western balsam poplar]
ref|XP_006344866.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   5e-33   Solanum tuberosum [potatoes]
ref|XP_009776400.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     134   6e-33   Nicotiana sylvestris
ref|XP_010267108.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     134   6e-33   Nelumbo nucifera [Indian lotus]
ref|XP_004491103.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   6e-33   
ref|XP_008795501.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     134   7e-33   Phoenix dactylifera
ref|XP_010465199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      134   8e-33   
ref|XP_002514201.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    134   8e-33   
gb|EYU33669.1|  hypothetical protein MIMGU_mgv1a005896mg                133   9e-33   
ref|XP_008449478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     133   1e-32   
ref|XP_009628415.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     133   1e-32   
ref|XP_009771279.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    133   1e-32   
ref|XP_007012990.1|  O-Glycosyl hydrolases family 17 protein isof...    133   1e-32   
ref|XP_010257592.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    133   1e-32   
emb|CDP13790.1|  unnamed protein product                                134   1e-32   
ref|XP_009146477.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      133   1e-32   
gb|EYU43154.1|  hypothetical protein MIMGU_mgv1a005917mg                132   2e-32   
ref|XP_001767901.1|  predicted protein                                  132   2e-32   
ref|XP_008799775.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    133   2e-32   
ref|XP_007012989.1|  O-Glycosyl hydrolases family 17 protein isof...    132   2e-32   
gb|EPS73917.1|  hypothetical protein M569_00835                         132   2e-32   
ref|XP_009394832.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   2e-32   
ref|XP_011047200.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     132   3e-32   
ref|XP_008384395.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   3e-32   
gb|KJB27172.1|  hypothetical protein B456_004G282300                    132   3e-32   
ref|XP_002278044.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     132   3e-32   
gb|KFK27118.1|  hypothetical protein AALP_AA8G337200                    132   3e-32   
ref|XP_004497650.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   3e-32   
gb|EPS68573.1|  hypothetical protein M569_06194                         132   3e-32   
ref|XP_009127020.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   3e-32   
ref|XP_011095448.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     132   4e-32   
ref|XP_011009684.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   4e-32   
ref|XP_010252551.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   4e-32   
ref|XP_011044921.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   4e-32   
ref|XP_001772420.1|  predicted protein                                  132   4e-32   
ref|XP_009364124.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   4e-32   
gb|EPS73640.1|  hypothetical protein M569_01113                         132   4e-32   
gb|EPS59841.1|  hypothetical protein M569_14964                         131   4e-32   
ref|XP_004294409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    131   5e-32   
gb|KDP30806.1|  hypothetical protein JCGZ_13749                         131   5e-32   
ref|XP_011093510.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    131   5e-32   
ref|XP_008226995.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    131   6e-32   
ref|XP_008806478.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    131   6e-32   
emb|CDP16794.1|  unnamed protein product                                131   6e-32   
gb|EYU27371.1|  hypothetical protein MIMGU_mgv1a005776mg                131   6e-32   
ref|XP_006413135.1|  hypothetical protein EUTSA_v10026799mg             131   6e-32   
ref|XP_002302861.2|  glycosyl hydrolase family 17 family protein        131   7e-32   
emb|CDY62033.1|  BnaC03g77660D                                          131   7e-32   
gb|KEH41871.1|  O-glycosyl hydrolase family 17 protein                  131   8e-32   
ref|XP_006386788.1|  hypothetical protein POPTR_0002s21700g             130   8e-32   
ref|XP_010448205.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    130   9e-32   
ref|XP_002529472.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    130   9e-32   
ref|XP_010542461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    130   1e-31   
dbj|BAB01763.1|  beta-1,3-glucanase-like protein                        130   1e-31   
ref|XP_001752749.1|  predicted protein                                  130   1e-31   
gb|EYU31523.1|  hypothetical protein MIMGU_mgv1a005774mg                130   1e-31   
ref|XP_011087532.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    130   1e-31   
ref|XP_009120040.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    130   1e-31   
ref|XP_010557676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     130   1e-31   
ref|XP_009109043.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    130   1e-31   
ref|XP_006283767.1|  hypothetical protein CARUB_v10004853mg             130   1e-31   
ref|NP_187965.1|  glucan endo-1,3-beta-glucosidase 4                    130   1e-31   
ref|XP_004288596.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      130   1e-31   
ref|XP_003620800.1|  Glucan endo-1,3-beta-glucosidase                   129   2e-31   
ref|XP_002973118.1|  hypothetical protein SELMODRAFT_442025             130   2e-31   
emb|CDY19908.1|  BnaC09g31740D                                          130   2e-31   
gb|KDO62115.1|  hypothetical protein CISIN_1g0115512mg                  130   2e-31   
ref|XP_010433104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    130   2e-31   
ref|XP_010541008.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     130   2e-31   
ref|XP_010097806.1|  Glucan endo-1,3-beta-glucosidase 4                 130   2e-31   
ref|XP_006407197.1|  hypothetical protein EUTSA_v10020572mg             129   2e-31   
ref|XP_006855690.1|  hypothetical protein AMTR_s00044p00136030          125   2e-31   
emb|CDY36734.1|  BnaA03g11520D                                          129   2e-31   
ref|XP_009132400.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   2e-31   
ref|NP_178637.2|  O-glycosyl hydrolases family 17 protein               129   2e-31   
ref|XP_009361042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   3e-31   
ref|XP_004287489.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     129   3e-31   
gb|ABD91577.1|  beta-1,3-glucanase                                      129   3e-31   
gb|ABD91576.1|  beta-1,3-glucanase                                      129   3e-31   
gb|KHG04722.1|  hypothetical protein F383_29074                         129   3e-31   
gb|KHG18393.1|  hypothetical protein F383_22096                         129   3e-31   
gb|KEH27229.1|  glucan endo-1,3-beta-glucosidase-like protein           129   3e-31   
emb|CDY12009.1|  BnaC03g14350D                                          129   3e-31   
ref|XP_006584807.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   3e-31   
ref|XP_011078239.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   4e-31   
ref|XP_010044948.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      129   4e-31   
ref|XP_010438307.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     129   4e-31   
gb|KHN16652.1|  Glucan endo-1,3-beta-glucosidase 13                     129   4e-31   
ref|XP_010483135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     129   4e-31   
ref|XP_002456331.1|  hypothetical protein SORBIDRAFT_03g034100          129   4e-31   
ref|XP_002961242.1|  hypothetical protein SELMODRAFT_402967             129   4e-31   
gb|KHG26459.1|  hypothetical protein F383_04538                         129   4e-31   
ref|XP_010049602.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     129   5e-31   
ref|XP_008364550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     128   5e-31   
ref|XP_002320484.1|  glycosyl hydrolase family 17 family protein        129   5e-31   
ref|XP_002867412.1|  glycosyl hydrolase family 17 protein               129   5e-31   
ref|XP_004969893.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    128   5e-31   
ref|XP_010232285.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    128   5e-31   
gb|EMS49856.1|  Glucan endo-1,3-beta-glucosidase 13                     128   5e-31   
ref|XP_008672638.1|  PREDICTED: uncharacterized protein LOC100278...    128   5e-31   
ref|XP_002969476.1|  hypothetical protein SELMODRAFT_231287             128   6e-31   
ref|XP_003569762.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    128   6e-31   
emb|CDY06818.1|  BnaC01g09170D                                          128   6e-31   
emb|CAB79694.1|  beta-1, 3-glucanase-like protein                       128   6e-31   
ref|XP_004304086.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     128   6e-31   
emb|CDM84006.1|  unnamed protein product                                128   7e-31   
gb|KHG05496.1|  hypothetical protein F383_30989                         128   7e-31   
ref|XP_008450301.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    128   7e-31   
ref|XP_010433433.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    128   7e-31   
gb|KJB23365.1|  hypothetical protein B456_004G094500                    128   8e-31   
ref|XP_007212383.1|  hypothetical protein PRUPE_ppa005210mg             128   8e-31   
emb|CDP05678.1|  unnamed protein product                                128   8e-31   
gb|KJB66065.1|  hypothetical protein B456_010G126400                    128   8e-31   
ref|XP_006285688.1|  hypothetical protein CARUB_v10007158mg             128   8e-31   
ref|XP_008775304.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    128   8e-31   
ref|NP_849556.1|  glucan endo-1,3-beta-glucosidase 12                   128   9e-31   
gb|EMT15518.1|  Glucan endo-1,3-beta-glucosidase 13                     128   9e-31   
ref|XP_003629715.1|  Glucan endo-1,3-beta-glucosidase                   128   9e-31   
dbj|BAJ85556.1|  predicted protein                                      128   9e-31   
emb|CDP03239.1|  unnamed protein product                                128   1e-30   
gb|AGV54422.1|  glucan endo-1,3-beta-glucosidase 13-like protein        128   1e-30   
ref|XP_004251644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     127   1e-30   
ref|XP_007160277.1|  hypothetical protein PHAVU_002G307800g             127   1e-30   
gb|KJB66066.1|  hypothetical protein B456_010G126400                    127   1e-30   
ref|XP_011097840.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     127   1e-30   
emb|CDY20780.1|  BnaA02g09200D                                          127   1e-30   
ref|XP_007032975.1|  Glucan endo-1,3-beta-glucosidase, putative i...    127   1e-30   
ref|XP_006396136.1|  hypothetical protein EUTSA_v10002515mg             127   1e-30   
gb|KJB54307.1|  hypothetical protein B456_009G028200                    127   1e-30   
ref|XP_006475009.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   1e-30   
ref|XP_006452449.1|  hypothetical protein CICLE_v10008176mg             127   1e-30   
ref|XP_006401482.1|  hypothetical protein EUTSA_v10013478mg             127   1e-30   
ref|XP_010438690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   1e-30   
gb|KJB10704.1|  hypothetical protein B456_001G216900                    125   1e-30   
gb|EAZ13481.1|  hypothetical protein OsJ_03397                          127   1e-30   
ref|XP_006580483.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     127   1e-30   
ref|XP_006837267.1|  hypothetical protein AMTR_s00112p00108890          127   1e-30   
ref|NP_001044198.1|  Os01g0739700                                       127   2e-30   
emb|CDY06601.1|  BnaC02g13250D                                          127   2e-30   
gb|EEC71452.1|  hypothetical protein OsI_03677                          127   2e-30   
ref|XP_002976593.1|  hypothetical protein SELMODRAFT_443280             127   2e-30   
ref|XP_010940752.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    127   2e-30   
gb|KHG14816.1|  hypothetical protein F383_17797                         127   2e-30   
ref|XP_006601114.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   2e-30   
gb|KHN12071.1|  Glucan endo-1,3-beta-glucosidase 4                      127   2e-30   
ref|XP_011070588.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      127   2e-30   
ref|XP_006357965.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   2e-30   
ref|XP_010447863.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   2e-30   
ref|XP_006853717.1|  hypothetical protein AMTR_s00056p00158530          127   2e-30   
gb|EYU30694.1|  hypothetical protein MIMGU_mgv1a005031mg                127   2e-30   
emb|CDY17308.1|  BnaA10g09420D                                          127   2e-30   
ref|XP_006386924.1|  hypothetical protein POPTR_0002s26290g             127   2e-30   
ref|XP_010488778.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   2e-30   
ref|XP_002962313.1|  hypothetical protein SELMODRAFT_438073             127   2e-30   
gb|KJB22745.1|  hypothetical protein B456_004G064200                    127   2e-30   
gb|ACL53837.1|  unknown                                                 124   2e-30   
gb|KJB65051.1|  hypothetical protein B456_010G078300                    127   2e-30   
ref|XP_010412737.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   2e-30   
gb|AIR93910.1|  glucanase                                               126   2e-30   
gb|KFK29497.1|  hypothetical protein AALP_AA7G142000                    127   2e-30   
ref|XP_002965231.1|  hypothetical protein SELMODRAFT_439107             127   3e-30   
emb|CDP00829.1|  unnamed protein product                                126   3e-30   
ref|NP_001275111.1|  glucan endo-1,3-beta-glucosidase 12-like pre...    126   3e-30   
gb|KDP25782.1|  hypothetical protein JCGZ_22504                         126   3e-30   
ref|XP_008337610.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     126   3e-30   
ref|XP_004140120.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   3e-30   
gb|KJB54309.1|  hypothetical protein B456_009G028300                    126   3e-30   
gb|AFK37243.1|  unknown                                                 126   3e-30   
ref|XP_007012991.1|  O-Glycosyl hydrolases family 17 protein isof...    126   3e-30   
ref|XP_010653417.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   3e-30   
ref|XP_010653375.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   3e-30   
ref|NP_001275363.1|  glucan endo-1,3-beta-glucosidase 13-like pre...    126   3e-30   
ref|NP_200470.1|  O-Glycosyl hydrolases family 17 protein               126   3e-30   
ref|XP_004251911.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   4e-30   
gb|EYU41109.1|  hypothetical protein MIMGU_mgv1a005128mg                126   4e-30   
ref|XP_006280336.1|  hypothetical protein CARUB_v10026261mg             126   4e-30   
ref|XP_010929505.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   4e-30   
emb|CBI26850.3|  unnamed protein product                                126   4e-30   
ref|XP_002283473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     126   4e-30   
ref|XP_009388881.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   4e-30   
ref|XP_008672637.1|  PREDICTED: uncharacterized protein LOC100278...    127   4e-30   
ref|XP_006644680.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   4e-30   
ref|XP_010926119.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   4e-30   
ref|XP_007215327.1|  hypothetical protein PRUPE_ppa005206mg             126   4e-30   
ref|XP_002967282.1|  hypothetical protein SELMODRAFT_87871              125   4e-30   
ref|XP_006344865.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   4e-30   
ref|XP_002316783.2|  glycosyl hydrolase family 17 family protein        126   4e-30   
ref|XP_002274828.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     125   4e-30   
ref|XP_009348307.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   4e-30   
ref|XP_002960438.1|  hypothetical protein SELMODRAFT_75479              125   4e-30   
ref|XP_008778544.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    125   4e-30   
ref|XP_010271297.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      125   5e-30   
gb|KJB27173.1|  hypothetical protein B456_004G282300                    125   5e-30   
gb|KJB10701.1|  hypothetical protein B456_001G216900                    125   5e-30   
ref|XP_010923875.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   5e-30   
ref|XP_006451337.1|  hypothetical protein CICLE_v10008080mg             125   5e-30   
ref|XP_010446151.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   6e-30   
ref|XP_009334153.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   6e-30   
ref|XP_004139073.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   6e-30   
ref|XP_010467085.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   6e-30   
ref|XP_010110871.1|  Glucan endo-1,3-beta-glucosidase 13                129   6e-30   
emb|CDY18049.1|  BnaC07g04210D                                          125   7e-30   
ref|XP_002532062.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    125   7e-30   
gb|KHG04832.1|  hypothetical protein F383_29565                         125   8e-30   
ref|XP_010929487.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   8e-30   
ref|XP_007012993.1|  O-Glycosyl hydrolases family 17 protein isof...    124   8e-30   
ref|XP_009352572.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     125   8e-30   
ref|XP_010476823.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   8e-30   
ref|XP_006596127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   8e-30   
ref|XP_006412850.1|  hypothetical protein EUTSA_v10024870mg             125   9e-30   
emb|CDY68826.1|  BnaA01g34890D                                          124   9e-30   
ref|XP_009384878.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    125   9e-30   
ref|XP_008789151.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   1e-29   
ref|XP_009128829.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     125   1e-29   
ref|XP_002864470.1|  glycosyl hydrolase family 17 protein               125   1e-29   
ref|XP_010500722.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      125   1e-29   
ref|XP_009397186.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   1e-29   
gb|ACF88240.1|  unknown                                                 125   1e-29   
gb|KDO36784.1|  hypothetical protein CISIN_1g009301mg                   125   1e-29   
ref|NP_001136613.1|  uncharacterized protein LOC100216736 precursor     124   1e-29   
dbj|BAB08587.1|  beta-1,3-glucanase-like protein                        124   1e-29   
ref|XP_009778460.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      125   1e-29   
gb|ACF79018.1|  unknown                                                 124   1e-29   
ref|XP_008789143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   1e-29   
ref|XP_008242469.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   1e-29   
ref|XP_008242470.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   1e-29   
ref|XP_004236940.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      124   1e-29   



>emb|CDP03931.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   286 bits (731),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -1

Query  665  KVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPP  486
            K+GTPARPGVV+P  IFALYNENQKPGPGTERHFG+LYPNGT +Y IDLSGKTPESE+ P
Sbjct  255  KIGTPARPGVVLPAFIFALYNENQKPGPGTERHFGLLYPNGTRVYEIDLSGKTPESEYEP  314

Query  485  LPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRH  306
            LPKPT N+PYKGK+WCVV   AN TA+A AL YACGQGN TC+PIQPGG CY PNSL+ H
Sbjct  315  LPKPTNNEPYKGKIWCVVGEGANRTALAAALGYACGQGNGTCDPIQPGGKCYEPNSLVHH  374

Query  305  ASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            AS+AFSSYWAQFR +GGTCYF+GLA +TI DPSYG+CK+PS+TL
Sbjct  375  ASFAFSSYWAQFRKVGGTCYFSGLATQTIRDPSYGSCKFPSVTL  418



>ref|XP_009777271.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
sylvestris]
Length=466

 Score =   282 bits (721),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 153/172 (89%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KKFT+K  VGTPA+PGV++PTL+FALYNENQKPGPGTERHFG+LYPNGTNIY IDLSGK
Sbjct  295  IKKFTAKPPVGTPAKPGVIVPTLLFALYNENQKPGPGTERHFGLLYPNGTNIYEIDLSGK  354

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TP SE+ PLP+P  N+PYKGK+WCVV   A++T V+ AL+YACGQGNRTC+ I+PGG CY
Sbjct  355  TPLSEYEPLPRPRNNEPYKGKIWCVVGRKASVTEVSGALAYACGQGNRTCDEIRPGGKCY  414

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             PNSL+ HA+YAFSSYWAQF+S GGTCYFNGLA+ T +DPSYGACK+PS+TL
Sbjct  415  KPNSLVLHANYAFSSYWAQFKSAGGTCYFNGLAIPTKSDPSYGACKFPSVTL  466



>ref|XP_009610543.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
tomentosiformis]
Length=465

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 152/172 (88%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KKFT+K  VGTPA+PGVV+PTL+FALYNEN+KPGPGTERHFG+LYPNGTNIY IDLSGK
Sbjct  294  IKKFTAKPPVGTPAKPGVVVPTLLFALYNENEKPGPGTERHFGLLYPNGTNIYGIDLSGK  353

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T  SE+ PLP+P  N+PYKGK+WCVV   A++T V+ AL+YACGQGNRTC+ I+PGG CY
Sbjct  354  TSLSEYEPLPRPRNNEPYKGKIWCVVGRKASVTEVSGALAYACGQGNRTCDEIRPGGKCY  413

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             PNSL+ HA+YAFSSYWAQF+S GGTCYFNGLA+ T +DPSYGACK+PS+TL
Sbjct  414  KPNSLVLHANYAFSSYWAQFKSAGGTCYFNGLAIPTKSDPSYGACKFPSVTL  465



>ref|XP_006366999.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Solanum tuberosum]
Length=464

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 149/172 (87%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KKFT+K  +GTPA+PGVV+PTL+FALYNENQKPGPGTERHFG+LYPNGTN+Y IDLSGK
Sbjct  293  IKKFTAKPPIGTPAKPGVVVPTLLFALYNENQKPGPGTERHFGLLYPNGTNVYGIDLSGK  352

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TPESE+  LP+   N+PYKGK+WCVV   AN + +  A+SYACGQGNRTC+ I+PGG CY
Sbjct  353  TPESEYKALPRARNNEPYKGKIWCVVGRNANASELGGAMSYACGQGNRTCDEIRPGGKCY  412

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            NPNSL+ HA+YAFSSYW+QF+S GGTCYFNGL + T  DPSYG+CK+PS+TL
Sbjct  413  NPNSLVSHANYAFSSYWSQFKSSGGTCYFNGLTIPTKKDPSYGSCKFPSVTL  464



>ref|XP_004247041.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Solanum 
lycopersicum]
Length=464

 Score =   275 bits (702),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 149/172 (87%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KKFT K  +GTPA+PGVV+PTL+FALYNENQKPGPGTERHFG+LYPNGTNIY IDLSGK
Sbjct  293  IKKFTVKPPIGTPAKPGVVVPTLLFALYNENQKPGPGTERHFGLLYPNGTNIYGIDLSGK  352

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TPESE+  LP+   N+PY GK+WCVV+ +AN + +  A+SYACGQGNRTC+ IQPGG CY
Sbjct  353  TPESEYKALPRARNNEPYTGKIWCVVSRSANASELGGAMSYACGQGNRTCDEIQPGGKCY  412

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            NPNSL+ HA+YAFSSYW+QF+S GGTCYFNGL + T  DPSYG+CK+PS+TL
Sbjct  413  NPNSLVSHANYAFSSYWSQFKSSGGTCYFNGLTIPTKKDPSYGSCKFPSVTL  464



>ref|XP_006484802.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Citrus sinensis]
Length=466

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 145/172 (84%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK T+K  +GTPARPG V+P+ IFALYNENQKPGPGTERHFG+LYPNG+++Y IDLSG 
Sbjct  295  VKKLTAKRAIGTPARPGWVLPSFIFALYNENQKPGPGTERHFGLLYPNGSHVYEIDLSGN  354

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             PE E+ PLPKPT N+PYKGK+WCV A  AN TA++ ALSYAC QGN+TC+PIQPG  C 
Sbjct  355  APEKEYEPLPKPTNNEPYKGKIWCVAAKVANTTALSSALSYACSQGNKTCDPIQPGKPCA  414

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P SL+  ASYAFSSYW+QFR LGGTCYFNGLA +TI DPS+G+CK+PS+TL
Sbjct  415  KPGSLVWKASYAFSSYWSQFRKLGGTCYFNGLATQTIKDPSHGSCKFPSVTL  466



>gb|KHG25787.1| putative glucan endo-1,3-beta-glucosidase A6 -like protein [Gossypium 
arboreum]
Length=461

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 144/172 (84%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK T+K  +GTPARPG VIP+LIFALYNENQKPGPGTERHFG+LYPNGTN+Y IDLSGK
Sbjct  290  VKKLTAKPPIGTPARPGWVIPSLIFALYNENQKPGPGTERHFGLLYPNGTNVYGIDLSGK  349

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TP+S F PLPKP  N+PYKGK+WCV A   N TA++ ALSYAC QGN+TC+PIQPG  C+
Sbjct  350  TPDSCFEPLPKPDNNEPYKGKIWCVAAKGVNETALSSALSYACSQGNKTCDPIQPGKKCF  409

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+SL  HASYAFSSYW+Q+R  G TCYFNGLA +T  DPS+G CK+PS+TL
Sbjct  410  KPDSLFWHASYAFSSYWSQYRKTGATCYFNGLATQTAKDPSFGHCKFPSVTL  461



>ref|XP_006437250.1| hypothetical protein CICLE_v10031440mg [Citrus clementina]
 gb|ESR50490.1| hypothetical protein CICLE_v10031440mg [Citrus clementina]
Length=466

 Score =   269 bits (688),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 145/172 (84%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK T+K  +GTPARPG V+P+ IFALYNENQKPGPGTERHFG+LYPNG+++Y IDLSG 
Sbjct  295  VKKLTAKPAIGTPARPGWVLPSFIFALYNENQKPGPGTERHFGLLYPNGSHVYEIDLSGN  354

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             PE E+ PLPKPT N+PYKGK+WCV A  AN TA++ ALSYAC QGN+TC+PIQPG  C 
Sbjct  355  APEKEYGPLPKPTNNEPYKGKIWCVAAKVANTTALSSALSYACSQGNKTCDPIQPGKPCA  414

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P SL+  ASYAFSSYW+QFR LGGTCYFNGLA +TI DPS+G+CK+PS+TL
Sbjct  415  KPGSLVWKASYAFSSYWSQFRKLGGTCYFNGLATQTIKDPSHGSCKFPSVTL  466



>ref|XP_003632052.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Vitis 
vinifera]
 emb|CBI39470.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   269 bits (687),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 146/172 (85%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +K+  +K  VGTPARPG V+PT IF+LYNENQK GPGTERH+G+LYPN +++Y IDL+G+
Sbjct  296  IKRLNAKPPVGTPARPGSVLPTFIFSLYNENQKGGPGTERHWGLLYPNESSVYQIDLTGE  355

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TPESE+PPLP P  N+PYKGK+WCVVA  AN T +  AL+YACGQGN TC P+QPG  CY
Sbjct  356  TPESEYPPLPAPENNEPYKGKIWCVVAKGANRTELGSALTYACGQGNGTCEPVQPGRKCY  415

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P SL+RHAS+AFSSYWAQFRS GGTCYFNGLAV+T+ DPSYG+CK+PS+TL
Sbjct  416  KPVSLVRHASFAFSSYWAQFRSTGGTCYFNGLAVQTMKDPSYGSCKFPSVTL  467



>gb|KJB10880.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=386

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 142/172 (83%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK T+K  +GTPARPG VIP+LIFALYNENQKPGPGTERHFG+LYPNGT IY IDLSGK
Sbjct  215  VKKLTAKPPIGTPARPGWVIPSLIFALYNENQKPGPGTERHFGLLYPNGTKIYGIDLSGK  274

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TP+S F PLPKP  N+PYKGK+WCV A   N TA++ ALSYAC QGN+TC+PIQPG  C+
Sbjct  275  TPDSCFEPLPKPDNNEPYKGKIWCVAAKGVNETALSSALSYACSQGNKTCDPIQPGKKCF  334

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+SL  HASYAFSSYW+Q R  G TCYFNGLA +T  DPS+G CK+PS+TL
Sbjct  335  KPDSLFWHASYAFSSYWSQSRKTGATCYFNGLATQTAKDPSFGHCKFPSVTL  386



>gb|KJB10878.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=461

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 142/172 (83%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK T+K  +GTPARPG VIP+LIFALYNENQKPGPGTERHFG+LYPNGT IY IDLSGK
Sbjct  290  VKKLTAKPPIGTPARPGWVIPSLIFALYNENQKPGPGTERHFGLLYPNGTKIYGIDLSGK  349

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TP+S F PLPKP  N+PYKGK+WCV A   N TA++ ALSYAC QGN+TC+PIQPG  C+
Sbjct  350  TPDSCFEPLPKPDNNEPYKGKIWCVAAKGVNETALSSALSYACSQGNKTCDPIQPGKKCF  409

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+SL  HASYAFSSYW+Q R  G TCYFNGLA +T  DPS+G CK+PS+TL
Sbjct  410  KPDSLFWHASYAFSSYWSQSRKTGATCYFNGLATQTAKDPSFGHCKFPSVTL  461



>ref|XP_007049652.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
 gb|EOX93809.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
Length=328

 Score =   262 bits (669),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 142/172 (83%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+K  +GTPARPG V+P+ IFALYNENQKPGPGTERHFG+LYPNG+N+Y IDLSG+
Sbjct  157  IKKLTAKPAIGTPARPGWVLPSFIFALYNENQKPGPGTERHFGLLYPNGSNVYGIDLSGE  216

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TP+S+F PLPKP  N+PYKGK+WCV A   N + +  ALSYAC QGN+TC+PIQPG  C+
Sbjct  217  TPDSDFEPLPKPDNNEPYKGKIWCVAARGVNASELGSALSYACSQGNKTCDPIQPGKECF  276

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+SL+ HASYAFSSYW+Q +  G TCYFNGLA +T  DPS+G CK+PS+TL
Sbjct  277  KPDSLVWHASYAFSSYWSQLKQTGATCYFNGLATQTAKDPSFGHCKFPSVTL  328



>gb|KEH22560.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=386

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 143/172 (83%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK   K  VGTPARPG+++P+ +FAL+NEN KPGPGTERHFG+LYPNG+ +Y IDLSGK
Sbjct  215  VKKVMKKPIVGTPARPGLILPSFLFALFNENIKPGPGTERHFGLLYPNGSRVYDIDLSGK  274

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TPE EFP LP P  N+PYKGK+WCV    +N+TA+ +AL+YAC QGNRTC+P+QPG  C+
Sbjct  275  TPEVEFPALPPPENNEPYKGKIWCVAVRGSNVTALGEALTYACSQGNRTCDPVQPGKKCF  334

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+S+  HASYAFSSYWAQF+ +GGTCYFNGLA +T  DPSYG+CK+PS+TL
Sbjct  335  KPDSVFWHASYAFSSYWAQFKKIGGTCYFNGLATQTAKDPSYGSCKFPSVTL  386



>ref|XP_007199923.1| hypothetical protein PRUPE_ppa006984mg [Prunus persica]
 gb|EMJ01122.1| hypothetical protein PRUPE_ppa006984mg [Prunus persica]
Length=387

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 145/172 (84%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKKF +K  VGTPARPG V+P+ +FALYNEN+KPGP TER+FG+LYPNG+N+YPIDLSGK
Sbjct  216  VKKFNAKPPVGTPARPGSVLPSFLFALYNENKKPGPSTERNFGLLYPNGSNVYPIDLSGK  275

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TPESE+ PLP  T N PYKG +WC+VA  AN +AVA ALSYAC QGN+TC+PIQPGG C+
Sbjct  276  TPESEYGPLPVATNNVPYKGPIWCLVAKGANRSAVASALSYACSQGNKTCDPIQPGGKCF  335

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+SL+ HASYAFS+YWAQFR +GG+CYF GLA +TI DPSYG+CK+P   L
Sbjct  336  KPDSLVWHASYAFSAYWAQFRKVGGSCYFGGLATQTIKDPSYGSCKFPGAKL  387



>gb|KHG02504.1| putative glucan endo-1,3-beta-glucosidase A6 -like protein [Gossypium 
arboreum]
Length=464

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 142/172 (83%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+K  VGTPARPG V+P+ IFALYNENQKPGPGTERHFG+LYPNG+N+Y IDLSGK
Sbjct  293  IKKLTAKPPVGTPARPGRVLPSFIFALYNENQKPGPGTERHFGLLYPNGSNVYAIDLSGK  352

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TP+S + PLPKPT N+PYKGK+WCV A   N + +  ALSYAC QGN+TC+PIQPG  C+
Sbjct  353  TPDSAYEPLPKPTNNEPYKGKIWCVAARGVNASELGSALSYACSQGNKTCDPIQPGKECF  412

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+SL+ HASYAFSSYW+QF+  G TCYFNGLA  T  DPS+G CK+PS+TL
Sbjct  413  KPDSLVWHASYAFSSYWSQFKKTGATCYFNGLATPTAKDPSFGRCKFPSVTL  464



>ref|XP_008244679.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Prunus 
mume]
Length=462

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 146/172 (85%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKKF +K  VGTPARPG V+P+ +FALYNEN+KPGP TER+FG+LYPNG+N+YPIDLSGK
Sbjct  291  VKKFNAKPPVGTPARPGSVLPSFLFALYNENKKPGPSTERNFGLLYPNGSNVYPIDLSGK  350

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TPESE+ PLP  T N PYKG +WC+VA  AN +AVA ALSYAC QGN+TC+PIQPGG C+
Sbjct  351  TPESEYGPLPAATNNVPYKGPIWCLVAKGANRSAVASALSYACSQGNKTCDPIQPGGKCF  410

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+SL+ HASYAFS+YWAQFR++GG+CYF GLA +TI DPS+G+CK+P   L
Sbjct  411  KPDSLVWHASYAFSAYWAQFRNVGGSCYFGGLATQTIKDPSFGSCKFPGAKL  462



>ref|XP_007049651.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOX93808.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=461

 Score =   263 bits (673),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 142/172 (83%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+K  +GTPARPG V+P+ IFALYNENQKPGPGTERHFG+LYPNG+N+Y IDLSG+
Sbjct  290  IKKLTAKPAIGTPARPGWVLPSFIFALYNENQKPGPGTERHFGLLYPNGSNVYGIDLSGE  349

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TP+S+F PLPKP  N+PYKGK+WCV A   N + +  ALSYAC QGN+TC+PIQPG  C+
Sbjct  350  TPDSDFEPLPKPDNNEPYKGKIWCVAARGVNASELGSALSYACSQGNKTCDPIQPGKECF  409

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+SL+ HASYAFSSYW+Q +  G TCYFNGLA +T  DPS+G CK+PS+TL
Sbjct  410  KPDSLVWHASYAFSSYWSQLKQTGATCYFNGLATQTAKDPSFGHCKFPSVTL  461



>gb|KEH22559.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=463

 Score =   263 bits (672),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 143/172 (83%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK   K  VGTPARPG+++P+ +FAL+NEN KPGPGTERHFG+LYPNG+ +Y IDLSGK
Sbjct  292  VKKVMKKPIVGTPARPGLILPSFLFALFNENIKPGPGTERHFGLLYPNGSRVYDIDLSGK  351

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TPE EFP LP P  N+PYKGK+WCV    +N+TA+ +AL+YAC QGNRTC+P+QPG  C+
Sbjct  352  TPEVEFPALPPPENNEPYKGKIWCVAVRGSNVTALGEALTYACSQGNRTCDPVQPGKKCF  411

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+S+  HASYAFSSYWAQF+ +GGTCYFNGLA +T  DPSYG+CK+PS+TL
Sbjct  412  KPDSVFWHASYAFSSYWAQFKKIGGTCYFNGLATQTAKDPSYGSCKFPSVTL  463



>ref|XP_002534357.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF28022.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=388

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 144/173 (83%), Gaps = 3/173 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VK+ T+K  +GTPARPG  +PT IFALYNENQKPGPGTERHFG+LYPNG+NIY IDLSG+
Sbjct  215  VKRLTTKPAIGTPARPGSGLPTFIFALYNENQKPGPGTERHFGLLYPNGSNIYEIDLSGE  274

Query  509  TPESEF-PPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGAC  333
            T +SE+  PLP PT N+PYKGK+WCVVA  AN TAVA AL+YAC QGN+TC+PIQPG  C
Sbjct  275  TLDSEYKEPLPVPTNNEPYKGKIWCVVAKGANKTAVAGALTYACSQGNKTCDPIQPGKQC  334

Query  332  YNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            + P SL  HASYAFSSYWAQF+ +GGTC FNGLA +T+ DPS+G CK PS+TL
Sbjct  335  FKPESLYWHASYAFSSYWAQFKKIGGTCQFNGLATQTVMDPSFGHCKLPSVTL  387



>ref|XP_008460404.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Cucumis 
melo]
Length=465

 Score =   261 bits (667),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 142/172 (83%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VK+ TSK  VGTPARPG V+PT+IF+LYNEN+K GPGTERHFG+LYP+G  +Y +DLSG 
Sbjct  292  VKRMTSKPPVGTPARPGRVLPTIIFSLYNENEKGGPGTERHFGLLYPSGKAVYEMDLSGS  351

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T E++F PLP+  TN+PYKG++WCVV    N++ V  ALSYAC QGN+TC PI+ GG CY
Sbjct  352  TAETKFKPLPEAETNEPYKGRIWCVVGKGVNMSEVVGALSYACSQGNKTCEPIRKGGPCY  411

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+SL RHAS+AFSSYWAQFR +GGTCYFNGLA +TI DPSYG CK+PS+TL
Sbjct  412  EPDSLKRHASFAFSSYWAQFRKIGGTCYFNGLATQTIKDPSYGKCKFPSVTL  463



>ref|XP_010100789.1| putative glucan endo-1,3-beta-glucosidase A6 [Morus notabilis]
 gb|EXB84487.1| putative glucan endo-1,3-beta-glucosidase A6 [Morus notabilis]
Length=470

 Score =   261 bits (667),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 144/175 (82%), Gaps = 5/175 (3%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK ++K  VGTPARPG V+P+ IFALYNENQKPGPGTERHFG+LYP+G NIYPI+LSG+
Sbjct  296  VKKLSAKPPVGTPARPGSVLPSFIFALYNENQKPGPGTERHFGLLYPSGKNIYPINLSGE  355

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAA---NLTAVADALSYACGQGNRTCNPIQPGG  339
            TP S++PPLP P  N PYKGK+WCVVA  A   N T +A ALSYAC QGN+TC+ IQPGG
Sbjct  356  TPLSDYPPLPAPENNTPYKGKIWCVVAKEAMRGNKTELAAALSYACSQGNKTCDAIQPGG  415

Query  338  ACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             C  P+SL+R ASYAFSSYWAQF+ LGG CYFNGLAV+T  DPSYG CKY S+TL
Sbjct  416  ICSRPDSLVRRASYAFSSYWAQFKKLGGGCYFNGLAVQTTKDPSYGYCKYASVTL  470



>ref|XP_010246533.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=466

 Score =   261 bits (667),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +++ TSK  +GTPARPGVVIPT IFALYNENQK GPGTERH+G+L P+GT++Y +DL+GK
Sbjct  293  IRRMTSKPAIGTPARPGVVIPTFIFALYNENQKGGPGTERHWGLLNPDGTSVYEVDLTGK  352

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             PE ++ PLP P  N+PYKGK+WCVVA  AN TA+  A+ YACGQGN TC  I+PG  CY
Sbjct  353  RPEFDYKPLPAPLNNEPYKGKIWCVVARGANRTALGSAIKYACGQGNGTCEEIRPGSDCY  412

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P SL+RHASYAFSSYWAQFR  GGTCYFNGLAV+T  DP +G+CKYPS+TL
Sbjct  413  EPVSLVRHASYAFSSYWAQFRKFGGTCYFNGLAVQTTKDPGHGSCKYPSVTL  464



>gb|KJB84083.1| hypothetical protein B456_N004800 [Gossypium raimondii]
Length=464

 Score =   261 bits (666),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+K  VGTPARPG V+P+ IFALYNENQKPGPGTERHFG+LYPNG+N+Y IDLSGK
Sbjct  293  IKKLTAKPPVGTPARPGRVLPSFIFALYNENQKPGPGTERHFGLLYPNGSNVYGIDLSGK  352

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TP+S + PLPKPT ++PYKGKVWCV A   N + +  ALSYAC QGN+TC+PIQ G  C+
Sbjct  353  TPDSAYEPLPKPTNDEPYKGKVWCVAARRVNASELGSALSYACSQGNKTCDPIQSGKECF  412

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+SL+ HASYAFSSYW+QF+  G TCYFNGLA  T  DPS+G CK+PS+TL
Sbjct  413  KPDSLVWHASYAFSSYWSQFKKTGATCYFNGLATPTAKDPSFGRCKFPSVTL  464



>ref|XP_009372203.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Pyrus 
x bretschneideri]
Length=463

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 143/172 (83%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKKF +K  VGTPARPGVV+P+ IFAL+NEN KPGP TER+FG+LYPNG+++YPIDLSGK
Sbjct  292  VKKFNAKPPVGTPARPGVVLPSFIFALFNENTKPGPSTERNFGLLYPNGSHVYPIDLSGK  351

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TP SE+PPLP    N+PY+G +WC+VA  AN +AVA ALSYAC QGN+TC+PIQPGG C+
Sbjct  352  TPLSEYPPLPAAKNNKPYEGPIWCIVAKGANRSAVASALSYACSQGNKTCDPIQPGGKCF  411

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+SL  HASYAFS+YWAQFR  GG+CYF GLA +TI DPSYG+CK+P   L
Sbjct  412  KPDSLFWHASYAFSAYWAQFRKAGGSCYFGGLATQTIKDPSYGSCKFPGAKL  463



>ref|XP_011089044.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Sesamum 
indicum]
Length=461

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 142/172 (83%), Gaps = 6/172 (3%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKKF +K  +GTPARPG VIPT+IFALYNENQKPGPGTER+FG+LYPNG+++YPIDLSGK
Sbjct  294  VKKFMAKPPIGTPARPGAVIPTMIFALYNENQKPGPGTERNFGLLYPNGSHVYPIDLSGK  353

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T  S++PPL KP  N    GK+WCVVA  AN TA+  ALSYAC QGNRTC+PIQPGG CY
Sbjct  354  TQVSDYPPLAKPANN----GKLWCVVAEGANKTALTGALSYACSQGNRTCDPIQPGGKCY  409

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             PNSLI+HASYAFSSYWAQ R+ G TC F+GLAV    DPSYGACKYPS+ L
Sbjct  410  KPNSLIKHASYAFSSYWAQMRAAGATCSFSGLAVMISKDPSYGACKYPSVNL  461



>ref|XP_004144397.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cucumis sativus]
 ref|XP_004167264.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cucumis sativus]
 gb|KGN58384.1| hypothetical protein Csa_3G634360 [Cucumis sativus]
Length=466

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 140/172 (81%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VK+ TSK  VGTPARPG ++PT+IF+LYNENQKPGPGTERHFG+LYP G  +Y +DLSG 
Sbjct  292  VKRVTSKPPVGTPARPGRMLPTIIFSLYNENQKPGPGTERHFGLLYPKGKAVYEMDLSGS  351

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
              E++F PLP+   N+PYKGK+WCVV    N++ V  ALSYAC QGN+TC PI+ GG CY
Sbjct  352  RAETKFKPLPEAERNEPYKGKIWCVVGKGVNMSDVVGALSYACSQGNKTCEPIRKGGPCY  411

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+SL RHAS+AFSSYWAQFR +GGTCYFNGLA +TI DPSYG CK+PS+TL
Sbjct  412  EPDSLKRHASFAFSSYWAQFRKVGGTCYFNGLATQTIKDPSYGKCKFPSVTL  463



>ref|XP_008356234.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=524

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 142/172 (83%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKKF +K  VGTPARPG V+P+ +FAL+NEN KPGP TER+FG LYPNG+N+YPIDLSGK
Sbjct  344  VKKFNAKPPVGTPARPGAVLPSFVFALFNENTKPGPSTERNFGFLYPNGSNVYPIDLSGK  403

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TPESE+ PLP  T N+PYKG +WC+VA  AN +AVA ALSYAC QGN+TC+PIQPGG C+
Sbjct  404  TPESEYAPLPVATNNEPYKGPIWCMVAKGANQSAVASALSYACSQGNKTCDPIQPGGKCF  463

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+SL  HASYAFS+YW+QFR  GG+CYF GLA +TI DPSYG+CK+P   L
Sbjct  464  KPDSLAWHASYAFSAYWSQFRKAGGSCYFGGLATQTIKDPSYGSCKFPGAKL  515



>ref|XP_004290162.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Fragaria 
vesca subsp. vesca]
Length=463

 Score =   259 bits (662),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 142/168 (85%), Gaps = 2/168 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KKFT+K  VGTPARPGVV+P+ IFALYNEN KPGPGTER+FG+LYPNG+N+Y IDL+GK
Sbjct  292  IKKFTAKPPVGTPARPGVVLPSFIFALYNENMKPGPGTERNFGLLYPNGSNVYEIDLTGK  351

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TP  EF PLP  T N+PY G +WC+V   AN TAVA+ALSYAC QGN+TC+PIQPGG C+
Sbjct  352  TPVLEFKPLPPATNNKPYPGPIWCLVKEGANKTAVAEALSYACSQGNKTCDPIQPGGKCF  411

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYP  186
             PN+L +HASYAFS+YWAQFR  GG+C F GLAV+TI DPSYG+CKYP
Sbjct  412  KPNTLAQHASYAFSAYWAQFRKAGGSCSFGGLAVQTIKDPSYGSCKYP  459



>ref|XP_004492271.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cicer arietinum]
Length=463

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            ++K   K  VGTPARPG+++P+ +FAL+NEN KPGPGTER+FG+LYPNG+ +Y IDL GK
Sbjct  292  IRKVMKKPVVGTPARPGLILPSFLFALFNENIKPGPGTERNFGLLYPNGSRVYEIDLFGK  351

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TPES+FP LP P  N+PYKGK+WCV A  +NLT + +ALSYAC QGNRTC+ +QPG  C+
Sbjct  352  TPESDFPALPPPENNEPYKGKIWCVAARGSNLTELGEALSYACSQGNRTCDAVQPGKKCF  411

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYAFSSYWAQF+ +GGTCYFNGLA +T  DPSYG+CK+PS+TL
Sbjct  412  KPESIFWHASYAFSSYWAQFKKIGGTCYFNGLATQTAKDPSYGSCKFPSVTL  463



>ref|XP_010036769.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Eucalyptus 
grandis]
 gb|KCW48410.1| hypothetical protein EUGRSUZ_K02113 [Eucalyptus grandis]
 gb|KCW48411.1| hypothetical protein EUGRSUZ_K02113 [Eucalyptus grandis]
Length=466

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 143/172 (83%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK +++  +GTPARPG V+P+ +FALYNENQK GPGTERHFG+LYPN + +Y IDLSG+
Sbjct  295  VKKLSARPAIGTPARPGWVLPSFMFALYNENQKTGPGTERHFGLLYPNDSFVYDIDLSGE  354

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TP++E+  LP PT N+PY+GK+WCVVA  AN +A+A ALSYAC QGN TC PIQPG AC+
Sbjct  355  TPDTEYGKLPAPTNNEPYEGKIWCVVAKRANRSALASALSYACSQGNATCGPIQPGKACH  414

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
               SL+R ASYAFSSYWAQFR  GG+CYFNGLA +TI DPSYG+C++P++TL
Sbjct  415  RKGSLVRQASYAFSSYWAQFRKTGGSCYFNGLATQTIEDPSYGSCEFPAVTL  466



>ref|XP_006386885.1| 3-glucanase family protein [Populus trichocarpa]
 gb|ERP64682.1| 3-glucanase family protein [Populus trichocarpa]
Length=465

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 138/173 (80%), Gaps = 3/173 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+K  +GTPARPG VIP++IFALYNENQKPGPGTERHFG+LYPNGT IY IDLSG 
Sbjct  293  IKKLTTKPAIGTPARPGWVIPSIIFALYNENQKPGPGTERHFGLLYPNGTKIYEIDLSGD  352

Query  509  TPESEF-PPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGAC  333
            TP SE+  PLP PT N+PYKGK+WC+VA   N TAV DALSYAC QGN+TC+ IQ G  C
Sbjct  353  TPLSEYTKPLPAPTNNEPYKGKIWCMVAKGVNETAVGDALSYACSQGNKTCDAIQTGKEC  412

Query  332  YNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            Y P+SL  HASYAFSSYWAQF+  GGTC FNGLA  T  DPS+G CK+P  TL
Sbjct  413  YKPDSLFWHASYAFSSYWAQFKKSGGTCSFNGLATMTPKDPSFGHCKFPGTTL  465



>ref|XP_011024595.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=465

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 138/173 (80%), Gaps = 3/173 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK T+K  +GTPARPG VIP++IFALYNENQKPGPGTERHFG+LYPNGT IY IDLSG 
Sbjct  293  VKKLTTKPAIGTPARPGWVIPSIIFALYNENQKPGPGTERHFGLLYPNGTKIYEIDLSGD  352

Query  509  TPESEFP-PLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGAC  333
            TP SE+  PLP PT N+PYKGK+WC+VA   N TAV DALSYAC QGN TC+ IQ G  C
Sbjct  353  TPLSEYKKPLPAPTNNEPYKGKIWCMVAKGVNETAVRDALSYACSQGNGTCDAIQTGKKC  412

Query  332  YNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            Y P+SL  HASYAFSSYWAQF+  GGTC FNGLA  T  DPS+G CK+P +TL
Sbjct  413  YKPDSLFWHASYAFSSYWAQFKKSGGTCSFNGLATMTPKDPSFGHCKFPGVTL  465



>dbj|BAA89481.1| beta-1,3-glucanase [Salix gilgiana]
Length=478

 Score =   254 bits (648),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 138/173 (80%), Gaps = 3/173 (2%)
 Frame = -1

Query  683  VKKFTS--KVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK T+   +GTPARPGV IP  IF+LYNENQKPGPGTERHFG+ YPNGT ++ IDLSGK
Sbjct  306  VKKLTTIPAIGTPARPGVAIPAFIFSLYNENQKPGPGTERHFGLYYPNGTEVFEIDLSGK  365

Query  509  TPESEFP-PLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGAC  333
            TP S +  PLP PT N+PYKGK+WCVVA  AN +AV DAL++AC QGN+TC+ IQPG  C
Sbjct  366  TPLSGYKKPLPLPTNNEPYKGKLWCVVAKEANRSAVKDALAWACSQGNKTCDEIQPGKEC  425

Query  332  YNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            Y P SL RHASYAFSSYWA+F+ +GG C FNGLA  T  DPS+G CK+PS+TL
Sbjct  426  YKPVSLFRHASYAFSSYWAEFKKIGGVCSFNGLATTTFKDPSFGQCKFPSVTL  478



>gb|KDP45279.1| hypothetical protein JCGZ_15144 [Jatropha curcas]
Length=464

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 139/173 (80%), Gaps = 3/173 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VK+ T+K  +GTPARPG VIP+ IFA+YNENQKPGPGTERHFG+LYPNG+ +Y IDLSG+
Sbjct  292  VKRLTAKPAIGTPARPGSVIPSFIFAMYNENQKPGPGTERHFGLLYPNGSKVYDIDLSGE  351

Query  509  TPESEF-PPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGAC  333
              ESE+  PLP P  N PY GK+WCVVA  AN TA+ DAL YAC QGN+TC+PIQPG  C
Sbjct  352  KTESEYTKPLPAPINNAPYTGKIWCVVAKGANRTALGDALGYACSQGNKTCDPIQPGKKC  411

Query  332  YNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            + P+S++ HASYAFSS+WAQ R  G TCYFNGLA +T  DPS+G CK+PS++L
Sbjct  412  FKPDSVVWHASYAFSSFWAQMRQAGATCYFNGLATQTTKDPSFGHCKFPSVSL  464



>ref|XP_008382581.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=463

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 140/172 (81%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKKF +K  VGTPARPGVV P+ +FAL+NEN K GP TER+FG+LYPNG+++YPIDLSGK
Sbjct  292  VKKFNAKPPVGTPARPGVVFPSFVFALFNENTKTGPSTERNFGLLYPNGSHVYPIDLSGK  351

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TP SE+PPLP    N+P KG +WC+VA  AN +AVA ALSYAC QGN+TC+PIQPGG C+
Sbjct  352  TPVSEYPPLPAAKNNKPXKGPIWCMVAKGANRSAVASALSYACSQGNKTCDPIQPGGKCF  411

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P++L  HASYAFS+YWAQFR  GG+CYF GLA +TI DPSYG+CK+P   L
Sbjct  412  KPDTLSWHASYAFSAYWAQFRKAGGSCYFGGLATQTIKDPSYGSCKFPGAKL  463



>gb|KJB10879.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=460

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 132/161 (82%), Gaps = 2/161 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK T+K  +GTPARPG VIP+LIFALYNENQKPGPGTERHFG+LYPNGT IY IDLSGK
Sbjct  290  VKKLTAKPPIGTPARPGWVIPSLIFALYNENQKPGPGTERHFGLLYPNGTKIYGIDLSGK  349

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TP+S F PLPKP  N+PYKGK+WCV A   N TA++ ALSYAC QGN+TC+PIQPG  C+
Sbjct  350  TPDSCFEPLPKPDNNEPYKGKIWCVAAKGVNETALSSALSYACSQGNKTCDPIQPGKKCF  409

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  207
             P+SL  HASYAFSSYW+Q R  G TCYFNGLA +T  DPS
Sbjct  410  KPDSLFWHASYAFSSYWSQSRKTGATCYFNGLATQTAKDPS  450



>ref|XP_007140788.1| hypothetical protein PHAVU_008G142200g [Phaseolus vulgaris]
 gb|ESW12782.1| hypothetical protein PHAVU_008G142200g [Phaseolus vulgaris]
Length=465

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T K  VGTPARPG ++P+ +FAL+NENQK GPGTERHFG+L+PNG+ ++ IDLSGK
Sbjct  294  IKKVTRKPRVGTPARPGSLLPSFLFALFNENQKSGPGTERHFGLLHPNGSRVFDIDLSGK  353

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TPES+F PLP P  N+ +KGK+WCV A   N+T +A ALSYAC QGN TC+PIQ  G C+
Sbjct  354  TPESDFQPLPAPENNEKFKGKIWCVAARRDNVTELAAALSYACSQGNGTCDPIQTRGKCF  413

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYAFS+YWAQF+ +G TCYFNGLA +T  DPSYG+CK+PS+TL
Sbjct  414  KPGSVFWHASYAFSAYWAQFKKIGATCYFNGLATQTAKDPSYGSCKFPSVTL  465



>ref|XP_004510238.1| PREDICTED: putative copper-transporting ATPase HMA5-like [Cicer 
arietinum]
Length=1239

 Score =   259 bits (662),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 141/172 (82%), Gaps = 5/172 (3%)
 Frame = -1

Query  683   VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
             VKK T K  VGTPARPG +IP+ IF+LYNEN KPG GTERHFG+LYPNG+++Y IDLSGK
Sbjct  1071  VKKVTKKPSVGTPARPGSIIPSFIFSLYNENLKPGLGTERHFGLLYPNGSSVYEIDLSGK  1130

Query  509   TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             T  SEF PLP P   + YKGK WCVVA  AN TAVA+ALSYAC QGNRTC+P+QPG  C+
Sbjct  1131  TLASEFKPLPPP---ENYKGKAWCVVAEGANETAVAEALSYACSQGNRTCDPVQPGKPCF  1187

Query  329   NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
              P S+I HASYAFSSYWAQFR++GGTC FNGLA++   DPSYG+CKYPS+TL
Sbjct  1188  EPVSVIGHASYAFSSYWAQFRNVGGTCQFNGLAIQIAKDPSYGSCKYPSVTL  1239



>ref|XP_002303070.2| 3-glucanase family protein [Populus trichocarpa]
 gb|EEE82343.2| 3-glucanase family protein [Populus trichocarpa]
Length=465

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 138/173 (80%), Gaps = 3/173 (2%)
 Frame = -1

Query  683  VKKFTS--KVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK T+   +GTPA+PGVVIP  IF+LYNENQKPGPGTER FG+ YPNGT ++ IDLSGK
Sbjct  293  VKKLTTIPAIGTPAQPGVVIPAFIFSLYNENQKPGPGTERQFGLYYPNGTEVFEIDLSGK  352

Query  509  TPESEFP-PLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGAC  333
            TP S +  PLP PT N+PYKGK+WC+VA  AN +AV DAL++AC QGN+TC+ IQPG  C
Sbjct  353  TPLSGYKKPLPLPTNNEPYKGKLWCIVAKEANRSAVKDALAWACSQGNKTCDEIQPGKGC  412

Query  332  YNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            Y P SL  HASYAFSSYWA+F+ +GG C FNGLA  T+ DPS+G CK+PS+TL
Sbjct  413  YKPVSLFWHASYAFSSYWAEFKKIGGVCSFNGLATTTVKDPSFGQCKFPSVTL  465



>gb|KEH18116.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=383

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 134/172 (78%), Gaps = 5/172 (3%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK T K  VGTPARPG ++P+ IFALYNEN K G GTERHFG+LYPNG+ IY IDLSGK
Sbjct  215  VKKVTKKPPVGTPARPGSILPSFIFALYNENLKTGLGTERHFGLLYPNGSRIYEIDLSGK  274

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TPE E+ PLP P     YKGK WCVVA  AN TAV +ALSYAC QGNRTC  +QPG  C+
Sbjct  275  TPEYEYKPLPPP---DDYKGKAWCVVAEGANKTAVVEALSYACSQGNRTCELVQPGKPCF  331

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+S++ HASYAFSSYWAQFR +GGTC FNGLA +   DPSYG+CKYPS+ L
Sbjct  332  EPDSVVGHASYAFSSYWAQFRRVGGTCNFNGLATQIAEDPSYGSCKYPSVIL  383



>ref|XP_010685101.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Beta 
vulgaris subsp. vulgaris]
Length=467

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 140/174 (80%), Gaps = 4/174 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            V++  +K  VGTPA PGVV+PT IFAL+NENQK G GTERH+G+ YP   ++YPIDL+G+
Sbjct  293  VQRLNAKPLVGTPAMPGVVLPTFIFALFNENQKGGQGTERHWGLFYPTEAHVYPIDLTGE  352

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPA--ANLTAVADALSYACGQGNRTCNPIQPGGA  336
            T  + +P LPKP  N+PYKGK+WCVVA A  AN+TA+ DA++YACGQGN TC  IQP G 
Sbjct  353  TDLASYPALPKPKNNEPYKGKIWCVVAEAKGANMTALGDAVTYACGQGNGTCAAIQPKGL  412

Query  335  CYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            CYNP SLI HA+YAFSSYWAQF+S G TC+FNGLAV+T  DPS+G CKYPS+TL
Sbjct  413  CYNPKSLIYHANYAFSSYWAQFKSQGATCFFNGLAVQTTKDPSHGKCKYPSVTL  466



>ref|XP_003626949.1| Beta-1 3-glucanase [Medicago truncatula]
 gb|AET01425.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=463

 Score =   246 bits (628),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 134/172 (78%), Gaps = 5/172 (3%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK T K  VGTPARPG ++P+ IFALYNEN K G GTERHFG+LYPNG+ IY IDLSGK
Sbjct  295  VKKVTKKPPVGTPARPGSILPSFIFALYNENLKTGLGTERHFGLLYPNGSRIYEIDLSGK  354

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TPE E+ PLP P     YKGK WCVVA  AN TAV +ALSYAC QGNRTC  +QPG  C+
Sbjct  355  TPEYEYKPLPPP---DDYKGKAWCVVAEGANKTAVVEALSYACSQGNRTCELVQPGKPCF  411

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+S++ HASYAFSSYWAQFR +GGTC FNGLA +   DPSYG+CKYPS+ L
Sbjct  412  EPDSVVGHASYAFSSYWAQFRRVGGTCNFNGLATQIAEDPSYGSCKYPSVIL  463



>gb|KFK38190.1| hypothetical protein AALP_AA3G081000 [Arabis alpina]
Length=462

 Score =   246 bits (628),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 136/172 (79%), Gaps = 3/172 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK T++  +GTPARPG+V+P+ IFALYNENQK GPGTERHFG+L+PNG+ +Y I+LSGK
Sbjct  292  VKKLTAEPPIGTPARPGLVLPSFIFALYNENQKTGPGTERHFGLLHPNGSQVYEIELSGK  351

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T E +   LP P  N+ YKGK+WCVVA  AN T + DALSYAC QGN TC PIQ GG C+
Sbjct  352  TTEFK-DSLPAPENNELYKGKIWCVVAKGANWTQLRDALSYACSQGNNTCEPIQTGGLCH  410

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+  + HASYAFSSYWAQFR  GGTC FNGLA +TI DPSYG C++PS+TL
Sbjct  411  KPDLTVLHASYAFSSYWAQFRKTGGTCSFNGLATQTIKDPSYGRCEFPSVTL  462



>ref|XP_009147086.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=501

 Score =   247 bits (630),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 3/172 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK  ++  VGTPARPG V+P+ IFALYNENQK GPGTERHFG+L+PNG+ +Y I+LSGK
Sbjct  331  VKKLAAEPPVGTPARPGKVLPSFIFALYNENQKTGPGTERHFGLLHPNGSQVYEIELSGK  390

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T E +   LP P  N+ YKGK+WCVVA  AN T + DALSYAC QGN TC+PI+PGG+C+
Sbjct  391  TTEYK-EALPGPENNEGYKGKIWCVVAKGANWTQLGDALSYACSQGNNTCDPIKPGGSCH  449

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+ ++ HASYAFSSYWA FR +GGTCYFNGLA +TI DP YG C++PS+TL
Sbjct  450  KPDLMVFHASYAFSSYWASFRKVGGTCYFNGLATQTIKDPGYGRCEFPSVTL  501



>emb|CDY28063.1| BnaC05g44650D [Brassica napus]
Length=460

 Score =   245 bits (626),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 138/172 (80%), Gaps = 3/172 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK  ++  VG+PARPG V+P+ IFALYNENQK GPGTERHFG+L+PNG+ +Y I+LSGK
Sbjct  290  VKKLAAEPPVGSPARPGKVLPSFIFALYNENQKTGPGTERHFGLLHPNGSQVYEIELSGK  349

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T E +   LP P  N+ YKGK+WCVVA  AN T + DALSYAC QGN TC+PI+PGG+C+
Sbjct  350  TTEYK-ESLPAPENNEVYKGKIWCVVAKGANWTQLGDALSYACSQGNNTCDPIKPGGSCH  408

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+ ++ HASYAFSSYWA FR +GGTCYFNGLA +TI DP YG C++PS+TL
Sbjct  409  KPDLMVFHASYAFSSYWASFRKVGGTCYFNGLATQTIKDPGYGRCEFPSVTL  460



>emb|CDY45466.1| BnaC09g12840D [Brassica napus]
Length=460

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 138/172 (80%), Gaps = 3/172 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK  ++  VG+PARPG V+P+ IFALYNENQK GPGTERHFG+L+PNG+ +Y I+LSGK
Sbjct  290  VKKLAAEPPVGSPARPGKVLPSFIFALYNENQKTGPGTERHFGLLHPNGSQVYEIELSGK  349

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T E +   LP P  N+ YKGK+WCVVA  AN T + DALSYAC QGN TC+PI+PGG+C+
Sbjct  350  TTEYK-ESLPAPENNEVYKGKIWCVVAKGANWTQLGDALSYACSQGNNTCDPIKPGGSCH  408

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+ ++ HASYAFSSYWA FR +GGTCYFNGLA +TI DP YG C++PS+TL
Sbjct  409  KPDLMVFHASYAFSSYWASFRKVGGTCYFNGLATQTIKDPGYGRCEFPSVTL  460



>ref|XP_010464351.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 136/172 (79%), Gaps = 3/172 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK  ++  VGTPARPG V+P+ +FALYNENQK GPGTERHFG+L+PNGT +Y IDLSGK
Sbjct  291  VKKLAAEPPVGTPARPGKVLPSFVFALYNENQKTGPGTERHFGLLHPNGTQVYGIDLSGK  350

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T E     LP P  N+ YKGK+WCVVA  AN T + +ALSYAC QGN TC+PIQPGG+C+
Sbjct  351  TTEYG-GELPAPENNEVYKGKIWCVVAKGANWTQLGEALSYACSQGNNTCDPIQPGGSCH  409

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+  + HASYAFSSYWAQFR  GGTC FNGLA +TI DPSYG C++PS+TL
Sbjct  410  KPDLAVLHASYAFSSYWAQFRKSGGTCSFNGLATQTIKDPSYGRCEFPSVTL  461



>ref|XP_010486278.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 136/172 (79%), Gaps = 3/172 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK  ++  VGTPARPG V+P+ +FALYNENQK GPGTERHFG+L+PNGT +Y IDLSGK
Sbjct  291  VKKLAAEPPVGTPARPGKVLPSFVFALYNENQKTGPGTERHFGLLHPNGTQVYGIDLSGK  350

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T E     LP P  N+ YKGK+WCVVA  AN T + +ALSYAC QGN TC+PIQPGG+C+
Sbjct  351  TTEYG-GALPAPENNEVYKGKIWCVVAKGANWTQLGEALSYACSQGNNTCDPIQPGGSCH  409

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+  + HASYAFSSYWAQFR  GGTC FNGLA +TI DPSYG C++PS+TL
Sbjct  410  KPDLAVLHASYAFSSYWAQFRKSGGTCSFNGLATQTIKDPSYGRCEFPSVTL  461



>emb|CDY24629.1| BnaA05g30280D [Brassica napus]
Length=460

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 137/172 (80%), Gaps = 3/172 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK  ++  VGTPARPG V+P+ IFALYNENQK GPGTERHFG+L+PNG+ +Y I+LSGK
Sbjct  290  VKKLAAEPPVGTPARPGKVLPSFIFALYNENQKTGPGTERHFGLLHPNGSQVYEIELSGK  349

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T E +   LP P  N+ YKGK+WCVVA  AN T + DALSYAC QGN TC+ I+PGG+C+
Sbjct  350  TTEYK-ESLPAPENNEGYKGKIWCVVAKGANWTQLGDALSYACSQGNNTCDSIKPGGSCH  408

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+ ++ HASYAFSSYWA FR +GGTCYFNGLA +TI DP YG C++PS+TL
Sbjct  409  KPDLMVFHASYAFSSYWASFRKVGGTCYFNGLATQTIKDPGYGRCEFPSVTL  460



>ref|XP_010451138.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 136/172 (79%), Gaps = 3/172 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK  ++  VGTPARPG V+P+ +FALYNENQK GPGTERHFG+L+PNGT +Y IDLSGK
Sbjct  291  VKKLAAEPPVGTPARPGKVLPSFVFALYNENQKTGPGTERHFGLLHPNGTQVYGIDLSGK  350

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T E     LP P  N+ YKGK+WCVVA  AN T + +ALSYAC QGN TC+PIQPGG+C+
Sbjct  351  TTEYG-GALPVPENNEVYKGKIWCVVAKGANWTQLGEALSYACSQGNNTCDPIQPGGSCH  409

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+  + HASYAFSSYWAQFR  GGTC FNGLA +TI DPSYG C++PS+TL
Sbjct  410  KPDLAVLHASYAFSSYWAQFRKSGGTCSFNGLATQTIKDPSYGRCEFPSVTL  461



>ref|XP_010906169.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Elaeis 
guineensis]
Length=222

 Score =   235 bits (600),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 128/163 (79%), Gaps = 3/163 (2%)
 Frame = -1

Query  662  VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPL  483
            +GTPARPG V+P  IFALYNENQKPGPGTERH+G+LYPN T +Y +DL+G+ P+S + PL
Sbjct  59   LGTPARPGAVMPVFIFALYNENQKPGPGTERHWGLLYPNATRVYEVDLTGRLPDSAYGPL  118

Query  482  PKPTTNQPYKGKVWCVVA---PAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLI  312
            P P  N+PYKGK+WCV      + N TAV  A++YACGQG+ TCN IQPGG CY P SL 
Sbjct  119  PLPDNNEPYKGKIWCVFGGGGKSVNATAVGSAIAYACGQGSGTCNAIQPGGQCYRPGSLT  178

Query  311  RHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
              ASYAF+SYW QFR  GGTCYFNGLAV+T  DPSYG+CK+PS
Sbjct  179  ARASYAFNSYWQQFRRSGGTCYFNGLAVQTAQDPSYGSCKFPS  221



>ref|XP_002884642.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60901.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score =   242 bits (618),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 133/172 (77%), Gaps = 3/172 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK  +   VGTPARPG V+P  +FALYNENQK GPGTERHFG+L+PNGT +Y IDLSGK
Sbjct  290  VKKLAADPPVGTPARPGKVLPAFVFALYNENQKTGPGTERHFGLLHPNGTQVYGIDLSGK  349

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T E +   LP P  N+ YKGK+WCVVA  AN T + DALSYAC QGN TC+PIQ GG C+
Sbjct  350  TTEYK-ESLPAPENNEFYKGKIWCVVAKGANWTQLGDALSYACSQGNNTCDPIQRGGPCH  408

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+  + HASYAFSSYWAQFR  GGTC FNGLA +TI DPSYG C++PS+TL
Sbjct  409  KPDLTVLHASYAFSSYWAQFRKTGGTCSFNGLATQTIKDPSYGRCEFPSVTL  460



>ref|XP_010547131.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=460

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 135/172 (78%), Gaps = 3/172 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK T+   VGTPARPG V+P+ IF+LYNENQKPGPGTERHFG+ +PNGT +Y IDLSGK
Sbjct  290  VKKLTADPPVGTPARPGRVLPSFIFSLYNENQKPGPGTERHFGMYHPNGTRVYDIDLSGK  349

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
              E E   LP+P  N+PYKG++WCVVA  AN T + +ALSYAC QGN TC PI+PGG C 
Sbjct  350  RTEYE-DVLPEPENNEPYKGRIWCVVAKGANWTELGEALSYACSQGNNTCAPIRPGGECS  408

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+ ++ HASYAFSSYWAQ R  G TC+FNGLA +TI DPSYG C++PS+TL
Sbjct  409  KPDLIVLHASYAFSSYWAQSRKSGATCFFNGLATQTIKDPSYGRCEFPSVTL  460



>ref|XP_006407848.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
 gb|ESQ49301.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
Length=469

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 134/172 (78%), Gaps = 3/172 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KKF ++  VGTPARPG V+P  IFALYNENQK GPGTERHFG+L+PNGT +Y I+LSGK
Sbjct  299  IKKFAAEPPVGTPARPGEVLPAFIFALYNENQKTGPGTERHFGLLHPNGTQVYEIELSGK  358

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T E +   LP P  N+ YKGK+WCVVA  AN T + DALSYAC QGN TC+PI+PGG C+
Sbjct  359  TTEFK-ESLPAPENNEVYKGKIWCVVAKGANWTQLGDALSYACSQGNNTCDPIKPGGPCH  417

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+  I HASYAFSSYWA FR  G TC FNGLA +TI DPSYG C++PS+TL
Sbjct  418  KPDLTILHASYAFSSYWASFRKTGATCSFNGLATQTIKDPSYGRCEFPSVTL  469



>ref|XP_007134153.1| hypothetical protein PHAVU_010G0238001g, partial [Phaseolus vulgaris]
 gb|ESW06147.1| hypothetical protein PHAVU_010G0238001g, partial [Phaseolus vulgaris]
Length=335

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 135/172 (78%), Gaps = 5/172 (3%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VK+ T    +GTPARPG V+P  IF+LYNEN KPG G+ERHFG+LYPNG+ +Y IDLSG 
Sbjct  167  VKRLTRNPVLGTPARPGSVLPAFIFSLYNENLKPGLGSERHFGLLYPNGSRVYDIDLSGN  226

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TPESE  P+P P  +  YKGK WCVVA  AN+T VA ALSY+C QGN TC+PIQPG  C+
Sbjct  227  TPESELAPVP-PAMD--YKGKAWCVVAEGANVTEVAAALSYSCSQGNGTCDPIQPGHPCF  283

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+S+  HA YAFS+YWAQFR +GGTCYFNGLA +T  DPSYG+CK+PS+TL
Sbjct  284  KPDSVTSHADYAFSAYWAQFRRVGGTCYFNGLATQTAKDPSYGSCKFPSVTL  335



>ref|NP_683538.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AAF02143.1|AC009853_3 putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
 dbj|BAC42699.1| putative beta-1,3-glucanase precursor [Arabidopsis thaliana]
 gb|AAO64098.1| putative glycosyl hydrolase [Arabidopsis thaliana]
 gb|AEE74528.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=460

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 131/172 (76%), Gaps = 4/172 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK  +   VGTPARPG V+P  +FALYNENQK GPGTERHFG+L+PNGT +Y IDLSGK
Sbjct  291  VKKLAADPPVGTPARPGKVLPAFVFALYNENQKTGPGTERHFGLLHPNGTQVYGIDLSGK  350

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T   E   LP P  N  YKGK+WCVVA  AN T + DALSYAC QGN TC+PIQ GG C 
Sbjct  351  TEYKE--SLPAPENNDLYKGKIWCVVAKGANWTQLGDALSYACSQGNNTCDPIQRGGPCQ  408

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+  + HASYAFSSYWAQFR +GGTC FNGLA +TI DPSYG C++PS+TL
Sbjct  409  KPDLTVLHASYAFSSYWAQFRKIGGTCSFNGLATQTIKDPSYGRCEFPSVTL  460



>ref|XP_009385472.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009385473.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Musa 
acuminata subsp. malaccensis]
Length=474

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 131/166 (79%), Gaps = 4/166 (2%)
 Frame = -1

Query  662  VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPL  483
            VGTPARPG V+P  +F+LYNENQKPGPGTERH+G+LYPNG+ +Y +DLSG+ P   +PPL
Sbjct  308  VGTPARPGAVMPVFVFSLYNENQKPGPGTERHWGLLYPNGSKVYEVDLSGRRPLDSYPPL  367

Query  482  PKPTTNQPYKGKVWCVVA----PAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSL  315
            P P  N+PYKGK+WCV       AAN T V  AL+YACGQGN TC+ I+PGG CY PN+L
Sbjct  368  PPPDNNEPYKGKIWCVFGGDRKAAANATTVGAALAYACGQGNGTCDAIRPGGPCYKPNTL  427

Query  314  IRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSIT  177
            + HASYAF+SYW QFR  GGTC+F+GLAV+T  DPSYG CKY S+T
Sbjct  428  LAHASYAFNSYWQQFRQAGGTCFFDGLAVQTKTDPSYGTCKYASLT  473



>ref|XP_010247391.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=466

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 136/172 (79%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +++ TSK   GTPARPGVVIPT IFALYNENQK GPGTERH+G++ P+GT +Y +DL+GK
Sbjct  293  IRRMTSKPPAGTPARPGVVIPTFIFALYNENQKGGPGTERHWGLMNPDGTPVYEVDLNGK  352

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             PE++F  LP P  N+ YKGK+WCVVA  AN T +  A+ +AC  GN TC+ I+PG  CY
Sbjct  353  RPENDFKSLPAPLNNELYKGKIWCVVADGANSTELESAIEFACRLGNNTCDAIRPGSECY  412

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            +P SL+ HASYAFSSYWAQF+  GGTCYFNGLAV+T  DPS G+CK+PS+TL
Sbjct  413  HPVSLVSHASYAFSSYWAQFKQSGGTCYFNGLAVQTTEDPSNGSCKFPSVTL  464



>ref|XP_006297636.1| hypothetical protein CARUB_v10013655mg [Capsella rubella]
 gb|EOA30534.1| hypothetical protein CARUB_v10013655mg [Capsella rubella]
Length=460

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 135/172 (78%), Gaps = 3/172 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK  ++  VGTPARPG V+P+ +FALYNENQK G GTERHFG+L+PNGT +Y IDLSGK
Sbjct  290  VKKLAAEPPVGTPARPGKVLPSFVFALYNENQKTGQGTERHFGLLHPNGTQVYGIDLSGK  349

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T E +   LP P  N+ YKGK+WCVVA  AN T + +ALSYAC QGN+TC+PIQ GG C+
Sbjct  350  TTEYK-ESLPAPENNEVYKGKIWCVVAKGANWTELGEALSYACSQGNKTCDPIQSGGPCH  408

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+  + HASYAFSSYWAQFR  GGTC FNGLA +TI DPSYG C++PS+TL
Sbjct  409  KPDLAVLHASYAFSSYWAQFRKSGGTCSFNGLATQTIKDPSYGRCEFPSVTL  460



>gb|AAM65039.1| putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
Length=460

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 131/172 (76%), Gaps = 4/172 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK  +   VGTPARPG V+P  +FALYNENQK GPGTERHFG+L+PNGT +Y IDLSGK
Sbjct  291  VKKLAADPPVGTPARPGKVLPAFVFALYNENQKTGPGTERHFGLLHPNGTQVYGIDLSGK  350

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
                E   LP P  N+ YKGK+WCVVA  AN T + DALSYAC QGN TC+PIQ GG C 
Sbjct  351  MEYKE--SLPAPDNNELYKGKIWCVVAKGANWTQLGDALSYACSQGNNTCDPIQRGGPCQ  408

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+  + HASYAFSSYWAQFR +GGTC FNGLA +TI DPSYG C++PS+TL
Sbjct  409  KPDLTVLHASYAFSSYWAQFRKIGGTCSFNGLATQTIKDPSYGRCEFPSVTL  460



>ref|XP_011024596.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=465

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 134/172 (78%), Gaps = 3/172 (2%)
 Frame = -1

Query  683  VKKFTS--KVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK  +   +GTPA+PGVVIP  IF+LYNENQKPGPGTER FG+ YPNGT +  IDLSGK
Sbjct  293  VKKLATIPVIGTPAQPGVVIPAFIFSLYNENQKPGPGTERQFGLYYPNGTEVLEIDLSGK  352

Query  509  TPESEFP-PLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGAC  333
            TP S +  PLP PT N+PYKGK+WC+VA  AN +AV DAL++AC QGN TC+ IQPG  C
Sbjct  353  TPLSGYKKPLPLPTNNEPYKGKLWCIVAKEANRSAVKDALAWACSQGNTTCDKIQPGKGC  412

Query  332  YNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSIT  177
            Y P SL  HASYAFSSYWA+F+ +GG C FNGLA  T+ DPS+G CK+PS+T
Sbjct  413  YKPVSLFWHASYAFSSYWAEFKKIGGVCSFNGLATTTVKDPSFGQCKFPSVT  464



>gb|EYU39188.1| hypothetical protein MIMGU_mgv1a006049mg [Erythranthe guttata]
Length=459

 Score =   237 bits (605),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 133/172 (77%), Gaps = 8/172 (5%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKKF +K   GTPARP  VIP++IFALYNENQKPG GTER+FG+LYPNG+N+YPIDLSGK
Sbjct  294  VKKFMAKPPYGTPARPYTVIPSMIFALYNENQKPGQGTERNFGLLYPNGSNVYPIDLSGK  353

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T +S +PPLP P        K+WCV    ANL A+  A+SYAC QGNRTC+PIQPGG C+
Sbjct  354  TRDSRYPPLPNPNR------KLWCVAVKGANLRAMGGAMSYACSQGNRTCDPIQPGGKCF  407

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            NPNSL  HASYAFSSYWAQ    G TC+F+GLA  T  DPS+G+CK+PSI +
Sbjct  408  NPNSLAVHASYAFSSYWAQLWKEGATCFFDGLAFMTSKDPSFGSCKFPSIDI  459



>ref|XP_006407849.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
 gb|ESQ49302.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
Length=470

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 134/173 (77%), Gaps = 4/173 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KKF ++  VGTPARPG V+P  IFALYNENQK GPGTERHFG+L+PNGT +Y I+LSGK
Sbjct  299  IKKFAAEPPVGTPARPGEVLPAFIFALYNENQKTGPGTERHFGLLHPNGTQVYEIELSGK  358

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T E +   LP P  N+ YKGK+WCVVA  AN T + DALSYAC QGN TC+PI+PGG C+
Sbjct  359  TTEFK-ESLPAPENNEVYKGKIWCVVAKGANWTQLGDALSYACSQGNNTCDPIKPGGPCH  417

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS-YGACKYPSITL  174
             P+  I HASYAFSSYWA FR  G TC FNGLA +TI DP+ YG C++PS+TL
Sbjct  418  KPDLTILHASYAFSSYWASFRKTGATCSFNGLATQTIKDPTGYGRCEFPSVTL  470



>emb|CDY08004.1| BnaC03g35190D [Brassica napus]
Length=460

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 136/172 (79%), Gaps = 3/172 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK +++  VGTPARPG V+P+ IFAL+NENQK GPGTERHFG+L+PNG+ +Y I+LSG+
Sbjct  290  VKKLSAEPPVGTPARPGKVLPSFIFALFNENQKTGPGTERHFGLLHPNGSRVYEIELSGE  349

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T E +   LP P  N+ YKGK+WCVVA  AN T + +ALSYAC QGN TC+PI+PGG C+
Sbjct  350  TTEYK-ETLPAPENNEVYKGKIWCVVAKGANWTQLGEALSYACSQGNNTCDPIKPGGPCH  408

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+  + HASYAFSSYWA FR  GGTC FNGLA +TI DPS+G C++PS+TL
Sbjct  409  KPDLTVLHASYAFSSYWASFRKTGGTCSFNGLATQTIKDPSFGRCEFPSVTL  460



>ref|XP_010552026.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=460

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 133/172 (77%), Gaps = 3/172 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK T    VGTPARPG V+P  IF+LYNENQKPGPGTERHFG+  PNG  +Y +DLSGK
Sbjct  290  VKKLTIDPPVGTPARPGRVLPAFIFSLYNENQKPGPGTERHFGLYNPNGNPVYDMDLSGK  349

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T E E   LP+P  N+PYKGK+WCVVA  AN T + +ALSYAC QGN TC+PI+PGG C 
Sbjct  350  TTEYE-DVLPEPGNNEPYKGKIWCVVAKGANWTELGEALSYACSQGNNTCDPIRPGGPCN  408

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P  ++ HAS+AFSSYWA+FR  G TC+FNGLA +T+ DPSYG C++PS+TL
Sbjct  409  KPEFILTHASFAFSSYWAEFRKSGATCHFNGLATQTVKDPSYGRCEFPSVTL  460



>ref|XP_003552101.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=467

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T K  VGTPARPG  +P+ +FAL+NENQKPGP TERHFG+L+PNG+ +Y +DLSG+
Sbjct  296  IKKVTKKPRVGTPARPGSALPSFLFALFNENQKPGPSTERHFGLLHPNGSRVYDVDLSGE  355

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TPE+EF PLP P  N+ +KG++WCV A   N TA+  AL+YAC QGN TC+PIQ  G C+
Sbjct  356  TPEAEFRPLPVPENNEKFKGRIWCVAARRDNATALTAALAYACSQGNGTCDPIQSKGKCF  415

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+S+  HASYAFS+YWAQFR +GGTCYFNGLA +T  DPSYG+CK+PS+TL
Sbjct  416  KPDSVFWHASYAFSAYWAQFRKVGGTCYFNGLATQTAKDPSYGSCKFPSVTL  467



>ref|XP_003530849.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=467

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 140/172 (81%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T K  +GTPARPG  +P+ +FAL+NENQKPGPGTERHFG+L+PNG+ +Y +DLSG+
Sbjct  296  IKKVTRKPWLGTPARPGSALPSFLFALFNENQKPGPGTERHFGLLHPNGSRVYDVDLSGE  355

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TPE+ F PLP P  N+ +KG++WCV A   N TA+A AL+YAC QGN TC+PIQP G C+
Sbjct  356  TPEAGFRPLPVPENNEKFKGEIWCVAARPHNATALAAALAYACSQGNGTCDPIQPKGKCF  415

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+S+  HASYAFS+YWAQFR +GGTCYFNGLA +T  DPSYG+CK+PS+TL
Sbjct  416  KPDSVFWHASYAFSAYWAQFRKVGGTCYFNGLATQTAKDPSYGSCKFPSVTL  467



>ref|XP_008792941.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X3 [Phoenix dactylifera]
Length=389

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 126/163 (77%), Gaps = 3/163 (2%)
 Frame = -1

Query  662  VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPL  483
            +GTPARPG V+P  +FALYNENQKPGPGTERH+G+LYPN T +Y +DL+G+ P++ + PL
Sbjct  226  LGTPARPGAVMPVFVFALYNENQKPGPGTERHWGLLYPNATRVYEVDLTGRRPDASYGPL  285

Query  482  PKPTTNQPYKGKVWCVVA---PAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLI  312
            P P  N+PYKGK+WCV       AN T V  A++YACGQG  TC+ IQPGG CY P S  
Sbjct  286  PAPENNEPYKGKIWCVFGGGKKGANATEVGAAIAYACGQGKGTCDAIQPGGPCYRPASPT  345

Query  311  RHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
             HASYAF+SYW QFR  GGTCYFNGLAV+T  DPS+G+CKYPS
Sbjct  346  AHASYAFNSYWQQFRRSGGTCYFNGLAVQTAQDPSHGSCKYPS  388



>ref|XP_009134961.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=460

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 134/172 (78%), Gaps = 3/172 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK ++   VGTPARPG V+P+ IFAL+NENQK GPGTERHFG+L+PNG+ +Y I+LSG+
Sbjct  290  VKKLSAVPPVGTPARPGKVLPSFIFALFNENQKTGPGTERHFGLLHPNGSRVYEIELSGE  349

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T E +   LP P  N+ YKGK+WCVVA  AN T + +ALSYAC QGN TC+PI+ GG C+
Sbjct  350  TTEFK-EKLPAPENNEVYKGKIWCVVAKGANWTQLGEALSYACSQGNNTCDPIKSGGPCH  408

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+  + HASYAFSSYWA FR  GGTC FNGLA +TI DPS+G C++PS+TL
Sbjct  409  KPDLTVLHASYAFSSYWASFRKTGGTCSFNGLATQTIKDPSFGRCEFPSVTL  460



>ref|XP_006830552.1| hypothetical protein AMTR_s00117p00097230 [Amborella trichopoda]
 gb|ERM97968.1| hypothetical protein AMTR_s00117p00097230 [Amborella trichopoda]
Length=464

 Score =   232 bits (592),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 131/169 (78%), Gaps = 0/169 (0%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            V+K  S +GTP RP   I   IF+LYNEN K GPGTERH+G+LYPNG+ +Y +DL+G+TP
Sbjct  294  VRKLRSNMGTPMRPNQTIFAYIFSLYNENLKGGPGTERHWGLLYPNGSRVYEVDLTGRTP  353

Query  503  ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNP  324
             S++ PLP+P  N+ YKGK+WCVV P AN+TA+  ALSYAC Q N TCN IQ G  C+ P
Sbjct  354  NSKYAPLPEPKNNEQYKGKIWCVVVPGANVTALGPALSYACSQANDTCNAIQRGKKCFMP  413

Query  323  NSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSIT  177
            N+L+ HASYAF+SYW  FR  GGTC+FNGLAV+T  +PSYG+CK+P+++
Sbjct  414  NTLVSHASYAFNSYWQMFRGTGGTCFFNGLAVQTAINPSYGSCKFPTLS  462



>ref|XP_008792940.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Phoenix dactylifera]
Length=467

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 126/163 (77%), Gaps = 3/163 (2%)
 Frame = -1

Query  662  VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPL  483
            +GTPARPG V+P  +FALYNENQKPGPGTERH+G+LYPN T +Y +DL+G+ P++ + PL
Sbjct  304  LGTPARPGAVMPVFVFALYNENQKPGPGTERHWGLLYPNATRVYEVDLTGRRPDASYGPL  363

Query  482  PKPTTNQPYKGKVWCVVA---PAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLI  312
            P P  N+PYKGK+WCV       AN T V  A++YACGQG  TC+ IQPGG CY P S  
Sbjct  364  PAPENNEPYKGKIWCVFGGGKKGANATEVGAAIAYACGQGKGTCDAIQPGGPCYRPASPT  423

Query  311  RHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
             HASYAF+SYW QFR  GGTCYFNGLAV+T  DPS+G+CKYPS
Sbjct  424  AHASYAFNSYWQQFRRSGGTCYFNGLAVQTAQDPSHGSCKYPS  466



>ref|XP_008792939.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Phoenix dactylifera]
Length=470

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 126/163 (77%), Gaps = 3/163 (2%)
 Frame = -1

Query  662  VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPL  483
            +GTPARPG V+P  +FALYNENQKPGPGTERH+G+LYPN T +Y +DL+G+ P++ + PL
Sbjct  307  LGTPARPGAVMPVFVFALYNENQKPGPGTERHWGLLYPNATRVYEVDLTGRRPDASYGPL  366

Query  482  PKPTTNQPYKGKVWCVVA---PAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLI  312
            P P  N+PYKGK+WCV       AN T V  A++YACGQG  TC+ IQPGG CY P S  
Sbjct  367  PAPENNEPYKGKIWCVFGGGKKGANATEVGAAIAYACGQGKGTCDAIQPGGPCYRPASPT  426

Query  311  RHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
             HASYAF+SYW QFR  GGTCYFNGLAV+T  DPS+G+CKYPS
Sbjct  427  AHASYAFNSYWQQFRRSGGTCYFNGLAVQTAQDPSHGSCKYPS  469



>ref|XP_009411847.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=455

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 127/165 (77%), Gaps = 4/165 (2%)
 Frame = -1

Query  659  GTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP  480
            GTPARPG  +P  IF+LYNE++KPGPGTERH+G+L P+G  +Y +DLSG+ P   +PPLP
Sbjct  290  GTPARPGAAMPVFIFSLYNEDRKPGPGTERHWGLLSPDGKQVYEVDLSGRRPLESYPPLP  349

Query  479  KPTTNQPYKGKVWCVV----APAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLI  312
             P  + PY GK+WCV+       AN TAV  AL+YACGQG  TC+ I+PGG CY PN+L+
Sbjct  350  PPENDVPYMGKIWCVLDAEGKATANTTAVGAALAYACGQGTGTCDAIRPGGPCYQPNTLV  409

Query  311  RHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSIT  177
             HASYAF+SYW QFR  GGTC+F+GLAV+T  DPSYG+CKYPS+T
Sbjct  410  THASYAFNSYWQQFRQAGGTCFFDGLAVQTKADPSYGSCKYPSLT  454



>ref|XP_006492526.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Citrus sinensis]
Length=389

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK TSK  +GTPARPG +IPT IF+LY+ENQK GPGTERH+G+L+ NG  IY IDLSG 
Sbjct  218  IKKMTSKPALGTPARPGSIIPTFIFSLYDENQKTGPGTERHWGMLHGNGVPIYEIDLSGN  277

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
               S++ PLP    N PYKGKVWCVVA +A+L A+  AL YACGQGN TC+ + PG  CY
Sbjct  278  RSLSQYRPLPLAHNNVPYKGKVWCVVARSADLLALTSALGYACGQGNGTCDALVPGQRCY  337

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P SL  HASYAFSSYWA+F   G TCYFNGLA +TI +PS G C++PS+TL
Sbjct  338  QPLSLYWHASYAFSSYWAKFMGKGATCYFNGLAQQTIINPSRGNCRFPSVTL  389



>gb|KDP32593.1| hypothetical protein JCGZ_13143 [Jatropha curcas]
Length=479

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 127/172 (74%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK T+   +GTPARPG +IPT IF+LYNEN+K GPGTERH+GV   NG  IY IDLSG+
Sbjct  308  VKKMTANPPMGTPARPGTMIPTFIFSLYNENRKDGPGTERHWGVFNENGKAIYDIDLSGQ  367

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
              ESE+ PLP+   N+PYKGK+WCVV   A L  V   LS  C QGN TC  + PG  CY
Sbjct  368  RQESEYEPLPEGINNRPYKGKLWCVVRREAGLMEVERELSTVCSQGNETCEALAPGNDCY  427

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+I HASYAFSSYWAQFRS G +CYFNGLA +T  DPS+G+CK+PS+T+
Sbjct  428  EPISVIWHASYAFSSYWAQFRSQGASCYFNGLAKQTTTDPSHGSCKFPSVTV  479



>ref|XP_009411846.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=469

 Score =   228 bits (580),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 127/165 (77%), Gaps = 4/165 (2%)
 Frame = -1

Query  659  GTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP  480
            GTPARPG  +P  IF+LYNE++KPGPGTERH+G+L P+G  +Y +DLSG+ P   +PPLP
Sbjct  304  GTPARPGAAMPVFIFSLYNEDRKPGPGTERHWGLLSPDGKQVYEVDLSGRRPLESYPPLP  363

Query  479  KPTTNQPYKGKVWCVV----APAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLI  312
             P  + PY GK+WCV+       AN TAV  AL+YACGQG  TC+ I+PGG CY PN+L+
Sbjct  364  PPENDVPYMGKIWCVLDAEGKATANTTAVGAALAYACGQGTGTCDAIRPGGPCYQPNTLV  423

Query  311  RHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSIT  177
             HASYAF+SYW QFR  GGTC+F+GLAV+T  DPSYG+CKYPS+T
Sbjct  424  THASYAFNSYWQQFRQAGGTCFFDGLAVQTKADPSYGSCKYPSLT  468



>gb|EPS58986.1| hypothetical protein M569_15824, partial [Genlisea aurea]
Length=453

 Score =   226 bits (577),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 132/173 (76%), Gaps = 7/173 (4%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKKF++   VG P+RPG VIP  IFAL+NEN+KPGPGTERHFG LYP+G  +YPIDLSGK
Sbjct  285  VKKFSANPPVGIPSRPGAVIPATIFALFNENKKPGPGTERHFGQLYPDGKFVYPIDLSGK  344

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAA-NLTAVADALSYACGQGNRTCNPIQPGGAC  333
            TP S +PPL KP +N    G++WCVVA    N T++  AL+YACG GN TC+ I+PGG C
Sbjct  345  TPISAYPPLRKPASN----GRLWCVVANGVRNATSLTAALTYACGNGNGTCDGIRPGGKC  400

Query  332  YNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            + P+SLIRHASY FSSYWAQF + G TC FNGLA  T  DPSYG CKYPS+ L
Sbjct  401  FRPDSLIRHASYGFSSYWAQFSAQGATCSFNGLATLTSKDPSYGYCKYPSVNL  453



>ref|XP_006373100.1| hypothetical protein POPTR_0017s08720g [Populus trichocarpa]
 gb|ERP50897.1| hypothetical protein POPTR_0017s08720g [Populus trichocarpa]
Length=466

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 129/172 (75%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            V K T +  +GTPARPG+ IP  IF+LY+ENQK GPGTERH+G+L+PNGT+IY IDL+GK
Sbjct  295  VTKMTGQPLIGTPARPGLFIPAFIFSLYDENQKTGPGTERHWGLLHPNGTSIYQIDLTGK  354

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
               S++ PLP    + PY+GK WCV  P  NLT +  AL++AC QGN TC  + PG  CY
Sbjct  355  RASSDYEPLPATHNDMPYEGKSWCVATPDVNLTELERALTFACSQGNGTCEALTPGKECY  414

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+I HAS+AFSSYWA+FRS G  CYFNGLAV+T +DPS G C++PS+T+
Sbjct  415  EPLSVIWHASFAFSSYWAKFRSQGANCYFNGLAVQTTSDPSRGLCQFPSVTI  466



>ref|XP_002298669.2| glucan endo-1 family protein [Populus trichocarpa]
 gb|EEE83474.2| glucan endo-1 family protein [Populus trichocarpa]
Length=416

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 131/172 (76%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            V+K T+    GTPARPG +IPT IFALY+EN+K GPGTERH+G+L+PNGT+IY IDL+GK
Sbjct  245  VRKMTASNPTGTPARPGSLIPTFIFALYDENRKTGPGTERHWGLLHPNGTSIYQIDLTGK  304

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
               S++  LP    N PYKGK+WC+ AP  NLT +  AL++AC QGN TC+ + PG  CY
Sbjct  305  RASSDYETLPPAQNNVPYKGKLWCIAAPEVNLTELESALTFACNQGNGTCDSLTPGKECY  364

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYAFSSYWA+FRS G  CYFNGLA +T ++PS G+C++PS+T+
Sbjct  365  EPLSVTWHASYAFSSYWAKFRSQGANCYFNGLAQQTTSNPSRGSCQFPSVTI  416



>ref|XP_003632055.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan endo-1,3-beta-glucosidase 
A6 [Vitis vinifera]
Length=474

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 129/172 (75%), Gaps = 3/172 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+K  VGTPARPG+ IPT IFALYNENQK GPGTERH+G+L  NG  +Y +DL+G+
Sbjct  304  IKKMTAKPAVGTPARPGMTIPTFIFALYNENQKRGPGTERHWGLLDCNGKPVYGVDLTGE  363

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
              ES    LP P  N+PY+GK+WCVVA   N   +  AL YAC QGN TC+ + PG  CY
Sbjct  364  L-ESNDDQLPMPQNNKPYQGKIWCVVASEVNPEQLVSALIYACSQGNGTCDALMPGKECY  422

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P SL+ HASYAFSSYWA+FRSLG  CYFNGLAV+T  DPS G+CK+P++TL
Sbjct  423  EPFSLLSHASYAFSSYWAKFRSLGANCYFNGLAVQTTEDPSRGSCKFPTVTL  474



>ref|XP_011010072.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=466

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 129/172 (75%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            V K T +  +GTPARPG+ IP  IF+LY+ENQK GPGTERH+G+L+PNGT+IY IDL+GK
Sbjct  295  VTKMTGRPQIGTPARPGLFIPAFIFSLYDENQKTGPGTERHWGLLHPNGTSIYQIDLTGK  354

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
               S++ PLP    + PY+GK WCV AP  NLT +  AL++AC +GN TC  + PG  CY
Sbjct  355  RASSDYEPLPATQNDMPYEGKSWCVAAPDVNLTELERALNFACSKGNGTCEALTPGKECY  414

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+I HAS+AFSSYWA+FRS G  CYFNGLAV+T  +PS G C++PS+T+
Sbjct  415  EPLSVIWHASFAFSSYWAKFRSQGANCYFNGLAVQTTRNPSRGLCQFPSVTI  466



>emb|CBI39414.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 123/163 (75%), Gaps = 1/163 (1%)
 Frame = -1

Query  662  VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPL  483
            VGTPARPG+ IPT IFALYNENQK GPGTERH+G+L  NG  +Y +DL+G+  ES    L
Sbjct  214  VGTPARPGMTIPTFIFALYNENQKRGPGTERHWGLLDCNGKPVYGVDLTGEL-ESNDDQL  272

Query  482  PKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHA  303
            P P  N+PY+GK+WCVVA   N   +  AL YAC QGN TC+ + PG  CY P SL+ HA
Sbjct  273  PMPQNNKPYQGKIWCVVASEVNPEQLVSALIYACSQGNGTCDALMPGKECYEPFSLLSHA  332

Query  302  SYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            SYAFSSYWA+FRSLG  CYFNGLAV+T  DPS G+CK+P++TL
Sbjct  333  SYAFSSYWAKFRSLGANCYFNGLAVQTTEDPSRGSCKFPTVTL  375



>ref|XP_011045808.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=475

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            V+K T+    GTPARPG +IPT IFALY+EN K GPGTERH+G+L+PNGT+IY IDL+GK
Sbjct  304  VRKMTASNPTGTPARPGALIPTFIFALYDENTKTGPGTERHWGLLHPNGTSIYQIDLTGK  363

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
               S++  LP    N PYKGK+WC+ AP  NLT +  AL++AC QGN TC+ + PG  CY
Sbjct  364  RASSDYETLPPAHNNVPYKGKLWCIAAPEVNLTELERALTFACNQGNGTCDSLTPGKECY  423

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYAFSSYWA+FRS G  CYFNGLA +T ++PS G+C++PS+T+
Sbjct  424  EPLSVTWHASYAFSSYWAKFRSQGANCYFNGLAQQTTSNPSRGSCQFPSVTI  475



>ref|XP_007034194.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY05120.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=552

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            ++K T+K  +GTPARPG+VIPT IF+LY ENQK GPGTERH+G+L+ NGT IY IDL+GK
Sbjct  381  IRKMTAKPPLGTPARPGLVIPTFIFSLYEENQKTGPGTERHWGLLHSNGTAIYDIDLTGK  440

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
               S++ PLP    N PYKGKVWC VAP ANL  ++ AL+YAC Q N+TC  + PG  CY
Sbjct  441  RLASDYKPLPPAQNNVPYKGKVWCEVAPGANLMNLSSALTYACSQDNQTCAALSPGKECY  500

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  H+SYAFSSYWA+FRS G TCYF+GLA +T  +PS G CK+PS+ L
Sbjct  501  EPISVFWHSSYAFSSYWAKFRSQGATCYFSGLARQTTVNPSRGRCKFPSVIL  552



>ref|XP_009383834.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=475

 Score =   223 bits (568),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 132/174 (76%), Gaps = 6/174 (3%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            V++  ++   GTPARPG ++P  IF+LYNENQKPGPGTERH+G+LYP+G   Y +DLSG+
Sbjct  300  VQRMAARPAAGTPARPGALMPVFIFSLYNENQKPGPGTERHWGLLYPHGKMAYDVDLSGR  359

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVA----PAANLTAVADALSYACGQGNRTCNPIQPG  342
             P + +P LP P  N+PYKG++WCV       A+N TAV  AL+YACGQGN TC+ I+PG
Sbjct  360  RPLASYPSLPPPENNEPYKGRIWCVFGGGRRAASNATAVGAALAYACGQGNGTCDGIRPG  419

Query  341  GACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSI  180
            G C+ PN+++ HASYAF+SYW  FR  G TC+F+GLA++T  DPSYG+CKY S+
Sbjct  420  GPCHKPNTIVSHASYAFNSYWQLFRRAGATCFFDGLALQTKTDPSYGSCKYRSL  473



>ref|XP_009383833.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=476

 Score =   223 bits (568),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 132/174 (76%), Gaps = 6/174 (3%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            V++  ++   GTPARPG ++P  IF+LYNENQKPGPGTERH+G+LYP+G   Y +DLSG+
Sbjct  301  VQRMAARPAAGTPARPGALMPVFIFSLYNENQKPGPGTERHWGLLYPHGKMAYDVDLSGR  360

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVA----PAANLTAVADALSYACGQGNRTCNPIQPG  342
             P + +P LP P  N+PYKG++WCV       A+N TAV  AL+YACGQGN TC+ I+PG
Sbjct  361  RPLASYPSLPPPENNEPYKGRIWCVFGGGRRAASNATAVGAALAYACGQGNGTCDGIRPG  420

Query  341  GACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSI  180
            G C+ PN+++ HASYAF+SYW  FR  G TC+F+GLA++T  DPSYG+CKY S+
Sbjct  421  GPCHKPNTIVSHASYAFNSYWQLFRRAGATCFFDGLALQTKTDPSYGSCKYRSL  474



>gb|KJB28087.1| hypothetical protein B456_005G026800 [Gossypium raimondii]
Length=462

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 128/172 (74%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            V+K T+K  +GTPARPG VIPT IF+LY+ENQK GP TERH+G+L  NGT+IY IDL+GK
Sbjct  291  VQKMTAKPPLGTPARPGSVIPTFIFSLYDENQKTGPTTERHWGLLRSNGTSIYEIDLTGK  350

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P S + PLP    N PYKGK+WC VAP A+   ++ ALSYACGQGN+TC  + PG  CY
Sbjct  351  RPLSSYKPLPAARNNVPYKGKIWCEVAPGADAMNLSLALSYACGQGNQTCAALNPGKQCY  410

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYAFSSYWA+FR  G TC FNGLA +T  +PS G C +PS+TL
Sbjct  411  EPVSVFWHASYAFSSYWARFRKQGATCNFNGLARQTRANPSRGHCSFPSVTL  462



>gb|ACR37660.1| unknown [Zea mays]
Length=225

 Score =   214 bits (546),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 121/163 (74%), Gaps = 4/163 (2%)
 Frame = -1

Query  659  GTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP  480
            GTP RPG  +P  +F+LYNE+ KPGPGTERH+G+ Y NGT +Y IDL+G+ P   +PPLP
Sbjct  58   GTPVRPGAKMPVFVFSLYNEDLKPGPGTERHWGLYYANGTAVYEIDLTGRRPLGSYPPLP  117

Query  479  KPTTNQPYKGKVWCVVAPAA----NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLI  312
             P  N PYKG +WCV++ AA    N TAV +ALSYACGQGN TC+ IQPG  CY PN+  
Sbjct  118  APENNTPYKGPIWCVLSAAASNKLNETAVGNALSYACGQGNGTCDAIQPGKTCYTPNTTA  177

Query  311  RHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
             HASYAF+SYW QF   G TCYFN LA +TI DPS+G+C++PS
Sbjct  178  AHASYAFNSYWQQFEKTGATCYFNNLAEQTIKDPSHGSCRFPS  220



>dbj|BAJ88052.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=488

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 124/163 (76%), Gaps = 4/163 (2%)
 Frame = -1

Query  659  GTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP  480
            GTPARPG  +P  +F+LYNEN KPGPGTERH+G+ YPNGT +Y +DL+G+ P   +PPLP
Sbjct  323  GTPARPGARMPVFVFSLYNENLKPGPGTERHWGLYYPNGTAVYRVDLTGRRPLWAYPPLP  382

Query  479  KPTTNQPYKGKVWCVVAPAA----NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLI  312
             P  + PYKG++WCV+A  A    N TAV DAL+YACGQGN TC+ +QPGG C+ PN+  
Sbjct  383  APENDTPYKGQIWCVLAAHAGRKLNETAVGDALTYACGQGNGTCDAVQPGGECFQPNTGA  442

Query  311  RHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
             HASYAF+SYW QFR  G TCYFN LA +TI DPS+G+CK+ S
Sbjct  443  AHASYAFNSYWQQFRKTGATCYFNNLAEQTIKDPSHGSCKFRS  485



>emb|CDO96794.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 125/172 (73%), Gaps = 22/172 (13%)
 Frame = -1

Query  683  VKKFTS--KVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKKFT+    GTPARPGV I   IFALYNENQKPG GTERHFG+LYPNGT++Y IDLSG 
Sbjct  295  VKKFTAMPSAGTPARPGVNISVNIFALYNENQKPGAGTERHFGLLYPNGTSVYDIDLSGH  354

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TP+S + PLP+PT N+PYKGK+WCV                     NRTC  I+PGG CY
Sbjct  355  TPDSTYSPLPQPTNNKPYKGKLWCV--------------------DNRTCEAIRPGGKCY  394

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             PN L+ HASYAFS+YWAQFRS G TC+FNGLAV+T  DPSY +C++PS+ L
Sbjct  395  KPNWLVLHASYAFSAYWAQFRSSGATCFFNGLAVQTTKDPSYLSCQFPSVNL  446



>ref|XP_011101604.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Sesamum 
indicum]
Length=468

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 128/172 (74%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            V K TS   +GTPARPG+ I T IF+LY+ENQKPGPGTERH+G+L  NG   Y +DL+G 
Sbjct  297  VMKMTSNPPLGTPARPGIEILTFIFSLYDENQKPGPGTERHWGLLSNNGKPTYEVDLTGT  356

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             PE+ +  LPKP+ N PYKGK+WCV    A+LT +  AL +ACGQGN TCN + PG  CY
Sbjct  357  RPETSYAILPKPSNNHPYKGKLWCVADSRASLTDLGPALDFACGQGNGTCNELAPGKGCY  416

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYAFSSYWA+FR+ G  CYF+GLAV+T  DPS+G+C++PS+ L
Sbjct  417  QPVSISAHASYAFSSYWAKFRNAGAVCYFDGLAVQTTTDPSHGSCQFPSVLL  468



>ref|XP_010238330.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=477

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 123/162 (76%), Gaps = 3/162 (2%)
 Frame = -1

Query  659  GTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP  480
            GTPARPG  +P  +F+LYNEN KPGPGTERH+G+ YP+GT +Y IDL+G+ P   +PPLP
Sbjct  313  GTPARPGAKMPVFVFSLYNENLKPGPGTERHWGLYYPDGTEVYQIDLTGRRPLWAYPPLP  372

Query  479  KPTTNQPYKGKVWCVVAPAA---NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIR  309
             P  N PYKG +WCV+A      N TAV DAL+YACGQGN TC+ +QPGG C+ PN+   
Sbjct  373  APENNTPYKGPIWCVLATHGRKLNETAVGDALTYACGQGNGTCDAVQPGGECFQPNTGEA  432

Query  308  HASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            HASYAF+SYW QFR +G TCYFN LA +TI DPS+G+CK+ S
Sbjct  433  HASYAFNSYWQQFRKIGATCYFNNLAEQTIKDPSHGSCKFHS  474



>gb|ACN28576.1| unknown [Zea mays]
Length=335

 Score =   216 bits (551),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 121/163 (74%), Gaps = 4/163 (2%)
 Frame = -1

Query  659  GTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP  480
            GTP RPG  +P  +F+LYNE+ KPGPGTERH+G+ Y NGT +Y IDL+G+ P   +PPLP
Sbjct  168  GTPVRPGAKMPVFVFSLYNEDLKPGPGTERHWGLYYANGTAVYEIDLTGRRPLGSYPPLP  227

Query  479  KPTTNQPYKGKVWCVVAPAA----NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLI  312
             P  N PYKG +WCV++ AA    N TAV +ALSYACGQGN TC+ IQPG  CY PN+  
Sbjct  228  APENNTPYKGPIWCVLSAAASNKLNETAVGNALSYACGQGNGTCDAIQPGKTCYTPNTTA  287

Query  311  RHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
             HASYAF+SYW QF   G TCYFN LA +TI DPS+G+C++PS
Sbjct  288  AHASYAFNSYWQQFEKTGATCYFNNLAEQTIKDPSHGSCRFPS  330



>ref|XP_002462618.1| hypothetical protein SORBIDRAFT_02g029080 [Sorghum bicolor]
 gb|EER99139.1| hypothetical protein SORBIDRAFT_02g029080 [Sorghum bicolor]
Length=483

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 124/163 (76%), Gaps = 4/163 (2%)
 Frame = -1

Query  659  GTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP  480
            GTP RPG  +P  +F+LYNE+ KPGPGTERH+G+ Y NGT +Y IDL+G+ P   +PPLP
Sbjct  316  GTPVRPGAKMPVFVFSLYNEDLKPGPGTERHWGLYYANGTAVYEIDLTGRRPLWSYPPLP  375

Query  479  KPTTNQPYKGKVWCVVAPAA----NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLI  312
             P  N PYKG +WC+++ AA    N TAV +AL+YACGQGN TC+ IQPG  CY PN+ +
Sbjct  376  APENNTPYKGPIWCLLSAAASNKLNETAVGNALTYACGQGNGTCDAIQPGKNCYMPNTTV  435

Query  311  RHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
             HASYAF+SYW QFR +G TCYFN LA +TI DPS+G+CK+PS
Sbjct  436  AHASYAFNSYWQQFRKIGATCYFNNLAEQTIKDPSHGSCKFPS  478



>ref|XP_010023613.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Eucalyptus 
grandis]
 gb|KCW59922.1| hypothetical protein EUGRSUZ_H02646 [Eucalyptus grandis]
Length=440

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 129/172 (75%), Gaps = 3/172 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK  ++   GTPARPGVVIPT IF+LY+ENQK GPGTERH+G+L+ NG  +Y IDL+ K
Sbjct  270  IKKMMAEPPAGTPARPGVVIPTFIFSLYDENQKAGPGTERHWGLLHANGDAVYEIDLTEK  329

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P S + PLP PT N+PYKGK+WCV    AN+T +  ALS AC + N  C+ + PG  C+
Sbjct  330  RPASTYGPLPLPTNNRPYKGKLWCVARIDANVTDLGSALSSAC-RVNGMCDILMPGRECH  388

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S  RHASYAFS+YWA+FRS G TCYF+GLA +T+ DPS G+CK+PS+TL
Sbjct  389  EPASTFRHASYAFSAYWARFRSRGATCYFDGLAEQTVGDPSRGSCKFPSVTL  440



>ref|NP_001149815.1| glucan endo-1,3-beta-glucosidase A6 precursor [Zea mays]
 gb|ACG36890.1| glucan endo-1,3-beta-glucosidase A6 precursor [Zea mays]
 tpg|DAA62204.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=479

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 121/163 (74%), Gaps = 4/163 (2%)
 Frame = -1

Query  659  GTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP  480
            GTP RPG  +P  +F+LYNE+ KPGPGTERH+G+ Y NGT +Y IDL+G+ P   +PPLP
Sbjct  312  GTPVRPGAKMPVFVFSLYNEDLKPGPGTERHWGLYYANGTAVYEIDLTGRRPLGSYPPLP  371

Query  479  KPTTNQPYKGKVWCVVAPAA----NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLI  312
             P  N PYKG +WCV++ AA    N TAV +ALSYACGQGN TC+ IQPG  CY PN+  
Sbjct  372  APENNTPYKGPIWCVLSAAASNKLNETAVGNALSYACGQGNGTCDAIQPGKTCYTPNTTA  431

Query  311  RHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
             HASYAF+SYW QF   G TCYFN LA +TI DPS+G+C++PS
Sbjct  432  AHASYAFNSYWQQFEKTGATCYFNNLAEQTIKDPSHGSCRFPS  474



>ref|XP_004505110.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cicer arietinum]
Length=462

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 126/172 (73%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +++ T+K  +GTPARPGV IPT IF+L+NENQKPGPGTERH+G+L  +GT IY +DL+GK
Sbjct  291  IQRMTTKPPIGTPARPGVTIPTFIFSLFNENQKPGPGTERHWGLLETDGTPIYDLDLTGK  350

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
               ++F  LP P  N P+KGKVWCV A  AN   +A ALSYAC + N TC  + PG  CY
Sbjct  351  KHITDFASLPAPENNVPFKGKVWCVAAKGANEIELASALSYACNEVNMTCEALSPGNECY  410

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASY FS++WA+F++ G TCYFNGLA +T  DPS   CK+PS+T+
Sbjct  411  EPVSVTDHASYVFSTFWAKFKTTGATCYFNGLAEQTTKDPSRPFCKFPSVTI  462



>ref|XP_008222761.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Prunus 
mume]
Length=477

 Score =   214 bits (546),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 123/165 (75%), Gaps = 2/165 (1%)
 Frame = -1

Query  662  VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPL  483
            +GTPARPGVVIPT IF+L++ENQK GPGTERH+G+L+ +GT IY IDL+GK    ++ PL
Sbjct  313  LGTPARPGVVIPTFIFSLFDENQKTGPGTERHWGLLHADGTPIYDIDLAGKRRLEDYEPL  372

Query  482  PKPTTNQPYKGKVWCVVAPAANLTAVADALSYAC--GQGNRTCNPIQPGGACYNPNSLIR  309
            P+   N PYKG VWCVVA   N   +  AL+  C  G GN TC+ + PG  CY P S I 
Sbjct  373  PEANNNSPYKGSVWCVVAKGVNNDELGSALTNLCNSGAGNGTCDALSPGKECYEPVSEIL  432

Query  308  HASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            HASYAFSSYWA+FRS G TCYFNGLA +T  DPS+G+CK+PS+TL
Sbjct  433  HASYAFSSYWAKFRSHGATCYFNGLAEQTTVDPSHGSCKFPSVTL  477



>gb|KEH30957.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=462

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 126/172 (73%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +++ T+K  +GTPARPGV I T +F+L++ENQKPGPGTERH+G+L+ +GT IY +DL+GK
Sbjct  291  IQRMTAKPPIGTPARPGVPITTFLFSLFDENQKPGPGTERHWGLLHTDGTPIYDLDLTGK  350

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
               +++ PL  P  N PYKGKVWCV A  AN   +A AL+YAC   N TC+ + PG  CY
Sbjct  351  KTNTDYAPLQAPKNNVPYKGKVWCVAAEGANEIELAAALTYACNVANMTCDALSPGNECY  410

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASY FS+YWAQF+S G TCYFNGLA +T  DPS  +CK+PS+ L
Sbjct  411  EPVSIPLHASYVFSTYWAQFKSSGATCYFNGLATETTKDPSRNSCKFPSVIL  462



>emb|CDX74052.1| BnaA03g29950D [Brassica napus]
Length=567

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 124/161 (77%), Gaps = 3/161 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK ++   VGTPARPG V+P+ IFAL+NENQK GPGTERHFG+L+PNG+ +Y I+LSG+
Sbjct  290  VKKLSAVPPVGTPARPGKVLPSFIFALFNENQKTGPGTERHFGLLHPNGSRVYEIELSGE  349

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T E +   LP P  N+ YKGK+WCVVA  AN T + +ALSYAC QGN TC+PI+ GG C+
Sbjct  350  TTEFK-EKLPAPENNEVYKGKIWCVVAKGANWTQLGEALSYACSQGNNTCDPIKSGGPCH  408

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  207
             P+  + HASYAFSSYWA FR  GGTC FNGLA +TI DPS
Sbjct  409  KPDLTVLHASYAFSSYWASFRKTGGTCSFNGLATQTIKDPS  449



>gb|KDO47456.1| hypothetical protein CISIN_1g012660mg [Citrus sinensis]
Length=459

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 120/161 (75%), Gaps = 2/161 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK TSK  +GTPARPG +IPT IF+LY+ENQK GPGTERH+G+L+ NG  IY IDLSG 
Sbjct  297  IKKMTSKPALGTPARPGSIIPTFIFSLYDENQKTGPGTERHWGMLHGNGVPIYEIDLSGN  356

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
               S++ PLP    N PYKGKVWCVVA  A+L A+  AL YACGQGN TC+ + PG  CY
Sbjct  357  RSLSQYRPLPLAHNNVPYKGKVWCVVARGADLLALTSALGYACGQGNGTCDALVPGQRCY  416

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  207
             P SL  HASYAFSSYWA+F   G TCYFNGLA +TI +PS
Sbjct  417  QPLSLYWHASYAFSSYWAKFMGKGATCYFNGLAQQTIINPS  457



>ref|XP_006830555.1| hypothetical protein AMTR_s00117p00104410 [Amborella trichopoda]
 gb|ERM97971.1| hypothetical protein AMTR_s00117p00104410 [Amborella trichopoda]
Length=482

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 126/167 (75%), Gaps = 0/167 (0%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            ++K TS+ GTP RP   + T IF+LYNE+QKPG GTERH+G+LYPNG+ ++ IDL+G+  
Sbjct  301  IRKLTSREGTPMRPNQTMFTYIFSLYNEDQKPGRGTERHWGLLYPNGSRVFEIDLNGRKL  360

Query  503  ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNP  324
            +SE+ PLP+P  N+ +KGK+WCVV   AN++AV  AL +AC QGN TC+ I+ G  CY P
Sbjct  361  DSEYEPLPEPVNNEEFKGKIWCVVVHGANVSAVGPALDHACAQGNGTCDAIKSGRECYEP  420

Query  323  NSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            N+++ HASYAF++YW +FR  GGTCYF+GLA +T  DPS  +  YP+
Sbjct  421  NTIVGHASYAFNAYWQRFRKSGGTCYFDGLAEQTAVDPSEFSNLYPT  467



>ref|XP_010314851.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Solanum 
lycopersicum]
Length=463

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 130/173 (75%), Gaps = 4/173 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +++  SK  +GTPARPG+ IPT IF+LY+ENQK GPGTERH+G+L PNG  +Y IDL+G+
Sbjct  292  IRRIVSKPAIGTPARPGLAIPTFIFSLYDENQKEGPGTERHWGMLNPNGRPMYDIDLTGQ  351

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVA-PAANLTAVADALSYACGQGNRTCNPIQPGGAC  333
            T ++EF  LP+PT N PY GK+WCVV     N   +  AL +AC + N TC+ I PG +C
Sbjct  352  TLDTEFIDLPQPTNNGPYHGKLWCVVTNDTMNEMDLGQALEFAC-RRNETCDDISPGKSC  410

Query  332  YNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            Y P S++ HA+YAFSSYWA++R  G TCYFNGLAV+T  DPS+G+CK+P ++L
Sbjct  411  YQPVSIVSHANYAFSSYWAKYREDGETCYFNGLAVQTNVDPSHGSCKFPYVSL  463



>ref|XP_006421038.1| hypothetical protein CICLE_v10004917mg [Citrus clementina]
 gb|ESR34278.1| hypothetical protein CICLE_v10004917mg [Citrus clementina]
Length=466

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 119/160 (74%), Gaps = 2/160 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK TSK  +GTPARPG +IPT IF+LY+ENQK GPGTERH+G+L+ NG  IY IDLSG 
Sbjct  297  IKKMTSKPALGTPARPGSIIPTFIFSLYDENQKTGPGTERHWGMLHGNGVPIYEIDLSGN  356

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
               S++ PLP    N PYKGKVWCVVA  A+L A+  AL YACGQGN TC+ + PG  CY
Sbjct  357  RSLSQYRPLPLAHNNVPYKGKVWCVVARGADLLALTSALGYACGQGNGTCDALVPGQRCY  416

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDP  210
             P SL  HASYAFSSYWA+F   G TCYFNGLA +TI +P
Sbjct  417  QPLSLYWHASYAFSSYWAKFMGKGATCYFNGLAQQTIINP  456



>ref|XP_006349905.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Solanum tuberosum]
Length=470

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 131/174 (75%), Gaps = 5/174 (3%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +++  SK  +GTPARPG+ IPT IF+LY+ENQK GPGTERH+G+L+PNG  +Y IDL+G+
Sbjct  298  IRRVVSKPPIGTPARPGLTIPTFIFSLYDENQKEGPGTERHWGMLHPNGRPMYDIDLTGQ  357

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVA--PAANLTAVADALSYACGQGNRTCNPIQPGGA  336
            T +SEF  LP+PT N P+ GK+WCVV      N   +  AL +AC + N TC+ I PG +
Sbjct  358  TLDSEFIDLPQPTNNGPFHGKLWCVVTNDHTMNEMDLGQALEFAC-RRNETCDEISPGKS  416

Query  335  CYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            CY P S++ HA+YAFSSYWA+++  G TCYFNGLAV+T  DPS+G+CK+P ++L
Sbjct  417  CYQPVSIVSHANYAFSSYWAKYKEDGETCYFNGLAVQTNVDPSHGSCKFPYVSL  470



>gb|EEC84834.1| hypothetical protein OsI_31928 [Oryza sativa Indica Group]
Length=477

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 118/163 (72%), Gaps = 4/163 (2%)
 Frame = -1

Query  659  GTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP  480
            GTPARPG  +P  +F+LYNE+ KPGPGTERH+G+ Y NGT +YP+DL+G  P   +P LP
Sbjct  312  GTPARPGAKMPVFVFSLYNEDLKPGPGTERHWGLYYANGTAVYPVDLAGARPLRSYPLLP  371

Query  479  KPTTNQPYKGKVWCVVA----PAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLI  312
             P  + PYKG VWCV+A       N TAV DAL+YACGQGN TC+ IQPGG C+ PN+  
Sbjct  372  PPENDAPYKGPVWCVLAGRRGEKLNETAVGDALAYACGQGNGTCDAIQPGGECFRPNTTA  431

Query  311  RHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
             HASYAF+SYW Q R  G TCYFN LA +T  DPS+G+CK+ S
Sbjct  432  AHASYAFNSYWQQLRKTGATCYFNNLAEETTKDPSHGSCKFHS  474



>ref|NP_001063586.1| Os09g0502200 [Oryza sativa Japonica Group]
 dbj|BAF25500.1| Os09g0502200 [Oryza sativa Japonica Group]
 gb|EEE69998.1| hypothetical protein OsJ_29910 [Oryza sativa Japonica Group]
Length=480

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 118/163 (72%), Gaps = 4/163 (2%)
 Frame = -1

Query  659  GTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP  480
            GTPARPG  +P  +F+LYNE+ KPGPGTERH+G+ Y NGT +YP+DL+G  P   +P LP
Sbjct  315  GTPARPGAKMPVFVFSLYNEDLKPGPGTERHWGLYYANGTAVYPVDLAGARPLRSYPLLP  374

Query  479  KPTTNQPYKGKVWCVVA----PAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLI  312
             P  + PYKG VWCV+A       N TAV DAL+YACGQGN TC+ IQPGG C+ PN+  
Sbjct  375  PPENDAPYKGPVWCVLAGRRGEKLNETAVGDALAYACGQGNGTCDAIQPGGECFRPNTTA  434

Query  311  RHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
             HASYAF+SYW Q R  G TCYFN LA +T  DPS+G+CK+ S
Sbjct  435  AHASYAFNSYWQQLRKTGATCYFNNLAEETTKDPSHGSCKFHS  477



>dbj|BAK04571.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 117/155 (75%), Gaps = 4/155 (3%)
 Frame = -1

Query  659  GTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP  480
            GTPARPG  +P  +F+LYNEN KPGPGTERH+G+ YPNGT +Y +DL+G+ P   +PPLP
Sbjct  371  GTPARPGARMPVFVFSLYNENLKPGPGTERHWGLYYPNGTAVYRVDLTGRRPLWAYPPLP  430

Query  479  KPTTNQPYKGKVWCVVAPAA----NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLI  312
             P  + PYKG++WCV+A  A    N TAV DAL+YACGQGN TC+ +QPGG C+ PN+  
Sbjct  431  APENDTPYKGQIWCVLAAHAGRKLNETAVGDALTYACGQGNGTCDAVQPGGECFQPNTGA  490

Query  311  RHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  207
             HASYAF+SYW QFR  G TCYFN LA +TI DPS
Sbjct  491  AHASYAFNSYWQQFRKTGATCYFNNLAEQTIKDPS  525



>ref|XP_006661404.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan endo-1,3-beta-glucosidase 
A6-like [Oryza brachyantha]
Length=521

 Score =   211 bits (536),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 118/162 (73%), Gaps = 3/162 (2%)
 Frame = -1

Query  659  GTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP  480
            GTPARPG  +P  +F+LYNE+ KPGPGTERH+G+ Y NGT +YPIDL+G  P   +PPLP
Sbjct  357  GTPARPGAKMPVFVFSLYNEDLKPGPGTERHWGLYYANGTAVYPIDLTGARPLWSYPPLP  416

Query  479  KPTTNQPYKGKVWCVVAPAA---NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIR  309
             P  + PYKG VWCV+A      NLTAV DAL+YACGQGN TC  IQPG  C+ PN+   
Sbjct  417  PPENDTPYKGPVWCVLADRGGKLNLTAVGDALAYACGQGNGTCATIQPGRECFQPNTTAA  476

Query  308  HASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            HASYAF+SYW Q R  G TCYFN LA +T  DPS+G+CK+ S
Sbjct  477  HASYAFNSYWQQLRKNGATCYFNNLAEETTKDPSHGSCKFHS  518



>ref|XP_007221306.1| hypothetical protein PRUPE_ppa016789mg, partial [Prunus persica]
 gb|EMJ22505.1| hypothetical protein PRUPE_ppa016789mg, partial [Prunus persica]
Length=452

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 121/165 (73%), Gaps = 2/165 (1%)
 Frame = -1

Query  662  VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPL  483
            +GTPARPGVVIPT IF+L++ENQK GPGTERH+G+L+ +GT IY IDL+GK    ++ PL
Sbjct  288  LGTPARPGVVIPTFIFSLFDENQKTGPGTERHWGLLHADGTPIYDIDLTGKRRLEDYKPL  347

Query  482  PKPTTNQPYKGKVWCVVAPAANLTAVADALSYAC--GQGNRTCNPIQPGGACYNPNSLIR  309
            P+   N PYKG VWCVVA   N   +  AL+  C    GN TC+ + PG  CY P S I 
Sbjct  348  PEANNNSPYKGMVWCVVAKGVNNDELDSALNNLCSSSSGNGTCDALSPGKECYEPVSEIL  407

Query  308  HASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            HASYAFSSYWA+F S G TCYF+GLA +T  DPS+G+CK+PS+TL
Sbjct  408  HASYAFSSYWAKFWSHGATCYFDGLAEQTTVDPSHGSCKFPSVTL  452



>gb|EMT13087.1| Putative glucan endo-1,3-beta-glucosidase A6 [Aegilops tauschii]
Length=362

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 113/154 (73%), Gaps = 4/154 (3%)
 Frame = -1

Query  659  GTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP  480
            GTPARPG  +P  +F+LYNE+ KPGPGTERH+G+ Y NGT +YP+DL+G+ P   +PPLP
Sbjct  171  GTPARPGARMPVFVFSLYNEDLKPGPGTERHWGLYYANGTAVYPVDLTGRRPLWAYPPLP  230

Query  479  KPTTNQPYKGKVWCVVAPAA----NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLI  312
                + PYKG +WCV+A  A    N TAV DAL+YACGQGN TC  IQPGG C+ PN+  
Sbjct  231  AADNDTPYKGPIWCVLAAHAGRKLNETAVGDALTYACGQGNGTCGAIQPGGECFQPNTGA  290

Query  311  RHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDP  210
             HASYAF+SYW QFR  G TCYFN LA +TI DP
Sbjct  291  AHASYAFNSYWQQFRKTGATCYFNNLAEQTIKDP  324



>gb|EYU31522.1| hypothetical protein MIMGU_mgv1a005774mg [Erythranthe guttata]
Length=471

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 127/172 (74%), Gaps = 3/172 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            V K TS   +GTPA+PG+ IPT +F+LY+ENQKPGPGTERH+G+L   G+ IY +DL+G 
Sbjct  301  VAKVTSDPPIGTPAKPGIEIPTFVFSLYDENQKPGPGTERHWGLLSNTGSPIYEVDLTGT  360

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            + E+    L +P+ N PY GK+WCVVA  A+   +  AL +AC QGN TC+ + PG  CY
Sbjct  361  SHENN-TKLSEPSNNGPYNGKIWCVVASTASPDDLGPALEFACRQGNGTCDQLAPGKECY  419

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S++ HASYAFSS+WAQFRS G +CYF GLAV+TI DP +G+C++PS+ L
Sbjct  420  EPISIVSHASYAFSSFWAQFRSAGASCYFGGLAVQTITDPGHGSCEFPSVLL  471



>ref|XP_004957267.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Setaria italica]
Length=483

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 120/163 (74%), Gaps = 4/163 (2%)
 Frame = -1

Query  659  GTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP  480
            GTP RPG  +P  +F+LYNE+ K GPGTERH+G+ Y NGT +YPIDL+G+ P   +PPLP
Sbjct  317  GTPLRPGAKMPVFVFSLYNEDLKGGPGTERHWGLYYANGTAVYPIDLTGRRPLWSYPPLP  376

Query  479  KPTTNQPYKGKVWCVVAPAA----NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLI  312
                N PYKG +WCV++ AA    N TAV +AL+YACGQGN TC  IQPG  CY PN+ +
Sbjct  377  ALENNTPYKGPIWCVLSAAASKKLNETAVGNALAYACGQGNGTCAAIQPGEKCYLPNTTV  436

Query  311  RHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
             HASYAF+SYW QFR  G TCYFN LA +TI +PS+G+CK+ S
Sbjct  437  AHASYAFNSYWQQFRKTGATCYFNNLAEQTIKNPSHGSCKFRS  479



>ref|XP_008439043.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Cucumis 
melo]
Length=467

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 124/172 (72%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VK+ T+K  VGTPARPGVVIPT IFAL++ENQKPG GTERH+G+L  +G+  Y IDL+GK
Sbjct  296  VKRITAKPTVGTPARPGVVIPTFIFALFDENQKPGSGTERHWGLLRSDGSPNYQIDLTGK  355

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
                E+ PLP    N P++G++WCV A   +L  +  A+   CG+G+ TC  + PG  CY
Sbjct  356  ESSVEYDPLPVVENNAPFRGRLWCVAARGVDLMELEAAVDDVCGRGDGTCEALSPGRECY  415

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYAFSSYW++FRS G +CYFNGLA +T  DPS G+C++PS+T 
Sbjct  416  EPVSVYWHASYAFSSYWSKFRSQGASCYFNGLAEQTTVDPSNGSCRFPSVTF  467



>ref|XP_010532729.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=480

 Score =   207 bits (527),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 123/172 (72%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +K+ T+   VGTPARPG+ IPT +F+L++EN+KPGPGTERH+G+L P+GT +Y +D +GK
Sbjct  309  IKRMTANPPVGTPARPGLSIPTFVFSLFDENRKPGPGTERHWGILRPSGTPVYEVDFTGK  368

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
               S + PLP P  N PYKG VWCV    A++ A+ +AL +ACG+ N TC  + PG  CY
Sbjct  369  KQVSGYGPLPAPDNNVPYKGNVWCVANEGADMAALGEALRFACGRSNDTCQALAPGRECY  428

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYAFSSYWAQFRS    CYF+GLA +T  +P    CK+PS+TL
Sbjct  429  EPVSVTWHASYAFSSYWAQFRSQNARCYFDGLARETTTNPGNDRCKFPSVTL  480



>emb|CDY63754.1| BnaAnng19080D [Brassica napus]
Length=478

 Score =   207 bits (526),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPARPG+ IPT +F+L+NENQKPG GTERH+G+L P+GT IY ID SG 
Sbjct  307  IKKMTANPPLGTPARPGLPIPTFLFSLFNENQKPGSGTERHWGILNPDGTQIYDIDFSGT  366

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P S    LPKP+ N P+KG VWCVV   A+   +  AL +ACG+ N TC  + PG  CY
Sbjct  367  KPVSSLGSLPKPSNNVPFKGNVWCVVVEGASEEELGQALDFACGRSNETCAALAPGRECY  426

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYAFSSYWAQFR+    CYFNGLA +T  +P    CK+PS+TL
Sbjct  427  APVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNERCKFPSVTL  478



>ref|XP_009102583.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=478

 Score =   206 bits (525),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPARPG+ IPT +F+L+NENQKPG GTERH+G+L P+GT IY ID SG 
Sbjct  307  IKKMTANPPLGTPARPGLPIPTFLFSLFNENQKPGSGTERHWGILNPDGTQIYEIDFSGT  366

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P S    LPKP+ N P+KG VWCVV   A+   +  AL +ACG+ N TC  + PG  CY
Sbjct  367  RPVSSLGSLPKPSNNVPFKGNVWCVVVEGASEEELGQALDFACGRSNETCAALAPGRECY  426

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYAFSSYWAQFR+    CYFNGLA +T  +P    CK+PS+TL
Sbjct  427  APVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNERCKFPSVTL  478



>emb|CDY50110.1| BnaC01g43580D [Brassica napus]
Length=476

 Score =   206 bits (525),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 118/172 (69%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPAR G  IPT +F+L+NENQKPG GTERH+G+L PNGT IY IDLSG 
Sbjct  305  IKKMTANPPLGTPARRGSPIPTFLFSLFNENQKPGSGTERHWGILNPNGTQIYDIDLSGT  364

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P S    LPKP  N P+KG VWCV    AN T +  AL +ACG+ N TC  + PG  CY
Sbjct  365  RPVSSLGSLPKPNNNVPFKGNVWCVAVEGANETELGQALDFACGRSNATCAALAPGRECY  424

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYAFSSYWAQFR+    CYFNGLA +T  +P    CK+PS+TL
Sbjct  425  APVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNEQCKFPSVTL  476



>emb|CDP15106.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   206 bits (524),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 126/173 (73%), Gaps = 3/173 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            V+K T+   +GTPA+PGVVIPT IF+LY+EN+K G GTERH+G+L PNG   Y IDL+G 
Sbjct  298  VRKVTATPPIGTPAQPGVVIPTFIFSLYDENRKFGRGTERHWGLLQPNGLPNYEIDLTGV  357

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
              ES +P LP+PT N+P+KGK+WCVVAP + +T +   L+  C + N  C+ + PG  CY
Sbjct  358  QSESNYPTLPQPTNNKPFKGKIWCVVAPGSRITDLGPVLNSVCKEDNGACDALAPGKECY  417

Query  329  NPNSLIRHASYAFSSYWAQFR-SLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P SL+ HASYA SSYWA+ R S G TCYFNG A +T  DPS+G CK+PS++L
Sbjct  418  EPVSLVAHASYALSSYWAKHRDSAGATCYFNGFAEQTTRDPSHGPCKFPSVSL  470



>dbj|BAK05423.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=470

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 124/169 (73%), Gaps = 5/169 (3%)
 Frame = -1

Query  680  KKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPE  501
            ++  + VGTPARP   +P  +F+LYNEN KPG GTERH+G+ YPNGT +Y IDL+G+   
Sbjct  303  RRMHNNVGTPARPRSNMPVFVFSLYNENLKPGAGTERHWGMFYPNGTWVYQIDLTGRRTA  362

Query  500  SEFPPLPKPTTNQPYKGKVWCVVAPA---ANLTAVADALSYACGQGNRTCNPIQPGGACY  330
              +PPLP P  N+  K + WCV+A      N TAVADAL+YAC QG  TC  IQPGGACY
Sbjct  363  RSYPPLPPPD-NKTAKLE-WCVLAGGGKPVNETAVADALNYACQQGTGTCAAIQPGGACY  420

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
             PN+L  HASYAF++YW QF+  GG+CYFNGLAVKT  DPSYG+CK+PS
Sbjct  421  EPNTLDAHASYAFNAYWQQFKGTGGSCYFNGLAVKTNKDPSYGSCKFPS  469



>ref|XP_006414816.1| hypothetical protein EUTSA_v10025081mg [Eutrema salsugineum]
 gb|ESQ56269.1| hypothetical protein EUTSA_v10025081mg [Eutrema salsugineum]
Length=479

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 123/172 (72%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPARPG+ IPT +F+L+NENQK G GT+RH+G+L+P+GT IY ID +G+
Sbjct  308  IKKMTANPPIGTPARPGLPIPTFVFSLFNENQKSGSGTQRHWGLLHPDGTPIYDIDFTGQ  367

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P + F PLPKPT N PYKG+VWCV    AN T + +AL  ACGQ N TC  + PG  CY
Sbjct  368  KPLTGFNPLPKPTNNVPYKGQVWCVPVEGANETELEEALRLACGQSNTTCAALAPGRECY  427

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYA SSYWAQFR+    CYFNGLA +T  +P    CK+PS+TL
Sbjct  428  EPVSIYWHASYAVSSYWAQFRTQDVRCYFNGLAHETTINPGNDRCKFPSVTL  479



>gb|AAF20214.1|AC012395_1 putative beta-1,3-glucanase precursor [Arabidopsis thaliana]
Length=440

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 117/172 (68%), Gaps = 24/172 (14%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VKK  +   VGTPARPG V+P  +FALYNENQK GPGTERHFG+L+PNGT +Y IDLSGK
Sbjct  291  VKKLAADPPVGTPARPGKVLPAFVFALYNENQKTGPGTERHFGLLHPNGTQVYGIDLSGK  350

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T   E   LP P  N  YKGK+WCV                    GN TC+PIQ GG C 
Sbjct  351  TEYKE--SLPAPENNDLYKGKIWCV--------------------GNNTCDPIQRGGPCQ  388

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P+  + HASYAFSSYWAQFR +GGTC FNGLA +TI DPSYG C++PS+TL
Sbjct  389  KPDLTVLHASYAFSSYWAQFRKIGGTCSFNGLATQTIKDPSYGRCEFPSVTL  440



>emb|CDY59775.1| BnaCnng35540D [Brassica napus]
Length=474

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 119/172 (69%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPARPG  IPT +F+L+NENQKPG GTERH+G+L P+GT IY ID SG 
Sbjct  303  IKKMTANPPLGTPARPGSPIPTFLFSLFNENQKPGSGTERHWGILNPDGTQIYDIDFSGT  362

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P S    LPKP+ N P+KG VWCVV   A+   +  AL +ACG+ N TC  + PG  CY
Sbjct  363  RPVSSLGSLPKPSNNVPFKGNVWCVVVEGASEEELGQALDFACGRSNETCAALAPGRECY  422

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYAFSSYWAQFR+    CYFNGLA +T  +P    CK+PS+TL
Sbjct  423  APVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNERCKFPSVTL  474



>ref|XP_009373620.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Pyrus 
x bretschneideri]
Length=469

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 124/167 (74%), Gaps = 4/167 (2%)
 Frame = -1

Query  662  VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPL  483
            +GTPARPGVVIPT IF+L++ENQK GPGTERH+G+L+ +GT IY +DL+GK P  ++ PL
Sbjct  303  LGTPARPGVVIPTFIFSLFDENQKTGPGTERHWGLLHADGTPIYDVDLTGKRPLEDYEPL  362

Query  482  PKPTTNQPYKGKVWCVVAP--AANLTAVADALSYACGQGNR--TCNPIQPGGACYNPNSL  315
            P+   N+PYKG VWCVVA   + N   +  A++ AC  GN   TC+ + PG  CY P SL
Sbjct  363  PEEQNNRPYKGAVWCVVAKGVSVNDEELGSAVNNACIAGNATGTCDALSPGKECYEPVSL  422

Query  314  IRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
              HASYAFSSYWA+FRS G TC+FNGLA +T  DPS+G+CK+PS+  
Sbjct  423  TWHASYAFSSYWAKFRSQGATCHFNGLAEQTSLDPSHGSCKFPSVIF  469



>ref|XP_009144683.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=479

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 123/172 (72%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPARPG  IPT +F+L+NEN+KPG GT+RH+G+L+P+GT IY ID +G+
Sbjct  308  IKKMTAIPPIGTPARPGSPIPTFVFSLFNENKKPGSGTQRHWGILHPDGTPIYDIDFTGQ  367

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P + F PLPKPT N PYKG+VWCV+   AN T + +AL  AC + N TC  + PG  CY
Sbjct  368  KPLTGFNPLPKPTNNVPYKGQVWCVLVEGANETELEEALRMACARSNTTCAALAPGRECY  427

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYA +SYWAQFRS    CYFNGLA +T  +P    CK+PS+TL
Sbjct  428  EPVSVYWHASYALNSYWAQFRSQNVQCYFNGLAHETTTNPGNDRCKFPSVTL  479



>ref|XP_002868315.1| hypothetical protein ARALYDRAFT_493503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44574.1| hypothetical protein ARALYDRAFT_493503 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   204 bits (520),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTP+RPG+ IPT +F+L+NENQK GPGT+RH+G+L+P+G+ IY ID +G+
Sbjct  307  IKKMTASPPIGTPSRPGLPIPTFVFSLFNENQKSGPGTQRHWGILHPDGSPIYDIDFTGQ  366

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P + F PLPKPT N PYKG+VWCV    AN T + + L  AC Q N TC  + PG  CY
Sbjct  367  KPLTGFNPLPKPTNNVPYKGQVWCVPVEGANETELEETLRMACAQSNTTCAALAPGRECY  426

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYA SSYWAQFR+    CYFNGLA +T  +P    CK+PS+TL
Sbjct  427  EPVSIYWHASYALSSYWAQFRNQSIQCYFNGLAHETTTNPGNDRCKFPSVTL  478



>emb|CDY67322.1| BnaA03g57600D [Brassica napus]
Length=221

 Score =   197 bits (500),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 117/172 (68%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPARPG  IPT +F+L+NENQKPG GTERH+G+L P+GT IY ID SG 
Sbjct  50   IKKMTANPPLGTPARPGSPIPTFLFSLFNENQKPGSGTERHWGILNPDGTQIYEIDFSGT  109

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P      LPKP+ N P+KG VWCV    A+   +  AL++ACGQ N TC  + PG  CY
Sbjct  110  RPVPSPGSLPKPSNNVPFKGNVWCVAVEGASEAELQQALNFACGQSNATCAALAPGRECY  169

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P SL  HASYAFSSYWAQFR+    CYFNGLA +T  +P    C +PS+TL
Sbjct  170  APVSLTWHASYAFSSYWAQFRNQSSRCYFNGLARETTTNPGNEHCTFPSVTL  221



>emb|CDY08310.1| BnaA05g13090D [Brassica napus]
Length=479

 Score =   204 bits (518),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPARPG  IPT +F+L+NEN+KPG GT+RH+G+L+P+GT IY ID +G+
Sbjct  308  IKKMTAIPPIGTPARPGSPIPTFVFSLFNENKKPGSGTQRHWGILHPDGTPIYDIDFTGQ  367

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P + F PLPKPT N PYKG+VWCV+   AN   + +AL  AC + N TC  + PG  CY
Sbjct  368  KPLTGFNPLPKPTNNVPYKGQVWCVLVEGANEAELEEALRMACARSNTTCAALAPGRECY  427

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYA +SYWAQFRS    CYFNGLA +T  +P    CK+PS+TL
Sbjct  428  EPVSVYSHASYALNSYWAQFRSQNVQCYFNGLAHETTTNPGNDRCKFPSVTL  479



>emb|CDY18092.1| BnaA01g23530D [Brassica napus]
Length=476

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 118/172 (69%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPAR G  IPT +F+L+NEN+KPG GTERH+G+L P+GT IY IDLSG 
Sbjct  305  IKKMTANPPLGTPARRGSPIPTFLFSLFNENRKPGSGTERHWGILNPDGTQIYDIDLSGT  364

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P S    LPKP  N P+KG VWCV    AN T +  AL +ACG+ N TC  + PG  CY
Sbjct  365  RPVSSLGSLPKPNNNVPFKGNVWCVAVEGANETELGQALDFACGRSNATCAALAPGRECY  424

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYAFSSYWAQFR+    CYFNGLA +T  +P    CK+PS+TL
Sbjct  425  APVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNEQCKFPSVTL  476



>gb|KFK36299.1| hypothetical protein AALP_AA4G104300 [Arabis alpina]
Length=479

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPARPG+ IPT +F+L+NENQKPG GT+RH+GVL+P+GT IY ID +G+
Sbjct  308  IKKMTASPPIGTPARPGLPIPTFVFSLFNENQKPGSGTQRHWGVLHPDGTPIYDIDFTGQ  367

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
               + F PLPKPT N PYKG+VWCV    AN T + + L  ACG+ N TC  + PG  CY
Sbjct  368  KNLTGFNPLPKPTNNVPYKGQVWCVPVEGANETELEETLRIACGRSNTTCAALAPGRECY  427

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYA SSYWAQFR+    CYFNGLA +T  +P    CK+PS+TL
Sbjct  428  EPVSVYWHASYAVSSYWAQFRNESIQCYFNGLAHETTTNPGNDRCKFPSVTL  479



>ref|XP_004147671.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cucumis sativus]
Length=461

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VK+ T+K  VGTPARP VVIPT IF+L++ENQKPG GTERH+G+L  +G+  Y IDL+GK
Sbjct  290  VKRITAKPTVGTPARPKVVIPTFIFSLFDENQKPGSGTERHWGLLSSDGSPNYQIDLTGK  349

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
                E+ PLP    N P++G++WCV A   +L  +   +   CG+G+ TC  + PG  CY
Sbjct  350  ESSVEYDPLPVVENNMPFRGRLWCVAARGVDLMELGATVDDVCGRGDGTCEALSPGRECY  409

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYAFSSYW++FRS G +CYFNGLA +T  DPS G+C++PS+T 
Sbjct  410  EPVSVYWHASYAFSSYWSKFRSQGASCYFNGLAEQTTTDPSNGSCRFPSVTF  461



>ref|XP_009106344.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=476

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 118/172 (69%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPAR G  IPT +F+L+NEN+KPG GTERH+G+L P+GT IY IDLSG 
Sbjct  305  IKKMTANPPLGTPARRGSPIPTFLFSLFNENRKPGSGTERHWGILNPDGTQIYDIDLSGT  364

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P S    LPKP  N P+KG VWCV    AN T +  AL +ACG+ N TC  + PG  CY
Sbjct  365  RPVSSLGSLPKPNNNVPFKGNVWCVAVEGANETELGQALDFACGRSNATCAALAPGRECY  424

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYAFSSYWAQFR+    CYFNGLA +T  +P    CK+PS+TL
Sbjct  425  APVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNEQCKFPSVTL  476



>emb|CAA49513.1| beta-1,3-glucanase homologue [Brassica napus]
Length=474

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPARPG  IPT +F+L+NEN+KPG GT+RH+G+L+P+GT IY ID +G+
Sbjct  303  IKKMTATPPIGTPARPGSPIPTFVFSLFNENKKPGSGTQRHWGILHPDGTPIYDIDFTGQ  362

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P + F PLPKPT N PYKG+VWCV    AN T + +AL  AC + N TC  + PG  CY
Sbjct  363  KPLTGFNPLPKPTNNVPYKGQVWCVPVEGANETELEEALRMACARSNTTCAALVPGRECY  422

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYA +SYWAQFRS    CYFNGLA +T  +P    CK+PS+TL
Sbjct  423  EPVSVYWHASYALNSYWAQFRSQNVQCYFNGLAHETTTNPGNDRCKFPSVTL  474



>emb|CDY06469.1| BnaC06g11750D [Brassica napus]
Length=479

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPARPG  IPT +F+L+NEN+KPG GT+RH+G+L+P+GT IY ID +G+
Sbjct  308  IKKMTATPPIGTPARPGSPIPTFVFSLFNENKKPGSGTQRHWGILHPDGTPIYDIDFTGQ  367

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P + F PLPKPT N PYKG+VWCV    AN T + +AL  AC + N TC  + PG  CY
Sbjct  368  KPLTGFNPLPKPTNNVPYKGQVWCVPVEGANETELEEALRMACARSNTTCAALVPGRECY  427

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYA +SYWAQFRS    CYFNGLA +T  +P    CK+PS+TL
Sbjct  428  EPVSVYWHASYALNSYWAQFRSQNVQCYFNGLAHETTTNPGNDRCKFPSVTL  479



>ref|XP_004973968.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Setaria italica]
Length=389

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 121/171 (71%), Gaps = 10/171 (6%)
 Frame = -1

Query  677  KFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPES  498
            + +   GTPARPG  +P  +F+LYNE+QKPGPGTERH+G+ YPN T +Y +DL+G+ P  
Sbjct  220  RMSKNPGTPARPGAKMPVFLFSLYNEDQKPGPGTERHWGLYYPNQTRVYEVDLTGQRPSR  279

Query  497  EFPPLP--KPTTNQPYKGKVWCVVAP----AANLTAVADALSYACGQGNRTCNPIQPGGA  336
             +PPLP    T + P     WCV+A     AAN TAV  AL YAC QG+ TC  IQPGGA
Sbjct  280  SYPPLPPAGDTDSSP----AWCVLASGEGKAANETAVQAALEYACQQGSGTCAAIQPGGA  335

Query  335  CYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            C+ P++L  HASYAF+SYW QFR+ GGTC+FNGLA  T  DPS+G+CK+ S
Sbjct  336  CHEPDTLDAHASYAFNSYWQQFRNAGGTCFFNGLAEATTKDPSHGSCKFQS  386



>ref|XP_009625839.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Nicotiana tomentosiformis]
Length=440

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 126/173 (73%), Gaps = 4/173 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            V++ TS+  +GTPARP   IPT IF+LY+ENQK GPGTERH+G+L PNG  IY IDL+G+
Sbjct  269  VRRLTSQPLIGTPARPESTIPTFIFSLYDENQKEGPGTERHWGLLLPNGKPIYDIDLTGE  328

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVA-PAANLTAVADALSYACGQGNRTCNPIQPGGAC  333
              E+EF  LP P  N P+ GK+WCV+A    N   +  AL +AC + +  C+ + PG +C
Sbjct  329  ISEAEFSKLPVPKNNGPFNGKLWCVLAKDIVNEMDLGQALEFACKR-DGICDELSPGKSC  387

Query  332  YNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            Y P S++ HA+YAFSSYWA+FR  G TC+FNGLAV+T  DPS+G+CK+P ++L
Sbjct  388  YQPVSIVAHANYAFSSYWAKFRKDGETCHFNGLAVQTTVDPSHGSCKFPYVSL  440



>ref|XP_009625838.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Nicotiana tomentosiformis]
Length=470

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 126/173 (73%), Gaps = 4/173 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            V++ TS+  +GTPARP   IPT IF+LY+ENQK GPGTERH+G+L PNG  IY IDL+G+
Sbjct  299  VRRLTSQPLIGTPARPESTIPTFIFSLYDENQKEGPGTERHWGLLLPNGKPIYDIDLTGE  358

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVA-PAANLTAVADALSYACGQGNRTCNPIQPGGAC  333
              E+EF  LP P  N P+ GK+WCV+A    N   +  AL +AC + +  C+ + PG +C
Sbjct  359  ISEAEFSKLPVPKNNGPFNGKLWCVLAKDIVNEMDLGQALEFACKR-DGICDELSPGKSC  417

Query  332  YNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            Y P S++ HA+YAFSSYWA+FR  G TC+FNGLAV+T  DPS+G+CK+P ++L
Sbjct  418  YQPVSIVAHANYAFSSYWAKFRKDGETCHFNGLAVQTTVDPSHGSCKFPYVSL  470



>gb|KFK39673.1| a6 anther-specific protein [Arabis alpina]
Length=474

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            ++K T+   +GTPAR G  IPT +F+L+NENQKPG GTERH+G+L P+GT IY ID SG 
Sbjct  303  IRKMTANPPLGTPARRGSPIPTFLFSLFNENQKPGSGTERHWGILNPDGTPIYEIDFSGT  362

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P + F  LPKP+ N P+KG VWCVVA  A+   +  AL++ACG+ N TC  + PG  CY
Sbjct  363  RPVNSFGSLPKPSNNVPFKGNVWCVVAEGASEAELGQALNFACGESNATCAALAPGRECY  422

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYAFSSYWAQFR+    CYFNGLA +T  +P    CK+PS+T+
Sbjct  423  EPVSVTWHASYAFSSYWAQFRNQSSRCYFNGLARETTTNPGNERCKFPSVTM  474



>emb|CDP15107.1| unnamed protein product [Coffea canephora]
Length=330

 Score =   197 bits (502),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 120/170 (71%), Gaps = 2/170 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            V++ +++  +GTPARP V IPT I+AL++E+Q PG GT RHFG+L  N   +Y +DL+GK
Sbjct  159  VRRMSAEPPIGTPARPSVFIPTFIYALFDEDQIPGRGTARHFGILQANSWPVYDLDLTGK  218

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
              E ++PPLP P+ N+P+KG +WCVVA  AN+  +   L   C  GN  C+ + PG  CY
Sbjct  219  LGEGDYPPLPLPSNNEPFKGNLWCVVASEANIMELVPQLESVCSLGNGICDALSPGNDCY  278

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSI  180
             P ++  HASYAFSSYW +FRS G  C+FNGLAV +  DPS+G+CK+PS+
Sbjct  279  EPVTIRAHASYAFSSYWVKFRSRGAACHFNGLAVLSTTDPSHGSCKFPSV  328



>ref|XP_010435194.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   201 bits (512),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTP+RPG+ IPT +F+L+NENQKPG GT+RH+G+++P+G  IY ID +G+
Sbjct  308  IKKMTASPPIGTPSRPGLPIPTFVFSLFNENQKPGSGTQRHWGIMHPDGQPIYDIDFTGQ  367

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P + F PLPKPT N PYKG+VWCV    AN   + D L  ACG+ N TC  + PG  CY
Sbjct  368  RPLTGFNPLPKPTNNVPYKGQVWCVPVEGANEAELEDTLRTACGRSNTTCAALAPGRECY  427

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYA SSYWAQFR+    CYFNGLA +T  +P    CK+PS+TL
Sbjct  428  EPVSVYWHASYAISSYWAQFRNQNVRCYFNGLAHETTTNPGNDRCKFPSVTL  479



>ref|XP_009777293.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
sylvestris]
Length=470

 Score =   201 bits (512),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 125/173 (72%), Gaps = 4/173 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            V++ TS+  +GTPARPG  IPT IF+LY+ENQK GPGTERH+G+L PNG  IY IDL+G+
Sbjct  299  VRRLTSQPPIGTPARPGSTIPTFIFSLYDENQKEGPGTERHWGLLQPNGKAIYDIDLTGE  358

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVA-PAANLTAVADALSYACGQGNRTCNPIQPGGAC  333
              ESE   LP P  N P+ GK+WCV+A    N   +  AL +AC + +  C+ + P  +C
Sbjct  359  ISESELSKLPVPKNNGPFHGKLWCVLAKDIVNEKDLGQALEFACKR-DGICDELSPEKSC  417

Query  332  YNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            Y P S++ HA+YAFSSYWA+FR  G TC+FNGLAV+T  DPS+G+CK+P ++L
Sbjct  418  YQPVSIVAHANYAFSSYWAKFRKDGETCHFNGLAVQTTLDPSHGSCKFPYVSL  470



>ref|XP_008380636.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=469

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 123/165 (75%), Gaps = 4/165 (2%)
 Frame = -1

Query  662  VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPL  483
            +GTPARPGVVIPT IF+L++ENQK GPGTERH+G+L+ +GT IY +DL+GK    ++ PL
Sbjct  303  LGTPARPGVVIPTFIFSLFDENQKTGPGTERHWGLLHADGTPIYDVDLTGKRVLEDYEPL  362

Query  482  PKPTTNQPYKGKVWCVVAP--AANLTAVADALSYACGQGNR--TCNPIQPGGACYNPNSL  315
            P+   N+PYKG VWCVVA   + N   +  A++ AC  GN   TC+ + PG  CY P SL
Sbjct  363  PEEQNNRPYKGAVWCVVAKGVSVNDEELGSAVNNACIAGNASGTCDALSPGKECYEPVSL  422

Query  314  IRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSI  180
              HAS+AFSSYWA+FRS G TC+FNGLA +T  DPS+G+CK+PS+
Sbjct  423  TWHASFAFSSYWAKFRSQGATCHFNGLAEQTSLDPSHGSCKFPSV  467



>emb|CDY12371.1| BnaC08g08340D [Brassica napus]
Length=479

 Score =   201 bits (511),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 123/172 (72%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPARP + IPT +F+L+NENQK G GT+RH+G+L+P+GT IY ID +G+
Sbjct  308  IKKMTAIPPIGTPARPALPIPTFVFSLFNENQKSGSGTQRHWGILHPDGTPIYDIDFTGQ  367

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P + F PLPKPT N PYKG+VWCV+   AN   + +AL  ACG+ N TC  + PG  CY
Sbjct  368  KPLTGFNPLPKPTNNVPYKGQVWCVLVEGANEAELEEALRIACGRSNTTCAALAPGKECY  427

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            +P S+  HASYA SSYWAQFR+    CYFNGLA ++  +P    CK+PS+TL
Sbjct  428  DPVSIYWHASYAVSSYWAQFRTQNVGCYFNGLAHESTINPGNDRCKFPSVTL  479



>ref|NP_189019.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 dbj|BAB01853.1| beta-1,3-glucanase [Arabidopsis thaliana]
 gb|ABE65959.1| glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
 gb|AEE76811.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=476

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPAR G  IPT +F+L+NENQKPG GTERH+G+L P+GT IY ID SG+
Sbjct  305  IKKMTANPPLGTPARRGAPIPTFLFSLFNENQKPGSGTERHWGILNPDGTPIYDIDFSGR  364

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
               S F  LPKP+ N P+KG VWCV    A+   +  AL++ACG+ N TC  + PGG CY
Sbjct  365  RSFSGFDSLPKPSNNVPFKGNVWCVAVDGADEAELGQALNFACGRSNATCAALAPGGECY  424

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P ++  HASYAFSSYWAQFR+    CYFNGLA +T  +P    CK+PS+TL
Sbjct  425  APVTVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNERCKFPSVTL  476



>gb|ABK28569.1| unknown [Arabidopsis thaliana]
Length=477

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPAR G  IPT +F+L+NENQKPG GTERH+G+L P+GT IY ID SG+
Sbjct  305  IKKMTANPPLGTPARRGAPIPTFLFSLFNENQKPGSGTERHWGILNPDGTPIYDIDFSGR  364

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
               S F  LPKP+ N P+KG VWCV    A+   +  AL++ACG+ N TC  + PGG CY
Sbjct  365  RSFSGFDSLPKPSNNVPFKGNVWCVAVDGADEAELGQALNFACGRSNATCAALAPGGECY  424

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P ++  HASYAFSSYWAQFR+    CYFNGLA +T  +P    CK+PS+TL
Sbjct  425  APVTVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNERCKFPSVTL  476



>ref|XP_010450129.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTP+RPG+ IPT +F+L+NENQKPG GT+RH+G+++P+G  IY ID +G+
Sbjct  308  IKKMTTSPPIGTPSRPGLPIPTFVFSLFNENQKPGSGTQRHWGIMHPDGQPIYDIDFTGQ  367

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P + F PLPKPT N PYKG+VWCV    AN   + + L  ACG+ N TC  + PG  CY
Sbjct  368  RPLTGFNPLPKPTNNVPYKGQVWCVPVEGANEAELEETLRTACGRSNTTCAALAPGRECY  427

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYA SSYWAQFR+    CYFNGLA +T  +P    CK+PS+TL
Sbjct  428  EPVSVYWHASYAISSYWAQFRNQNVRCYFNGLAHETTTNPGNDRCKFPSVTL  479



>ref|XP_010450110.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTP+RPG+ IPT +F+L+NENQKPG GT+RH+G+++P+G  IY ID +G+
Sbjct  308  IKKMTASPPIGTPSRPGLPIPTFVFSLFNENQKPGSGTQRHWGIMHPDGQPIYDIDFTGQ  367

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P + F PLPKPT N PYKG+VWCV    AN   + + L  ACG+ N TC  + PG  CY
Sbjct  368  RPLTGFNPLPKPTNNVPYKGQVWCVPVEGANEAELEETLRTACGRSNTTCAALAPGRECY  427

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYA SSYWAQFR+    CYFNGLA +T  +P    CK+PS+TL
Sbjct  428  EPVSVYWHASYAISSYWAQFRNQNVRCYFNGLAHETTTNPGNDRCKFPSVTL  479



>gb|AAM64490.1| beta-1,3-glucanase, putative [Arabidopsis thaliana]
Length=476

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 119/172 (69%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPAR G  IPT +F+L+NENQKPG GTERH+G+L P+GT IY ID SG 
Sbjct  305  IKKMTANPPLGTPARRGAPIPTFLFSLFNENQKPGSGTERHWGILNPDGTPIYDIDFSGT  364

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
               S F  LPKP+ N P+KG VWCV    A+   +  AL++ACG+ N TC  + PGG CY
Sbjct  365  RSFSGFDSLPKPSNNVPFKGNVWCVAVDGADEAELGQALNFACGRSNATCAALAPGGECY  424

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P ++  HASYAFSSYWAQFR+    CYFNGLA +T  +P    CK+PS+TL
Sbjct  425  APVTVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNERCKFPSVTL  476



>ref|NP_193144.1| putative glucan endo-1,3-beta-glucosidase A6 [Arabidopsis thaliana]
 sp|Q06915.1|EA6_ARATH RecName: Full=Probable glucan endo-1,3-beta-glucosidase A6; AltName: 
Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Anther-specific protein A6; AltName: 
Full=Beta-1,3-endoglucanase; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA49853.1| A6 [Arabidopsis thaliana]
 emb|CAB10187.1| A6 anther-specific protein [Arabidopsis thaliana]
 emb|CAB78450.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AAM20432.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AAN72161.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AEE83368.1| putative glucan endo-1,3-beta-glucosidase A6 [Arabidopsis thaliana]
Length=478

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK ++   +GTP+RPG+ IPT +F+L+NENQK G GT+RH+G+L+P+G+ IY +D +G+
Sbjct  307  IKKMSASPPIGTPSRPGLPIPTFVFSLFNENQKSGSGTQRHWGILHPDGSPIYDVDFTGQ  366

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            TP + F PLPKPT N PYKG+VWCV    AN T + + L  AC Q N TC  + PG  CY
Sbjct  367  TPLTGFNPLPKPTNNVPYKGQVWCVPVEGANETELEETLRMACAQSNTTCAALAPGRECY  426

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYA +SYWAQFR+    C+FNGLA +T  +P    CK+PS+TL
Sbjct  427  EPVSIYWHASYALNSYWAQFRNQSIQCFFNGLAHETTTNPGNDRCKFPSVTL  478



>ref|XP_006299757.1| hypothetical protein CARUB_v10015952mg [Capsella rubella]
 gb|EOA32655.1| hypothetical protein CARUB_v10015952mg [Capsella rubella]
Length=476

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 118/172 (69%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPAR G  IPT +F+L+NENQKPG GTERH+G+L P+GT IY ID +G 
Sbjct  305  IKKMTANPPLGTPARRGAPIPTFLFSLFNENQKPGSGTERHWGILNPDGTPIYEIDFTGT  364

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P S F  LPKP  N P+KG VWCV    A+   +  AL++ACG+ N TC  + PG  CY
Sbjct  365  RPVSSFGELPKPDNNVPFKGNVWCVAIDGASEAELGQALNFACGRSNETCAALAPGKECY  424

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYAFSSYWAQFR+    CYFNGLA +T  +P    CK+PS+TL
Sbjct  425  APVSVSWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNERCKFPSVTL  476



>ref|XP_009135862.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=480

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 117/172 (68%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPARPG  IPT +F+L+NENQKPG GTERH+G+L P+GT IY ID SG 
Sbjct  309  IKKMTANPPLGTPARPGSPIPTFLFSLFNENQKPGSGTERHWGILKPDGTQIYEIDFSGT  368

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P      LPKP+ N P+KG VWCV    A+   +  AL++ACGQ N TC  + PG  CY
Sbjct  369  RPVPSPGSLPKPSNNVPFKGNVWCVAVEGASEAELQQALNFACGQSNATCAALAPGRECY  428

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P SL  HASYAFSSYWAQFR+    CYFNGLA +T  +P    C +PS+TL
Sbjct  429  APVSLTWHASYAFSSYWAQFRNQSSRCYFNGLARETTTNPGNEHCTFPSVTL  480



>ref|XP_009108090.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=479

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPARPG+ IPT +F+L+NENQK G GT+RH+G+L+P+GT IY ID +G+
Sbjct  308  IKKMTAIPPIGTPARPGLPIPTFVFSLFNENQKSGSGTQRHWGILHPDGTPIYDIDFTGQ  367

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P + F PLPKPT N PYKG++WCV    A    + +AL  ACG+ N TC  + PG  CY
Sbjct  368  KPLTGFNPLPKPTNNVPYKGQMWCVPVEGAKEAELEEALRMACGRSNTTCAALAPGKECY  427

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HA YA SSYWAQFR+    CYFNGLA +T  +P    CK+PS+TL
Sbjct  428  EPVSIYWHARYAVSSYWAQFRTQNVGCYFNGLAHETTTNPGNDRCKFPSVTL  479



>ref|XP_002883459.1| hypothetical protein ARALYDRAFT_479892 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59718.1| hypothetical protein ARALYDRAFT_479892 [Arabidopsis lyrata subsp. 
lyrata]
Length=476

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 119/172 (69%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPAR G  IPT +F+L+NENQKPG GTERH+G+L P+GT IY ID SG 
Sbjct  305  IKKMTANPPLGTPARRGSPIPTFLFSLFNENQKPGSGTERHWGILNPDGTPIYDIDFSGT  364

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
               S F  LPKP+ N P+KG VWCV    A+   +  AL++ACG+ N TC  + PGG CY
Sbjct  365  RSVSSFGTLPKPSNNVPFKGNVWCVAVDGADEAELGLALNFACGRNNETCAALAPGGECY  424

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P ++  HASYAFSSYWAQFR+    CYFNGLA +T  +P    CK+PS+TL
Sbjct  425  APVTVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTINPGNERCKFPSVTL  476



>ref|XP_006418839.1| hypothetical protein EUTSA_v10002513mg [Eutrema salsugineum]
 gb|ESQ37275.1| hypothetical protein EUTSA_v10002513mg [Eutrema salsugineum]
Length=474

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 118/172 (69%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPAR G  IPT +F+L+NENQKPG GTERH+G+L P+GT IY ID SG 
Sbjct  303  IKKMTANPPLGTPARRGSPIPTFLFSLFNENQKPGSGTERHWGILNPDGTRIYEIDFSGT  362

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
               + F  +PKP+ N P+KG VWCVV   A+   +  AL +ACG+ N TC  + PG  CY
Sbjct  363  RQVNSFGSMPKPSNNVPFKGNVWCVVVEGASEAELGQALEFACGRSNVTCAALAPGRECY  422

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYAFSSYWAQFR+    CYFNGLA +T  +P    CK+PS++L
Sbjct  423  APVSVTWHASYAFSSYWAQFRNQSSRCYFNGLARETTTNPGNERCKFPSVSL  474



>emb|CDY53213.1| BnaC03g74070D [Brassica napus]
Length=480

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 116/172 (67%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTP RPG  IPT +F+L+NENQKPG GTERH+G+L P+GT IY ID SG 
Sbjct  309  IKKMTANPPIGTPVRPGSPIPTFLFSLFNENQKPGSGTERHWGILNPDGTQIYEIDFSGT  368

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P      LPKP+ N P+KG VWCV    A+   +  AL++ACGQ N TC  + PG  CY
Sbjct  369  RPVPSPGSLPKPSNNVPFKGNVWCVAVEGASEAELQQALNFACGQSNATCAALAPGRECY  428

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P SL  HASYAFSSYWAQFR+    CYFNGLA +T  +P    C +PS+TL
Sbjct  429  APVSLTWHASYAFSSYWAQFRNQSSRCYFNGLARETTTNPGNEHCTFPSVTL  480



>emb|CAK18899.1| glucan 1,3-beta glucosidase [Cocos nucifera]
Length=179

 Score =   188 bits (478),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = -1

Query  581  GTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA---PAANLT  411
            GTERH+G+LYPN T +Y +DL+G+ P++ + PLP P  N+PYKGK+WCV      + N T
Sbjct  4    GTERHWGLLYPNATRVYEVDLTGRLPDAGYGPLPPPGNNKPYKGKIWCVFGRRGKSVNAT  63

Query  410  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  231
            AV  A+SYACGQG  TC+ IQPGG CY P+SL  HASYAF+SYW QFR  GGTCYFNGLA
Sbjct  64   AVGSAISYACGQGKGTCDAIQPGGPCYRPDSLTAHASYAFNSYWQQFRRSGGTCYFNGLA  123

Query  230  VKTINDPSYGACKYPSI  180
            V+   DPSYG+CK+PSI
Sbjct  124  VQAAQDPSYGSCKFPSI  140



>ref|XP_006282877.1| hypothetical protein CARUB_v10006945mg [Capsella rubella]
 gb|EOA15775.1| hypothetical protein CARUB_v10006945mg [Capsella rubella]
Length=478

 Score =   196 bits (499),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTP+RPG+ IPT +F+L+NENQK G GT+RH+G+L+P+G  IY ID +G+
Sbjct  307  IKKMTASPPIGTPSRPGLPIPTFVFSLFNENQKSGSGTQRHWGILHPDGIPIYDIDFTGQ  366

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P + F PLPKPT N PYKG+VWCV    AN++ + + L   C + N TC  + PG  CY
Sbjct  367  KPLTGFNPLPKPTNNVPYKGQVWCVPVDGANVSELEETLRTTCSRSNTTCAALAPGRECY  426

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYA SSYWAQFR+    CYFNGLA +T  +P    CK+PS+TL
Sbjct  427  EPVSVYWHASYAISSYWAQFRNQNVQCYFNGLAHETTTNPGNDRCKFPSVTL  478



>emb|CDY27122.1| BnaA08g07600D [Brassica napus]
Length=479

 Score =   196 bits (498),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPARPG+ IPT +F+L+NEN+K G GT+RH+G+L+P+GT IY ID +G+
Sbjct  308  IKKMTAIPPIGTPARPGLPIPTFVFSLFNENKKSGSGTQRHWGILHPDGTPIYDIDFTGQ  367

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P + F PLPKPT N PYKG++WCV    A    + +AL  ACG+ N TC  + PG  CY
Sbjct  368  KPLTGFNPLPKPTNNVPYKGQMWCVPVEGAKEAELEEALRMACGRSNTTCAALAPGKECY  427

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HA YA SSYWAQFR+    CYFNGLA +T  +P    CK+PS+TL
Sbjct  428  EPVSIYWHARYAVSSYWAQFRTQNVGCYFNGLAHETTTNPGNDRCKFPSVTL  479



>gb|KJB37880.1| hypothetical protein B456_006G224700 [Gossypium raimondii]
Length=462

 Score =   196 bits (497),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 119/172 (69%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            ++K TSK  +G+P  PG++IPT I +LY+EN+K GP TERH+G+L+ NGT +Y IDL+G 
Sbjct  291  IRKMTSKQPLGSPKSPGLIIPTFISSLYDENRKIGPETERHWGMLHTNGTPVYEIDLTGN  350

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
               SE+ PLP    N PYKGK+WC VAP  N  ++  ALS  C   N TC  + PG  CY
Sbjct  351  RKISEYKPLPPAVNNVPYKGKLWCEVAPWVNEMSLPAALSNVCSIDNETCAALAPGKDCY  410

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S++ HASYAFSSYWA+FRS G  C FNGLA +T  DPS G C +PS+T+
Sbjct  411  EPVSVVWHASYAFSSYWAKFRSQGAICSFNGLARETTVDPSRGRCNFPSVTV  462



>ref|XP_010512882.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=476

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 116/172 (67%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPAR G  IPT +F+L+NENQKPG GTERH+G+L  +GT IY ID SG 
Sbjct  305  IKKMTANPPLGTPARRGAPIPTFLFSLFNENQKPGSGTERHWGILDHDGTPIYEIDFSGT  364

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
               S F  LPKP+ N P+KG VWCV    A    +  AL++ACG+ N TC  + PG  CY
Sbjct  365  RSVSSFDKLPKPSNNVPFKGNVWCVAVDGAGEAELGQALNFACGRSNETCAALAPGRECY  424

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYAFSSYWAQFR+    CYFNGLA +T  +P    CK+PS+TL
Sbjct  425  APVSVSWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNERCKFPSVTL  476



>gb|KCW48409.1| hypothetical protein EUGRSUZ_K02112 [Eucalyptus grandis]
Length=418

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 119/172 (69%), Gaps = 21/172 (12%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T++  VGTPARP   +   IFAL+NENQKPGP TERHFG+LYPNG+ +Y IDL GK
Sbjct  266  IKKLTARPPVGTPARPRRAMQGFIFALFNENQKPGPTTERHFGLLYPNGSKVYQIDLRGK  325

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
            T  S + PLP+PT N+ YKG ++                   C QGN TC  I+PG AC+
Sbjct  326  TTSSGYEPLPEPTNNKQYKGPMY-------------------CSQGNNTCEAIRPGKACH  366

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            NP+  + HA+YAFSSYWA+FR+ G +C+ NGLA +TI DPS+G+CK+PS+ L
Sbjct  367  NPDLSLFHANYAFSSYWAEFRNSGASCFLNGLATQTIKDPSHGSCKFPSVAL  418



>gb|ADE76604.1| unknown [Picea sitchensis]
Length=462

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 116/159 (73%), Gaps = 2/159 (1%)
 Frame = -1

Query  662  VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPL  483
            +GTP RP   IPT IF+L+NENQK G GTERH+G+LYPNG+ +Y IDL+G+  +SE+ P 
Sbjct  304  LGTPRRPNQFIPTYIFSLFNENQKTGLGTERHWGLLYPNGSRLYEIDLTGELQDSEYKP-  362

Query  482  PKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHA  303
              P    PYKGK+WCVV   AN++A+  A++YAC QGN TC  IQPG  CY PN++I HA
Sbjct  363  -LPPPPPPYKGKLWCVVDANANVSALPSAITYACSQGNNTCVAIQPGKPCYQPNTVIDHA  421

Query  302  SYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYP  186
            SYAF+SYW QF++ GGTCYFNG A     DPS   C+YP
Sbjct  422  SYAFNSYWQQFKNSGGTCYFNGAATLVTKDPSSKICRYP  460



>ref|XP_010488453.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=476

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 116/172 (67%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPAR G  IPT +F+L+NENQKPG GTERH+G+L  +GT IY ID SG 
Sbjct  305  IKKLTANPPLGTPARRGAPIPTFLFSLFNENQKPGSGTERHWGILNHDGTPIYEIDFSGT  364

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
               S F  LPKP+ N P+KG VWCV    A    +  AL++ACG+ N TC  + PG  CY
Sbjct  365  RSVSSFDKLPKPSNNVPFKGSVWCVAVDGAGEAELGQALNFACGRSNETCAALAPGRECY  424

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYAFSSYWAQFR+    CYFNGL+ +T  +P    CK+PS+TL
Sbjct  425  APVSVSWHASYAFSSYWAQFRNQSSQCYFNGLSRETTTNPGNERCKFPSVTL  476



>ref|NP_001168659.1| uncharacterized protein LOC100382447 [Zea mays]
 gb|ACN29077.1| unknown [Zea mays]
Length=384

 Score =   192 bits (487),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 121/167 (72%), Gaps = 11/167 (7%)
 Frame = -1

Query  677  KFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPES  498
            + ++  GTPARPG  +P  +F+LYNE++KPGPG+ERH+G+ YPNG+ +Y +DL+G+   S
Sbjct  220  RMSNSPGTPARPGAEVPVFLFSLYNEDRKPGPGSERHWGLYYPNGSMVYELDLTGR--RS  277

Query  497  EFPPLPKPTTNQPYKGKVWCVVAP----AANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             +PPLP   +        WCV+A     AAN TAV+ A++YAC  G+RTC  IQPGGAC+
Sbjct  278  SYPPLPSADS-----APAWCVLASGGGKAANETAVSAAVAYACQHGSRTCAAIQPGGACH  332

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKY  189
             P++L  HASYAF++YW QFRS GGTC+F+GLA  T  DPS+G CK+
Sbjct  333  EPDALDAHASYAFNAYWQQFRSAGGTCFFDGLAETTTEDPSHGLCKF  379



>ref|XP_009139564.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=480

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 119/172 (69%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPARPG+ IPT +F+L++E+QK G GT+RH+G+L+P+GT IY ID +G+
Sbjct  309  IKKMTAIPPIGTPARPGLAIPTFVFSLFDEDQKSGSGTQRHYGILHPDGTPIYDIDFTGE  368

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P + F PLPKPT N PYKG VWCV    A+   + +AL  ACG+ N TC  + PG  CY
Sbjct  369  KPLTGFNPLPKPTNNVPYKGIVWCVPVVGASEAQLEEALRMACGRSNTTCAALAPGRECY  428

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYA SSYWA+FR+    CYFNGLA  T  +P    CK+P +TL
Sbjct  429  EPVSVYWHASYAVSSYWAEFRTENVRCYFNGLARMTTVNPGNDRCKFPGVTL  480



>emb|CDY12732.1| BnaC04g29090D [Brassica napus]
Length=480

 Score =   193 bits (491),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 118/172 (69%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPARPG+ IPT +F+L++ENQK G GT+RH+G+L+P+GT IY ID +G+
Sbjct  309  IKKMTAIPPIGTPARPGLAIPTFVFSLFDENQKSGSGTQRHYGILHPDGTPIYDIDFTGE  368

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P + F PLPKP  N PYKG VWCV    A+   + +AL  ACG+ N TC  + PG  CY
Sbjct  369  KPLTGFNPLPKPKNNVPYKGIVWCVPVEGASEAQLEEALRMACGRSNTTCAALAPGRECY  428

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYA SSYWA+FR+    CYFNGLA  T  +P    CK+P +TL
Sbjct  429  EPVSVYWHASYAVSSYWAEFRTENVRCYFNGLARMTTINPGNDRCKFPGVTL  480



>emb|CDY01191.1| BnaA04g06280D [Brassica napus]
Length=480

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 119/172 (69%), Gaps = 2/172 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPARPG+ IPT +F+L++E+QK G GT+RH+G+L+P+GT IY ID +G+
Sbjct  309  IKKMTAIPPIGTPARPGLSIPTFVFSLFDEDQKSGSGTQRHYGILHPDGTPIYDIDFTGE  368

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P + F PLPKPT N PYKG VWCV    A+   + +AL  ACG+ N TC  + PG  CY
Sbjct  369  KPLTGFNPLPKPTNNVPYKGIVWCVPVVGASEAQLEEALRMACGRSNTTCAALAPGRECY  428

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYA SSYWA+FR+    CYFNGLA  T  +P    CK+P +TL
Sbjct  429  EPVSVYWHASYAVSSYWAEFRTENVRCYFNGLARMTTVNPGNDRCKFPGVTL  480



>ref|XP_008643986.1| PREDICTED: uncharacterized protein LOC100382447 isoform X1 [Zea 
mays]
 tpg|DAA48156.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=482

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 121/167 (72%), Gaps = 11/167 (7%)
 Frame = -1

Query  677  KFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPES  498
            + ++  GTPARPG  +P  +F+LYNE++KPGPG+ERH+G+ YPNG+ +Y +DL+G+   S
Sbjct  318  RMSNSPGTPARPGAEVPVFLFSLYNEDRKPGPGSERHWGLYYPNGSMVYELDLTGR--RS  375

Query  497  EFPPLPKPTTNQPYKGKVWCVVAP----AANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             +PPLP   +        WCV+A     AAN TAV+ A++YAC  G+RTC  IQPGGAC+
Sbjct  376  SYPPLPSADS-----APAWCVLASGGGKAANETAVSAAVAYACQHGSRTCAAIQPGGACH  430

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKY  189
             P++L  HASYAF++YW QFRS GGTC+F+GLA  T  DPS+G CK+
Sbjct  431  EPDALDAHASYAFNAYWQQFRSAGGTCFFDGLAETTTEDPSHGLCKF  477



>ref|XP_010466734.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=474

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 116/172 (67%), Gaps = 4/172 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPAR G  IPT +F+L+NENQKPG GTERH+G+L  +GT IY ID SG 
Sbjct  305  IKKLTANPPLGTPARRGAPIPTFLFSLFNENQKPGSGTERHWGILNHDGTPIYEIDFSGT  364

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
               S F  LPKP+ N P+KG VWCV    A    +  AL++ACG+ N TC  + PG  CY
Sbjct  365  I--SSFDKLPKPSNNVPFKGNVWCVAVDGAGEAELGQALNFACGRSNETCAALAPGRECY  422

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
             P S+  HASYAFSSYWAQFR+    CYFNGLA +T  +P    CK+PS+TL
Sbjct  423  APVSVSWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNERCKFPSVTL  474



>ref|XP_010527440.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=489

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 120/177 (68%), Gaps = 7/177 (4%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPARPG VIPT +F+L++EN+KPGPGTERH+G+L P+GT +Y ID +G+
Sbjct  313  IKKMTADPPIGTPARPGSVIPTFVFSLFDENRKPGPGTERHWGILRPSGTPVYEIDFTGR  372

Query  509  TPESEFPPLPKPTTNQP-----YKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQP  345
             P S + P  KP           K + WCVV   A++ A+  AL +ACG+ N TC+ + P
Sbjct  373  KPVSGYGPPAKPGNGGVGVAPCKKRRAWCVVKEGADVAALGQALGFACGRSNETCSALAP  432

Query  344  GGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            G  CY P ++  HASYAFSSYWAQFRS    CYFNGLA +T  DP  G CK+PS+ L
Sbjct  433  GRECYQPVTITWHASYAFSSYWAQFRSQNARCYFNGLARETTVDPGNGRCKFPSVAL  489



>gb|KGN57233.1| hypothetical protein Csa_3G172380 [Cucumis sativus]
Length=487

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            VK+ T+K  VGTPARP VVIPT IF+L++ENQKPG GTERH+G+L  +G+  Y IDL+GK
Sbjct  296  VKRITAKPTVGTPARPKVVIPTFIFSLFDENQKPGSGTERHWGLLSSDGSPNYQIDLTGK  355

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
                E+ PLP    N P++G++WCV A   +L  +   +   CG+G+ TC  + PG  CY
Sbjct  356  ESSVEYDPLPVVENNMPFRGRLWCVAARGVDLMELGATVDDVCGRGDGTCEALSPGRECY  415

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  207
             P S+  HASYAFSSYW++FRS G +CYFNGLA +T  DP+
Sbjct  416  EPVSVYWHASYAFSSYWSKFRSQGASCYFNGLAEQTTTDPN  456



>ref|XP_010673323.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Beta 
vulgaris subsp. vulgaris]
Length=473

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 116/164 (71%), Gaps = 3/164 (2%)
 Frame = -1

Query  662  VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPL  483
            +GTPARPG +IPT +F+LYNE+ K GP TERH+G+L P+GT +YPIDL+G   ++ F PL
Sbjct  312  LGTPARPGTIIPTFLFSLYNEDLKDGPKTERHWGLLKPDGTPVYPIDLTGA--QTNFGPL  369

Query  482  PKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCN-PIQPGGACYNPNSLIRH  306
             +P  N  YKGKVWCVV   AN+T +  AL   C + N TC   + PG  CY P S++ H
Sbjct  370  RQPENNMGYKGKVWCVVDKMANITELGPALRRTCSRLNETCELSLGPGKHCYEPVSVVWH  429

Query  305  ASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            AS+AF++YWA+FR  G  CYF GLA  T  +PS+G+C +PS+T+
Sbjct  430  ASFAFNAYWAKFRDSGEICYFGGLASLTTRNPSHGSCHFPSVTI  473



>ref|XP_008669802.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Zea 
mays]
 tpg|DAA38972.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=472

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 121/173 (70%), Gaps = 4/173 (2%)
 Frame = -1

Query  680  KKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPE  501
            ++  S  GTP RPGV +P ++FAL+NE+ K GP TERH+G+ YPNG+ +Y +DL+G+ P 
Sbjct  299  RRLASGAGTPRRPGVPVPAMVFALFNEDLKWGPDTERHWGLFYPNGSAVYEVDLTGRRPL  358

Query  500  SEFPPLPKPTTNQPYKGKVWCVVAPAA-NLTAVADALSYACGQG---NRTCNPIQPGGAC  333
            + +PPLP  T +QPY+G +WCVV  A  N TAV + ++  C      +  C+P++PGGAC
Sbjct  359  ASYPPLPPATNDQPYRGPLWCVVRTAGINETAVREQVAAVCDDDEAEDALCDPVRPGGAC  418

Query  332  YNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            + PN++  HASY FS++W +F    G CYF+G  ++T  DPS+G+CK+PSI L
Sbjct  419  FLPNTVAAHASYVFSAHWNRFSEDYGACYFDGWGMETTIDPSHGSCKFPSIHL  471



>ref|XP_003581305.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=473

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 119/170 (70%), Gaps = 3/170 (2%)
 Frame = -1

Query  680  KKFTSKVGTPARPGVV-IPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK-T  507
            +   S  GTP RPG++ +P  +FAL+NE+ K GPGTERH+G+ YPN + +Y +DLSG+ T
Sbjct  301  RHLASGAGTPRRPGMMRMPAFVFALFNEDLKGGPGTERHWGLFYPNSSAVYEVDLSGRRT  360

Query  506  PESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYN  327
              S +PPLP  T + PY GK+WC+    AN TAV + ++ AC      C+P++PGG C+ 
Sbjct  361  AASSYPPLPPATNDAPYPGKLWCMTKKLANGTAVREQVAAACKDEAALCDPVRPGGRCHL  420

Query  326  PNSLIRHASYAFSSYWAQF-RSLGGTCYFNGLAVKTINDPSYGACKYPSI  180
            P+++  HASY FS++W +F +  GG CYF GLAV+T  DPS+G+C+YPS+
Sbjct  421  PDTVAAHASYVFSAHWNRFSKQYGGWCYFAGLAVETTIDPSHGSCRYPSV  470



>gb|EEC76518.1| hypothetical protein OsI_14304 [Oryza sativa Indica Group]
Length=175

 Score =   172 bits (437),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 120/172 (70%), Gaps = 3/172 (2%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
             +   S  GTP RPG+ +P  +FAL+NE+ K GP TERH+G+ +PNG+ +Y +DL+G+ P
Sbjct  2    ARHLASGAGTPRRPGMRMPAFVFALFNEDLKTGPATERHWGLFHPNGSAVYEVDLTGRRP  61

Query  503  ESEFPPLPKPTTNQ-PYKGKVWCVV-APAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             + +PPLP P TN  PY GK+WCVV A AAN TAV + +  AC      C P++ GG CY
Sbjct  62   PASYPPLPPPATNDAPYPGKLWCVVGAAAANETAVREQMEAACADEAALCAPVRAGGECY  121

Query  329  NPNSLIRHASYAFSSYWAQFRSL-GGTCYFNGLAVKTINDPSYGACKYPSIT  177
             PN++  HASY FS++W +F  + GG CYF GLA++T  DPS+G+CK+PS+T
Sbjct  122  LPNTVAAHASYVFSAHWNKFSKVYGGWCYFAGLAMETTTDPSHGSCKFPSVT  173



>emb|CAA49515.1| beta-1,3-glucanase homologue [Brassica napus]
Length=139

 Score =   167 bits (424),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 93/139 (67%), Gaps = 0/139 (0%)
 Frame = -1

Query  590  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  411
            PG GTERH+G+L P+GT IY IDLSG  P S    LPKP  N P+KG VWCV    AN T
Sbjct  1    PGSGTERHWGILNPDGTQIYDIDLSGTRPVSSLGSLPKPNNNVPFKGNVWCVAVEGANET  60

Query  410  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  231
             +  AL +ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA
Sbjct  61   ELGQALDFACGRSNATCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLA  120

Query  230  VKTINDPSYGACKYPSITL  174
             +T  +P    CK+PS+TL
Sbjct  121  RETTTNPGNEQCKFPSVTL  139



>ref|XP_001777261.1| predicted protein [Physcomitrella patens]
 gb|EDQ57916.1| predicted protein [Physcomitrella patens]
Length=453

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 116/181 (64%), Gaps = 14/181 (8%)
 Frame = -1

Query  683  VKKF--TSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            V+K   TSKVGTP +PGV IPT IFAL+NENQK G GTE+H+G+LYPNGTN+Y ID++G 
Sbjct  272  VRKMVSTSKVGTPLKPGVYIPTFIFALFNENQKTGQGTEKHWGLLYPNGTNVYSIDMTGT  331

Query  509  TPESEFPPLPK------------PTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNR  366
              + ++ PL              P  N P     WCV  P  N   +  AL +ACG G  
Sbjct  332  LSDGQYTPLSDNPIFTTAPPPTLPPGNVPSTTGTWCVAKPGMNPPMLQAALDFACGPGGA  391

Query  365  TCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYP  186
             C P+Q GG+CYNP++++ H+SYAF+SY+ + ++ GG+C F G A  T  DPS+  CK+P
Sbjct  392  DCQPLQVGGSCYNPDTILDHSSYAFNSYYQRTKAAGGSCNFGGAATLTTTDPSHDTCKFP  451

Query  185  S  183
            +
Sbjct  452  T  452



>dbj|BAG16366.1| tapetum-specific protein A6 family protein [Brassica rapa var. 
perviridis]
Length=399

 Score =   173 bits (438),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 103/142 (73%), Gaps = 2/142 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPARPG  IPT +F+L+NEN+KPG GT+RH+G+L+P+GT IY ID +G+
Sbjct  255  IKKMTAIPPIGTPARPGSPIPTFVFSLFNENKKPGSGTQRHWGILHPDGTPIYDIDFTGQ  314

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P + F PLPKPT N PYKG+VWCV+   AN   + +AL  AC + N TC  + PG  CY
Sbjct  315  KPLTGFNPLPKPTNNVPYKGQVWCVLVEGANEAELEEALRMACARSNTTCAALAPGRECY  374

Query  329  NPNSLIRHASYAFSSYWAQFRS  264
             P S+  HASYA +SYWAQFRS
Sbjct  375  EPVSVYSHASYALNSYWAQFRS  396



>dbj|BAG16359.1| tapetum-specific protein A6 family protein [Brassica oleracea 
var. italica]
Length=399

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 103/142 (73%), Gaps = 2/142 (1%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+   +GTPARPG  IPT +F+L+NEN+KPG GT+RH+G+L+P+GT IY ID +G+
Sbjct  255  IKKMTATPPIGTPARPGSPIPTFVFSLFNENKKPGSGTQRHWGILHPDGTPIYDIDFTGQ  314

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             P + F PLPKPT N PYKG+VWCV    AN T + +AL  AC + N TC  + PG  CY
Sbjct  315  KPLTGFNPLPKPTNNVPYKGQVWCVPVEGANETELEEALRMACARSNTTCAALVPGRECY  374

Query  329  NPNSLIRHASYAFSSYWAQFRS  264
             P S+  HASYA +SYWAQFRS
Sbjct  375  EPVSVYWHASYALNSYWAQFRS  396



>gb|EEC76519.1| hypothetical protein OsI_14305 [Oryza sativa Indica Group]
Length=474

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 120/171 (70%), Gaps = 3/171 (2%)
 Frame = -1

Query  680  KKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPE  501
            +   S  GTP RPG+ +P  +FAL+NE+ K GP TERH+G+ +PNG+ +Y +DL+G+ P 
Sbjct  302  RHLASGAGTPRRPGMRMPAFVFALFNEDLKTGPATERHWGLFHPNGSAVYEVDLTGRRPP  361

Query  500  SEFPPLPKPTTNQ-PYKGKVWCVV-APAANLTAVADALSYACGQGNRTCNPIQPGGACYN  327
            + +PPLP P TN  PY GK+WCVV A AAN TAV + +  AC      C P++ GG CY 
Sbjct  362  ASYPPLPPPATNDAPYPGKLWCVVGAAAANETAVREQMEAACADEAALCAPVRAGGECYL  421

Query  326  PNSLIRHASYAFSSYWAQFRSL-GGTCYFNGLAVKTINDPSYGACKYPSIT  177
            PN++  HASY FS++W +F  + GG CYF GLA++T  DPS+G+CK+PS+T
Sbjct  422  PNTVAAHASYVFSAHWNKFSKVYGGWCYFAGLAMETTTDPSHGSCKFPSVT  472



>ref|NP_001051879.1| Os03g0845600 [Oryza sativa Japonica Group]
 gb|AAO73280.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 gb|AAS07356.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 gb|ABF99870.1| Glycosyl hydrolases family 17 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13793.1| Os03g0845600 [Oryza sativa Japonica Group]
 gb|EAZ29287.1| hypothetical protein OsJ_13350 [Oryza sativa Japonica Group]
 dbj|BAG98908.1| unnamed protein product [Oryza sativa Japonica Group]
Length=474

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 120/171 (70%), Gaps = 3/171 (2%)
 Frame = -1

Query  680  KKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPE  501
            +   S  GTP RPG+ +P  +FAL+NE+ K GP TERH+G+ +PNG+ +Y +DL+G+ P 
Sbjct  302  RHLASGAGTPRRPGMRMPAFVFALFNEDLKTGPATERHWGLFHPNGSAVYEVDLTGRRPP  361

Query  500  SEFPPLPKPTTNQ-PYKGKVWCVV-APAANLTAVADALSYACGQGNRTCNPIQPGGACYN  327
            + +PPLP P TN  PY GK+WCVV A AAN TAV + +  AC      C P++ GG CY 
Sbjct  362  ASYPPLPPPATNDAPYPGKLWCVVGAAAANETAVREQMEAACADEAALCAPVRAGGECYL  421

Query  326  PNSLIRHASYAFSSYWAQFRSL-GGTCYFNGLAVKTINDPSYGACKYPSIT  177
            PN++  HASY FS++W +F  + GG CYF GLA++T  DPS+G+CK+PS+T
Sbjct  422  PNTVAAHASYVFSAHWNKFSKVYGGWCYFAGLAMETTTDPSHGSCKFPSVT  472



>ref|XP_003572424.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=590

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 111/169 (66%), Gaps = 6/169 (4%)
 Frame = -1

Query  677  KFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK----  510
            +  +  GTP RPG  +P  +F+LYNE++KPG GTERH+G+ YPNGT +Y +DL G+    
Sbjct  313  RMATSPGTPLRPGEKMPVFVFSLYNEDKKPGAGTERHWGLFYPNGTAVYQVDLGGRRRSY  372

Query  509  --TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGA  336
               P     P P    + P +  +WCV+ P  +  AVA AL+YACGQG+ TC  IQPG  
Sbjct  373  PPLPSPPPSPSPSTPPSPPAEQGLWCVLLPGKDEKAVAAALNYACGQGSGTCAAIQPGAV  432

Query  335  CYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKY  189
            C+ PN+L  HASYAF+SYW QFR  G +C FNGLA  T  DPS+G+CK+
Sbjct  433  CFEPNTLDAHASYAFNSYWQQFRKSGASCSFNGLATTTTTDPSHGSCKF  481


 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -1

Query  446  VWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFR  267
            VWCV+AP  +  AV  AL+YACGQG  TC  IQPGGAC+ PN+L  HASYAF+SYW QFR
Sbjct  500  VWCVLAPGKDEKAVEAALNYACGQGQGTCAAIQPGGACFEPNTLDAHASYAFNSYWQQFR  559

Query  266  SLGGTCYFNGLAVKTINDPSYGACKYPS  183
              GG+C FNGLAV T  DPS+G+CK+PS
Sbjct  560  KTGGSCSFNGLAVTTTADPSHGSCKFPS  587



>ref|XP_001780045.1| predicted protein [Physcomitrella patens]
 gb|EDQ55148.1| predicted protein [Physcomitrella patens]
Length=453

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 114/180 (63%), Gaps = 14/180 (8%)
 Frame = -1

Query  683  VKKFTS--KVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            V+K  S   VGTP RPGV IPT IFAL+NE+QK G GTE+H+G+LYPNGTN+Y ID++G 
Sbjct  272  VRKMVSPTNVGTPMRPGVYIPTFIFALFNEDQKTGQGTEKHWGLLYPNGTNVYSIDMTGM  331

Query  509  TPESEFPPL---------PKPTTN---QPYKGKVWCVVAPAANLTAVADALSYACGQGNR  366
              + ++ PL         P PT +    P     WCV         +  AL +ACG G  
Sbjct  332  LSDGQYSPLSDNPVFTSAPPPTFSPGLVPSTSGTWCVAKSGIGQEMLQGALDFACGAGGA  391

Query  365  TCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYP  186
             C P+Q GG+C+NPN++  H+SYAF+SY+ + ++ GG+C F G A+ +  DPS+G CK+P
Sbjct  392  DCQPLQAGGSCFNPNTIHDHSSYAFNSYYQKTKAAGGSCNFGGAAMLSTTDPSHGTCKFP  451



>ref|XP_002444717.1| hypothetical protein SORBIDRAFT_07g026540 [Sorghum bicolor]
 gb|EES14212.1| hypothetical protein SORBIDRAFT_07g026540 [Sorghum bicolor]
Length=484

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 121/169 (72%), Gaps = 10/169 (6%)
 Frame = -1

Query  677  KFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPES  498
            + +   GTPARPG  +P  +F+LYNE+QKPG G+ERH+G+ YPNG+ +Y +DL+G+   S
Sbjct  319  RMSKNPGTPARPGAKVPVFLFSLYNEDQKPGAGSERHWGLYYPNGSRVYEVDLTGR--RS  376

Query  497  EFPPLP--KPTTNQPYKGKVWCVVAP--AANLTAVADALSYACGQGNRTCNPIQPGGACY  330
             +PPLP    T + P     WCV+    AAN TAVA A++YAC QG+ TC  IQPGGAC+
Sbjct  377  SYPPLPPADDTDSAP----AWCVLGSKAAANETAVAAAVAYACQQGSGTCAAIQPGGACH  432

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
             P+ +  HASYAF++YW QFR  GGTC+F+GLAV T  DPS+G+CK+ S
Sbjct  433  EPDMMDAHASYAFNAYWQQFRGAGGTCFFDGLAVTTTKDPSHGSCKFAS  481



>dbj|BAE80092.1| glycosyl hydrolase family 17 [Silene latifolia]
Length=439

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 103/150 (69%), Gaps = 5/150 (3%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK  ++  +GTPARPG +IP  +F+LY+EN K GP TERH+G++ PNGT +Y IDL+G 
Sbjct  292  IKKIVAEPPLGTPARPGTIIPAFLFSLYDENLKDGPETERHWGLVKPNGTPVYQIDLTGT  351

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCN-PIQPGGAC  333
              ++EF PLP  T N PYKG+VWCVV  +AN+T +   ++  C + N TC   I PG  C
Sbjct  352  --QTEFDPLPNATNNMPYKGEVWCVVQRSANMTELGSMVTNLCSRLNGTCEAAIGPGNDC  409

Query  332  YNPNSLIRHASYAFSSYWAQFRSLGGTCYF  243
            Y P S++ HASY FS+YWAQFR  G  C F
Sbjct  410  YQPVSILWHASYTFSAYWAQFRRHGTYCQF  439



>ref|XP_002972033.1| hypothetical protein SELMODRAFT_96745, partial [Selaginella moellendorffii]
 gb|EFJ26950.1| hypothetical protein SELMODRAFT_96745, partial [Selaginella moellendorffii]
Length=459

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 105/167 (63%), Gaps = 10/167 (6%)
 Frame = -1

Query  659  GTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP  480
            GTP RPG +I T IFAL+NE+QKPG  TER++G+LYPNG+ +Y IDL+GKTP    P   
Sbjct  281  GTPRRPGRLIDTYIFALFNEDQKPGAATERNWGLLYPNGSKVYDIDLTGKTPVPALPQAA  340

Query  479  KP----TTNQPYKGKVWCVV-APAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSL  315
             P    T N   +G+ WCV  A   +   V DA+ YACG G   C  IQPG ACY PN +
Sbjct  341  IPGNFSTGNSSRQGQ-WCVAKADYVSTADVQDAIDYACGGGKADCAAIQPGQACYLPNLV  399

Query  314  IRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
              HASYAF+SYW + +  GGTC FNG A  T  DPS    K+ S +L
Sbjct  400  RLHASYAFNSYWQKMKRSGGTCAFNGFAKLTSVDPS----KFRSFSL  442



>ref|XP_002972579.1| hypothetical protein SELMODRAFT_97838, partial [Selaginella moellendorffii]
 gb|EFJ26665.1| hypothetical protein SELMODRAFT_97838, partial [Selaginella moellendorffii]
Length=460

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 105/167 (63%), Gaps = 10/167 (6%)
 Frame = -1

Query  659  GTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP  480
            GTP RPG +I T IFAL+NE+QKPG  TER++G+LYPNG+ +Y IDL+GKTP    P   
Sbjct  281  GTPRRPGRLIDTYIFALFNEDQKPGAATERNWGLLYPNGSKVYDIDLTGKTPVPALPQAA  340

Query  479  KP----TTNQPYKGKVWCVV-APAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSL  315
             P    T N   +G+ WCV  A   +   V DA+ YACG G   C  IQPG ACY PN +
Sbjct  341  IPGNFSTGNSSRQGQ-WCVAKADYVSTADVQDAIDYACGGGKADCAAIQPGQACYLPNLV  399

Query  314  IRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
              HASYAF+SYW + +  GGTC FNG A  T  DPS    K+ S +L
Sbjct  400  RLHASYAFNSYWQKMKRSGGTCAFNGFAKLTSVDPS----KFRSFSL  442



>ref|XP_001784285.1| predicted protein [Physcomitrella patens]
 gb|EDQ50891.1| predicted protein [Physcomitrella patens]
Length=437

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 111/166 (67%), Gaps = 4/166 (2%)
 Frame = -1

Query  671  TSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEF  492
            T+ VGTPARPGV+IPT IF+L+NEN KPG G+ER++G+LYP+ T +Y +DL+G+  + ++
Sbjct  271  TTHVGTPARPGVIIPTYIFSLFNENLKPGVGSERNWGLLYPDLTPVYAVDLTGQLLDHQY  330

Query  491  PP----LPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNP  324
             P       P++        WCV + AA+   + + L+YAC      C  +QPG +C+ P
Sbjct  331  APNSVSTGPPSSPSSAGSGSWCVSSAAADPVTLENGLNYACNANEEFCAALQPGQSCHLP  390

Query  323  NSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYP  186
            N++  HAS+AF+SYW ++RS GG+C F+G A  T  DPS+G C +P
Sbjct  391  NTVASHASWAFNSYWQKYRSAGGSCSFDGAATLTSIDPSFGTCLFP  436



>ref|XP_002520622.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF41758.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=463

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 92/119 (77%), Gaps = 2/119 (2%)
 Frame = -1

Query  683  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  510
            +KK T+K  +GTPARPGVVIPT IF+LYNEN+K GPGTERH+G+L  NGT IY IDLSGK
Sbjct  296  IKKMTAKPPIGTPARPGVVIPTFIFSLYNENRKTGPGTERHWGLLNANGTAIYEIDLSGK  355

Query  509  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGAC  333
              +SE+  LP+P  N+PYKGK+WC+ A  A+LT +  A+++AC QGN TC+ + PGG  
Sbjct  356  QADSEYRALPQPNNNKPYKGKLWCIAAQGADLTELGTAVTFACSQGNGTCDALAPGGKV  414



>ref|XP_002463526.1| hypothetical protein SORBIDRAFT_01g001430 [Sorghum bicolor]
 gb|EER90524.1| hypothetical protein SORBIDRAFT_01g001430 [Sorghum bicolor]
Length=483

 Score =   159 bits (401),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 112/174 (64%), Gaps = 5/174 (3%)
 Frame = -1

Query  680  KKFTSKVGTPARP-GVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            +   S  GTP RP   V P ++FAL+NE+ K GPGTERH+G+ YPNG+ +Y +DL+G+  
Sbjct  309  RHLASGAGTPRRPRARVAPAMVFALFNEDLKWGPGTERHWGLFYPNGSAVYEVDLTGRRR  368

Query  503  ESEFPPLPKPTTN-QPYKGKVWCVVAPA---ANLTAVADALSYACGQGNRTCNPIQPGGA  336
                 P   P +N +PY G +WCVVA      N TAV   ++ AC      C+P++PGGA
Sbjct  369  SLPSYPPLPPASNDRPYPGPLWCVVATDKGPVNETAVRAQVAAACADVPGLCDPVRPGGA  428

Query  335  CYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  174
            C+ P+++  HASY FS++W +F    G CYF G AV+T  DPS+G+CK+PSI L
Sbjct  429  CFLPDTVSAHASYVFSAHWNRFSEDYGGCYFAGFAVETTVDPSHGSCKFPSILL  482



>ref|NP_001062294.2| Os08g0525800 [Oryza sativa Japonica Group]
 dbj|BAF24208.2| Os08g0525800 [Oryza sativa Japonica Group]
Length=471

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 101/156 (65%), Gaps = 5/156 (3%)
 Frame = -1

Query  659  GTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP  480
            GTPARPG  IP  +F+LYNEN+KPGPGTERH+G+ YPN T +Y +DL+G+ P + +PPL 
Sbjct  312  GTPARPGAEIPVFLFSLYNENRKPGPGTERHWGLYYPNATWVYEVDLAGRRPAASYPPLA  371

Query  479  KPTTNQPYKGK-VWCVVAPAANLTAVADAL----SYACGQGNRTCNPIQPGGACYNPNSL  315
                     G  VWCV+A      A   A+     YAC Q + TC  I+ GG C  P++L
Sbjct  372  PTPPAPDQDGTPVWCVLAGGGGEAANETAVAAAVEYACRQRSGTCAAIEAGGECNQPDTL  431

Query  314  IRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  207
              HASYAF++YW  FR  GGTCYFNGLA KT  DPS
Sbjct  432  AAHASYAFNAYWQLFRKAGGTCYFNGLAEKTTIDPS  467



>dbj|BAC75423.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
Length=482

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 101/156 (65%), Gaps = 5/156 (3%)
 Frame = -1

Query  659  GTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP  480
            GTPARPG  IP  +F+LYNEN+KPGPGTERH+G+ YPN T +Y +DL+G+ P + +PPL 
Sbjct  312  GTPARPGAEIPVFLFSLYNENRKPGPGTERHWGLYYPNATWVYEVDLAGRRPAASYPPLA  371

Query  479  KPTTNQPYKGK-VWCVVAPAANLTAVADAL----SYACGQGNRTCNPIQPGGACYNPNSL  315
                     G  VWCV+A      A   A+     YAC Q + TC  I+ GG C  P++L
Sbjct  372  PTPPAPDQDGTPVWCVLAGGGGEAANETAVAAAVEYACRQRSGTCAAIEAGGECNQPDTL  431

Query  314  IRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  207
              HASYAF++YW  FR  GGTCYFNGLA KT  DP+
Sbjct  432  AAHASYAFNAYWQLFRKAGGTCYFNGLAEKTTIDPT  467



>gb|EAZ07710.1| hypothetical protein OsI_29967 [Oryza sativa Indica Group]
Length=1020

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 108/158 (68%), Gaps = 5/158 (3%)
 Frame = -1

Query  659  GTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP  480
            GTPARPG  IP  +F+LYNEN+KPGPGTERH+G+ YPN T +Y +DL+G+ P + +PPL 
Sbjct  312  GTPARPGAEIPVFLFSLYNENRKPGPGTERHWGLYYPNATWVYEVDLAGRRPAASYPPLA  371

Query  479  KPTTNQPYKGK-VWCVVA----PAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSL  315
                     G  VWCV+A     AAN TAVA A+ YAC Q + TC  I+ GG C  P++L
Sbjct  372  PTPPAPDQDGTPVWCVLAGGGGEAANETAVAAAVEYACRQRSGTCAAIEAGGECNQPDTL  431

Query  314  IRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYG  201
              HASYAF++YW  FR  GGTCYFNGLA KT  DP++ 
Sbjct  432  AAHASYAFNAYWQLFRKAGGTCYFNGLAEKTTIDPTFA  469



>gb|KHG21190.1| hypothetical protein F383_01641 [Gossypium arboreum]
Length=470

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 105/179 (59%), Gaps = 13/179 (7%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            V++  +  GTP RP   +   IFAL+NENQKPGP +ER++G+ YPN   +Y I LS K  
Sbjct  291  VRRVLTGNGTPLRPNDPLNVYIFALFNENQKPGPTSERNYGLFYPNEQRVYNIPLSQKGL  350

Query  503  ESEFPPLPKPTTNQ------------PYKGKVWCVVAPAANLTAVADALSYACGQGNRTC  360
                 P P    NQ               G+ WC+ +P A    + + L YACG+G   C
Sbjct  351  NGNQSP-PASNVNQTAPVNNGGGVSKATSGQTWCMASPNAEAEELQEGLDYACGEGGADC  409

Query  359  NPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
             PIQP GACYNPNSL+ HASYA++SY+ +   + G+C+F+G A  +   PS+G C++P+
Sbjct  410  GPIQPNGACYNPNSLVAHASYAYNSYYQKKARVSGSCFFSGTAYVSTQRPSFGNCQFPT  468



>ref|XP_003544773.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=461

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 104/172 (60%), Gaps = 7/172 (4%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            VK+  S  GTP +P   +   +FAL+NENQK GP +ER++G+ YP+   +Y I L+ + P
Sbjct  290  VKRVLSGSGTPLKPNESLDVFLFALFNENQKTGPTSERNYGLFYPSQKKVYDIQLTAEAP  349

Query  503  -----ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGG  339
                 +S+ P     TT+   KG+ WCV    ++   + +AL+YACG+G   C PIQPG 
Sbjct  350  PSGVGKSQVPVSGDVTTSS--KGQTWCVANGGSSEKKLQNALNYACGEGGADCTPIQPGA  407

Query  338  ACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
             CY+PN+L  HASYAF+SY+ +     GTCYF G A      P YG C++P+
Sbjct  408  TCYDPNTLEAHASYAFNSYYQKMARASGTCYFGGTAYVVTQPPKYGNCEFPT  459



>gb|ABR16205.1| unknown [Picea sitchensis]
Length=494

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 103/170 (61%), Gaps = 11/170 (6%)
 Frame = -1

Query  659  GTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP  480
            GTP RPG  IPT IF+L+NE+QKPGP TER++G+ YP+GT +YPI LS   P      +P
Sbjct  326  GTPRRPGAFIPTFIFSLFNEDQKPGPNTERNWGLFYPDGTPVYPIVLSNDAPALSHISVP  385

Query  479  KPTTNQPYKGKV------WCVVAPAA----NLTAVADALSYACGQGNRTCNPIQPGGACY  330
                              WCVV+P A    + T++  AL YACG G   C+ I+PG  CY
Sbjct  386  SQNNGPLPASPPSPVSPQWCVVSPVAVAQVDETSLQAALDYACGAG-ADCSLIEPGEPCY  444

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSI  180
             PN+L+ HASYAF+SYW + ++   TC F+G AV T +DPS G C +  +
Sbjct  445  LPNTLVSHASYAFNSYWQKTKAADATCDFHGAAVLTSSDPSVGDCVFDHM  494



>gb|KJB13749.1| hypothetical protein B456_002G092600 [Gossypium raimondii]
 gb|KJB13750.1| hypothetical protein B456_002G092600 [Gossypium raimondii]
Length=470

 Score =   150 bits (379),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 105/179 (59%), Gaps = 13/179 (7%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            V++  +  GTP RP   +   IFAL+NENQKPGP +ER++G+ YPN   +Y I LS K  
Sbjct  291  VRRVLTGNGTPLRPNDPLNVYIFALFNENQKPGPTSERNYGLFYPNEQRVYNIPLSQKGL  350

Query  503  ESEFPPLPKPTTNQ------------PYKGKVWCVVAPAANLTAVADALSYACGQGNRTC  360
                 P P    NQ               G+ WC+ +P A    + + L YACG+G   C
Sbjct  351  NGNQSP-PASNVNQTAPVNNWGGVSKATSGQTWCMASPNAEAEELQEGLDYACGEGGADC  409

Query  359  NPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
             PIQP GACYNPNSL+ HASYA++SY+ +   + G+C+F+G A  +   PS+G C++P+
Sbjct  410  GPIQPNGACYNPNSLVAHASYAYNSYYQKKARVSGSCFFSGTAYVSTQPPSFGNCQFPT  468



>ref|XP_002961854.1| hypothetical protein SELMODRAFT_437767 [Selaginella moellendorffii]
 gb|EFJ37114.1| hypothetical protein SELMODRAFT_437767 [Selaginella moellendorffii]
Length=464

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 101/171 (59%), Gaps = 8/171 (5%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            V+K     GTP RP   I T IFALYNEN KPGPGTERH+G+LYP+G  +Y IDL+G+  
Sbjct  296  VRKVIEGRGTPKRPNSAIATFIFALYNENLKPGPGTERHWGLLYPDGRPVYSIDLTGRLS  355

Query  503  ESEFPPLPKPTT----NQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGA  336
            +S++  +P+P +    N       WCV  P A+ +++   L   C Q    C  IQ G +
Sbjct  356  DSQYEAVPEPMSVAVVNSSSSSSSWCVARPDADTSSLQRELDRICSQNPSDCAAIQDGQS  415

Query  335  CYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            C+ PN++I HASYAF+  W +       C F+  A  T  +PSYG+C +PS
Sbjct  416  CFYPNTIIAHASYAFNRRWIR----ENQCSFSSTAALTKINPSYGSCIFPS  462



>ref|XP_002980798.1| hypothetical protein SELMODRAFT_444643 [Selaginella moellendorffii]
 gb|EFJ17983.1| hypothetical protein SELMODRAFT_444643 [Selaginella moellendorffii]
Length=464

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 100/171 (58%), Gaps = 8/171 (5%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            V+K     GTP RP   I T IFALYNEN KPGPG ERH+G+LYP+G  +Y IDL+G+  
Sbjct  296  VRKVVEGRGTPKRPNSAIETFIFALYNENLKPGPGIERHWGLLYPDGRPVYSIDLTGRLS  355

Query  503  ESEFPPLPKPTT----NQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGA  336
            +S++  +P+P +    N       WCV  P A+ +++   L   C Q    C  IQ G +
Sbjct  356  DSQYEAVPEPMSVAVVNSSSSSSSWCVARPDADTSSLQRELDRICSQNPSDCAAIQDGQS  415

Query  335  CYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            C+ PN++I HASYAF+  W +       C F+  A  T  +PSYG+C +PS
Sbjct  416  CFYPNTIIAHASYAFNRRWIR----ENQCSFSSTAALTKINPSYGSCIFPS  462



>gb|KJB62900.1| hypothetical protein B456_009G442700 [Gossypium raimondii]
Length=469

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 105/176 (60%), Gaps = 9/176 (5%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            V+K  +  GTP RP   +   +FAL+NENQKPGP +ER++G+ YPN   +Y I L+ +  
Sbjct  292  VRKVLTGNGTPLRPQDPLNVYLFALFNENQKPGPTSERNYGLFYPNEQKVYTIPLTKEEV  351

Query  503  ES-EFPPL-----PKPTTNQPYKGKV---WCVVAPAANLTAVADALSYACGQGNRTCNPI  351
            ++ E  P+     P P   +  K KV   WCV    A+   +  AL YACG+G   C+PI
Sbjct  352  KTGESTPVNTNTSPAPVAGEVSKAKVGQTWCVANEKADEKKLQAALDYACGEGEADCSPI  411

Query  350  QPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            QPG  CYNPN+L  HASYAF+SY+ +     GTC F+G A      P+YG C++P+
Sbjct  412  QPGATCYNPNTLEAHASYAFNSYYQKNTRATGTCEFDGAAYVVTQRPTYGNCEFPT  467



>ref|XP_001781801.1| predicted protein [Physcomitrella patens]
 gb|EDQ53355.1| predicted protein, partial [Physcomitrella patens]
Length=450

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 104/155 (67%), Gaps = 1/155 (1%)
 Frame = -1

Query  671  TSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEF  492
            T+++GTPARPGV IPT IFAL+NEN KPG  +ER++G+L+PN + +Y IDL+G+  +S++
Sbjct  272  TTQIGTPARPGVFIPTYIFALFNENLKPGVSSERNWGLLHPNLSPVYAIDLTGQIYDSQY  331

Query  491  PPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLI  312
             P    +  Q   G  WC+    ++   + + L++ACG     C  IQP  +CY P++++
Sbjct  332  SPNSNSSPLQTGSGT-WCISNENSDPVTLENGLNFACGADVEFCKAIQPSASCYLPSTIV  390

Query  311  RHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  207
             HA++AF++YW +++  GG+C F+G  V T  DPS
Sbjct  391  SHAAWAFNNYWQKYKGAGGSCSFSGAGVLTSTDPS  425



>gb|KHG04965.1| hypothetical protein F383_30444 [Gossypium arboreum]
 gb|KHG22638.1| hypothetical protein F383_01203 [Gossypium arboreum]
Length=469

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 104/176 (59%), Gaps = 9/176 (5%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            V+K  +  GTP RP   +   +FAL+NENQKPGP +ER++G+ YPN   +Y I L+ +  
Sbjct  292  VRKVLTGNGTPLRPQDPLNVYLFALFNENQKPGPTSERNYGLFYPNEQKVYNIPLTKEEA  351

Query  503  ES-EFPPLPKPTTNQPYKGKV--------WCVVAPAANLTAVADALSYACGQGNRTCNPI  351
            ++ E  P+   T+  P  G+V        WCV    A+   +  AL YACG+G   C+PI
Sbjct  352  KTGESTPVNSNTSQVPVAGEVSKAKVGQTWCVANGKADEKKLQAALDYACGEGKADCSPI  411

Query  350  QPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            QPG  CYNPN+L  HASYAF+SY+ +     GTC F G A      P+YG C++P+
Sbjct  412  QPGATCYNPNTLEAHASYAFNSYYQKNTRATGTCEFGGAAYVVSQRPTYGNCEFPT  467



>ref|XP_004491104.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like isoform X2 
[Cicer arietinum]
Length=475

 Score =   145 bits (365),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 106/186 (57%), Gaps = 20/186 (11%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            V+K  +  GTP RP   +   +FAL+NENQKPGP +ER+FG+ YP+   +Y I L+ +  
Sbjct  289  VRKILTGSGTPLRPKADLTVYLFALFNENQKPGPTSERNFGLFYPSEEKVYDIPLTVEAL  348

Query  503  ESEFPPLPKPT------TNQPY-------------KGKVWCVVAPAANLTAVADALSYAC  381
            ++ +   P P       TNQP               G  WCV  P A+   +  AL +AC
Sbjct  349  KN-YHDNPSPVAPVSGNTNQPTPAVSPVGGVSKSTTGDTWCVANPDADKNKLQLALDFAC  407

Query  380  GQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYG  201
            G+G   C  IQPG  CYNPN+L+ HAS+AF+SY+ +    GG+C+F G +     +P YG
Sbjct  408  GEGGADCRTIQPGATCYNPNTLVAHASFAFNSYYQKQARAGGSCFFGGTSYVVTQEPKYG  467

Query  200  ACKYPS  183
            +C++P+
Sbjct  468  SCEFPT  473



>ref|XP_006595830.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=471

 Score =   144 bits (364),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 104/184 (57%), Gaps = 17/184 (9%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLS----  516
            V+K  +  GTP RP   +   +FAL+NENQKPGP +ER+FG+ YP+   +Y + L+    
Sbjct  286  VRKILTAAGTPLRPKADLTVYLFALFNENQKPGPTSERNFGLFYPDERRVYNVPLTVEEL  345

Query  515  ------------GKTPESEFP-PLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQ  375
                        G   + E P P+     ++   G  WCV  P A+   +  AL +ACG+
Sbjct  346  KDYHDRPSAPVNGGGQKKETPAPVVSGGVSKSTTGNTWCVANPDADKVKLQAALDFACGE  405

Query  374  GNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGAC  195
            G   C PIQ G  CY+PN+L+ HAS+AF+SY+ +    GG+CYF G +     +P YG+C
Sbjct  406  GGSDCGPIQRGATCYDPNTLVAHASFAFNSYYQKQSRKGGSCYFGGTSYVVTQEPRYGSC  465

Query  194  KYPS  183
            ++P+
Sbjct  466  EFPT  469



>gb|ADU15553.1| GLU [Gossypium hirsutum]
Length=469

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 106/176 (60%), Gaps = 9/176 (5%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            V+K  +  GTP RP   +   +FAL+NEN+KPGP +ER++G+ YPN   +Y I L+ +  
Sbjct  292  VRKVLTGNGTPLRPQDPLNVYLFALFNENKKPGPTSERNYGLFYPNEQKVYNIPLTKEEA  351

Query  503  ES-EFPPLPKPTTNQPYKGKV--------WCVVAPAANLTAVADALSYACGQGNRTCNPI  351
            ++ +  P+   T+  P  G+V        WCV    A+   +  AL YACG+G   C+PI
Sbjct  352  KTGQSTPVNSNTSQVPVAGEVSKAKVGQTWCVANGKADEKKLQAALDYACGEGKADCSPI  411

Query  350  QPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            QPG  CYNPN+L  HASYAF+SY+ +   + GTC F G A      P+YG+C++P+
Sbjct  412  QPGATCYNPNTLEAHASYAFNSYYQKNTRVTGTCEFGGAAYVVSQRPTYGSCEFPT  467



>ref|XP_006575581.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=472

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 104/185 (56%), Gaps = 18/185 (10%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            V+K  +  GTP RP   +   +FAL+NENQKPGP +ER+FG+ YP+   +Y + L+ +  
Sbjct  286  VRKILTAGGTPLRPKADLIVFLFALFNENQKPGPTSERNFGLFYPDERRVYNVPLTTEEL  345

Query  503  --------------ESEFPPLPKPTTN----QPYKGKVWCVVAPAANLTAVADALSYACG  378
                          + +  P P P  +    +   G  WCV  P A+   +  AL +ACG
Sbjct  346  KDYHDRPAPVSGGGQQKGTPAPAPVVSGGVSKSTTGNTWCVANPDADKVKLQAALDFACG  405

Query  377  QGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGA  198
            +G   C PIQ G  CY+PN+L+ HAS+AF+SY+ +    GG+CYF G +     +P YG+
Sbjct  406  EGGADCRPIQRGSTCYDPNTLVAHASFAFNSYYQKQSRKGGSCYFGGTSYVVTQEPKYGS  465

Query  197  CKYPS  183
            C++P+
Sbjct  466  CEFPT  470



>ref|XP_008449141.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Cucumis melo]
Length=454

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 95/167 (57%), Gaps = 2/167 (1%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            VK+  +  GTP RP   +   +FAL+NENQKPGP +ER++G+ YPN   +Y I L+G   
Sbjct  289  VKRVLTGSGTPLRPKDPLNVYLFALFNENQKPGPTSERNYGLFYPNEEKVYEISLTGDVV  348

Query  503  ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNP  324
             +  PP    +  +   G+ WCV         +   L YACG+G   C  IQ GGACY+P
Sbjct  349  GAT-PPDSNGSKVE-VTGQTWCVANENVGAEKLQAGLDYACGEGQADCRSIQQGGACYDP  406

Query  323  NSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            NSL  HASYAF+SY+ + +   GTC F G A      P YG C +PS
Sbjct  407  NSLQAHASYAFNSYYQKMKRAAGTCDFGGAAYIVTQPPQYGKCDFPS  453



>ref|XP_003616906.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES99864.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=470

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 104/180 (58%), Gaps = 14/180 (8%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            V+K  +  GTP RP   +   +FAL+NENQKPGP +ER+FG+ YP+   +Y + L+ +  
Sbjct  290  VRKILTSKGTPLRPKADLTVFLFALFNENQKPGPTSERNFGLFYPDEKKVYNVPLTVEAL  349

Query  503  ESEFPPLPKPTT-------------NQPYKGKVWCVVAPAANLTAVADALSYACGQGNRT  363
            ++ +   P P +             ++   G  WCV  P A+   + DAL +ACG+G   
Sbjct  350  KN-YHDDPSPASPVSGGGGSGGGGVSKSTTGNTWCVANPYADKNKLQDALDFACGEGGAD  408

Query  362  CNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            C PIQ    C++PN+L+ HAS+AF+SY+ +    GG+CYF G +     +P YG C++P+
Sbjct  409  CRPIQNNATCFDPNTLVAHASFAFNSYYQKQARAGGSCYFGGTSYVVTQEPKYGKCEFPT  468



>gb|KHN23902.1| Glucan endo-1,3-beta-glucosidase 12 [Glycine soja]
Length=458

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 101/171 (59%), Gaps = 8/171 (5%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            VK+  S  GTP +P   +   +FAL+NENQK GP +ER++G+ YP    +Y  D +   P
Sbjct  290  VKRVLSGSGTPLKPNESLDVFLFALFNENQKTGPTSERNYGLFYPTEKKVY--DTAEAPP  347

Query  503  ----ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGA  336
                +S+ P     TT+   KG+ WCV    ++   + +AL+YACG+G   C PIQPG  
Sbjct  348  SGVGKSQVPVSGDVTTSS--KGQTWCVANGGSSEKKLQNALNYACGEGGADCTPIQPGAT  405

Query  335  CYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            CY+PN+L  HASYAF+SY+ +     GTCYF G A      P YG C++P+
Sbjct  406  CYDPNTLEAHASYAFNSYYQKMARASGTCYFGGTAYVVTQPPKYGNCEFPT  456



>ref|XP_009137621.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Brassica rapa]
Length=465

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 97/169 (57%), Gaps = 6/169 (4%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            VK+  +  GTP RP   +   +FAL+NENQKPGP +ER++G+ YPN   +Y +  +  T 
Sbjct  299  VKRVLNGNGTPLRPKEPLNVFLFALFNENQKPGPTSERNYGLFYPNERKVYAVPFAATTS  358

Query  503  ESEFPPLPKPTTNQP--YKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
                 P+ +     P  ++G+ WCV    A    +  AL YACG+G   C PIQPG  CY
Sbjct  359  ----TPVNRNKEQAPVAHEGETWCVSNGDAAKEKLQAALDYACGEGGADCRPIQPGATCY  414

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            +P SL  HAS+AF+SY+ +     GTCYF G A      P YG CK+P+
Sbjct  415  HPKSLEAHASFAFNSYYQKNARRDGTCYFGGTAHVVTQHPRYGKCKFPT  463



>gb|KHN38251.1| Glucan endo-1,3-beta-glucosidase 12 [Glycine soja]
Length=381

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 95/167 (57%), Gaps = 0/167 (0%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            VK+  S  GTP +    +   +FAL+NENQK GP +ER++G+ YP    +Y I L     
Sbjct  213  VKRVLSGSGTPLKQNESLDVFLFALFNENQKTGPTSERNYGLFYPTEKKVYDIPLPPSGV  272

Query  503  ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNP  324
                 P+    +    KG+ WCV +  ++   + +AL+YACG+G   C PIQPG  CYNP
Sbjct  273  GKSQVPVSGEVSTTTSKGQTWCVASGGSSEKKLQNALNYACGEGGADCTPIQPGATCYNP  332

Query  323  NSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            N+L  HASYAF+SY+ +     GTC F G A      P YG C++P+
Sbjct  333  NTLEAHASYAFNSYYQKKARASGTCDFGGTAYVVTQPPKYGNCEFPT  379



>ref|XP_003519593.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=471

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 99/175 (57%), Gaps = 8/175 (5%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            VK+  S  GTP +    +   +FAL+NENQK GP +ER++G+ YP    +Y I L+ +  
Sbjct  296  VKRVMSGSGTPLKQNESLDVFLFALFNENQKTGPTSERNYGLFYPTEKKVYDIPLTAEEI  355

Query  503  ESEFP--------PLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQ  348
            +   P        P+    +    KG+ WCV +  ++   + +AL+YACG+G   C PIQ
Sbjct  356  KEAPPSGVGKSQVPVSGEVSTTTSKGQTWCVASGGSSEKKLQNALNYACGEGGADCTPIQ  415

Query  347  PGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            PG  CYNPN+L  HASYAF+SY+ +     GTC F G A      P YG C++P+
Sbjct  416  PGATCYNPNTLEAHASYAFNSYYQKKARASGTCDFGGTAYVVTQPPKYGNCEFPT  470



>ref|XP_002884972.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61231.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 100/165 (61%), Gaps = 11/165 (7%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            +K+  +  G P++P + I T I+ LYNE+++ GP +ER++G+L+PNGT++YP+ LSG + 
Sbjct  293  IKRVLNNSGPPSQPDIPINTYIYELYNEDKRSGPVSERNWGILFPNGTSVYPLSLSGGSN  352

Query  503  ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNP  324
             +                 ++CV    A+   + D L++ACGQG   C  IQPG  CY P
Sbjct  353  SAALN-----------DSSMFCVAKADADDDKLIDGLNWACGQGRANCAAIQPGQPCYLP  401

Query  323  NSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKY  189
            N +  HAS+AF+ Y+ + +S GGTC F+G A+ T  DPSY  C Y
Sbjct  402  NDVKSHASFAFNDYYQKMKSAGGTCDFDGTAITTTRDPSYRTCAY  446



>ref|XP_011085458.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Sesamum indicum]
Length=464

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 98/171 (57%), Gaps = 6/171 (4%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            V++  +  GTP RP   +   +FAL+NEN+KPGP +ER+FG+ YPN   +Y I L+ +  
Sbjct  292  VRRVLAGGGTPLRPHANLTVYLFALFNENKKPGPTSERNFGLFYPNQKKVYDIPLTAEGL  351

Query  503  ESEFPPLPKPTTNQPYK-----GKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGG  339
            +S +  +  P T    +     G+ WCV    A     +  L YACG+G   C+PIQPG 
Sbjct  352  KS-YRDIQSPVTGGEQRVSTANGQTWCVAKEEAGKEKQSSGLDYACGEGGADCHPIQPGS  410

Query  338  ACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYP  186
             C++PN+L  HAS+AF+SY+ +     GTCYF G A      P YG C +P
Sbjct  411  TCFDPNTLEAHASFAFNSYYQKKGRAIGTCYFGGAAYIVTQQPKYGKCDFP  461



>emb|CDY14214.1| BnaA08g13450D [Brassica napus]
Length=513

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 99/157 (63%), Gaps = 4/157 (3%)
 Frame = -1

Query  659  GTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP  480
            GTPA+PG  I   +F+L+NEN+KPG  +ER++G+ Y NGT++Y +D +G++      P P
Sbjct  299  GTPAKPGEEIDVYLFSLFNENRKPGMESERNWGMFYANGTSVYALDFTGEST----VPGP  354

Query  479  KPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHAS  300
               +N     K WCV +  A++T +  AL +ACG GN  C+ +QP   C+ P++++ HAS
Sbjct  355  VSPSNSTTGAKKWCVASSQASVTELQSALDWACGPGNVDCSAVQPNQLCFEPDTVLSHAS  414

Query  299  YAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKY  189
            YAF++Y+ Q       C F G++V+   DPSYG C Y
Sbjct  415  YAFNTYYQQSGGSSLDCSFGGVSVEVDKDPSYGNCLY  451



>ref|XP_008450796.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Cucumis melo]
Length=501

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 98/167 (59%), Gaps = 4/167 (2%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            ++   +  GTPARPG  +   IF+L+NEN+KPG  +ER++G+ YP+ T++Y +D +GK+ 
Sbjct  293  IRHVINNTGTPARPGEELDVYIFSLFNENRKPGLDSERNWGLFYPDQTSVYNLDFTGKS-  351

Query  503  ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNP  324
                  +     N    G  WC+ +  A+   + +AL +ACG GN  C PIQP   C+ P
Sbjct  352  ---VVDMTAQANNTASNGTAWCIASSKASDMDLQNALDWACGSGNVDCTPIQPSQPCFEP  408

Query  323  NSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            ++L+ HASYAF+SY+ Q  +    C F G  V+   DPSY  C Y +
Sbjct  409  DTLLSHASYAFNSYFQQNGATDVACGFGGNGVRVNQDPSYDNCLYAT  455



>gb|KFK29190.1| hypothetical protein AALP_AA7G101400 [Arabis alpina]
Length=461

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 101/174 (58%), Gaps = 9/174 (5%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPID-LSGKT  507
            VK+  +  GTP RP   +   +FAL+NENQKPGP +ER++G+ YPN   +Y +  ++GK 
Sbjct  288  VKRVLTGKGTPLRPRDPLNVYLFALFNENQKPGPTSERNYGLFYPNEAKVYDVPFVAGKK  347

Query  506  PESEFP------PLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQP  345
             +S         P+P P      +G+ WCV    A +  +  AL YACG+G   C+PIQP
Sbjct  348  RKSPLKGNRGHAPVPVPAVAD--EGEKWCVSNGEAGMEKLQAALDYACGEGGADCSPIQP  405

Query  344  GGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            G  C+NP SL  HASYAF+SY+ +     GTC+F G A      P YG C +P+
Sbjct  406  GATCFNPESLEAHASYAFNSYYQKNARRVGTCFFGGAAHVVTQPPRYGKCDFPT  459



>gb|KHG21189.1| hypothetical protein F383_01641 [Gossypium arboreum]
Length=489

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 98/172 (57%), Gaps = 13/172 (8%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            V++  +  GTP RP   +   IFAL+NENQKPGP +ER++G+ YPN   +Y I LS K  
Sbjct  291  VRRVLTGNGTPLRPNDPLNVYIFALFNENQKPGPTSERNYGLFYPNEQRVYNIPLSQKGL  350

Query  503  ESEFPPLPKPTTNQ------------PYKGKVWCVVAPAANLTAVADALSYACGQGNRTC  360
                 P P    NQ               G+ WC+ +P A    + + L YACG+G   C
Sbjct  351  NGNQSP-PASNVNQTAPVNNGGGVSKATSGQTWCMASPNAEAEELQEGLDYACGEGGADC  409

Query  359  NPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSY  204
             PIQP GACYNPNSL+ HASYA++SY+ +   + G+C+F+G A  +   P +
Sbjct  410  GPIQPNGACYNPNSLVAHASYAYNSYYQKKARVSGSCFFSGTAYVSTQRPFF  461



>ref|XP_004135678.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Cucumis 
sativus]
 ref|XP_004158423.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Cucumis 
sativus]
 gb|KGN66191.1| hypothetical protein Csa_1G575070 [Cucumis sativus]
Length=501

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 98/167 (59%), Gaps = 4/167 (2%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            ++   +  GTPARPG  +   IF+L+NEN+KPG  +ER++G+ YP+ T++Y +D +GK+ 
Sbjct  293  IRHVINNTGTPARPGEELDVYIFSLFNENRKPGLDSERNWGLFYPDQTSVYNLDFTGKS-  351

Query  503  ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNP  324
                  +     +    G  WC+ +  A+   + +AL +ACG GN  C PIQP   C+ P
Sbjct  352  ---VVDMTAQANSTASNGTAWCIASTKASDMDLQNALDWACGSGNVDCTPIQPSQPCFEP  408

Query  323  NSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            ++L+ HASYAF+SY+ Q  +    C F G  VK   DPSY  C Y +
Sbjct  409  DTLVSHASYAFNSYFQQNGATDVACGFGGNGVKVNQDPSYDTCLYAT  455



>emb|CDX92794.1| BnaC07g40520D [Brassica napus]
Length=451

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 94/169 (56%), Gaps = 14/169 (8%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            VK+  +  GTP R    +   +F+L+NENQKPGP +ER++G+ YPN   +Y +       
Sbjct  293  VKRVLNGNGTPLRRNEPLNVFLFSLFNENQKPGPTSERNYGLFYPNERRVYAV-------  345

Query  503  ESEFPPLPKPTTNQP--YKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
                 P P  T   P  ++G+ WCV    A    +  AL YACG+G   C PIQPG  CY
Sbjct  346  -----PFPATTEQAPVAHEGESWCVSNGDAAKEKLQAALDYACGEGGADCRPIQPGATCY  400

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            NP SL  HAS+AF+SY+ +     GTCYF G A      P YG CK+P+
Sbjct  401  NPKSLEAHASFAFNSYYQKNARRVGTCYFGGTAHVVTQHPRYGKCKFPT  449



>ref|XP_009595038.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Nicotiana 
tomentosiformis]
Length=467

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 98/177 (55%), Gaps = 10/177 (6%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLS----  516
            V++  +  GTP +P   +   +FAL+NENQKPGP +ER++G+ YPN   +Y I L+    
Sbjct  289  VRRVLTGSGTPLKPNEPLDVFLFALFNENQKPGPTSERNYGLFYPNEQKVYDITLTKDGL  348

Query  515  GKTP------ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNP  354
            G  P      +S     P+P       G  WCV    A    +  AL YACG+G   C P
Sbjct  349  GNGPTMNNGSKSTVVTAPEPALEASKVGNTWCVANEKAAREKLQAALDYACGEGGADCRP  408

Query  353  IQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            IQ G  CY+P++L  HASYAF+SY+ +     GTC F+G A      P YG+CK+P+
Sbjct  409  IQQGATCYDPDTLEAHASYAFNSYYQKNTRGIGTCDFSGAAYVVTQHPKYGSCKFPT  465



>ref|XP_010482941.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=460

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 101/173 (58%), Gaps = 9/173 (5%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLS-GKT  507
            VK+  +  GTP +P   +   +FAL+NENQK GP +ER++G+ YPN   +Y + LS GK+
Sbjct  289  VKRVLTGNGTPLKPKEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVSLSSGKS  348

Query  506  P-----ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPG  342
                  + + PP+ KP++   + G+ WCV         + + L YACG+G   C PIQPG
Sbjct  349  TPVEDNKEKVPPVVKPSS---HVGQTWCVANGKTTKEKLQEGLDYACGEGGADCRPIQPG  405

Query  341  GACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
              CY+P SL  HASYAF+SY+ +     GTC F G A      P YG C++P+
Sbjct  406  ATCYDPESLEAHASYAFNSYYQKNARGVGTCDFKGAAYVVSQPPKYGKCEFPT  458



>ref|XP_010675772.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Beta vulgaris 
subsp. vulgaris]
Length=463

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 98/170 (58%), Gaps = 4/170 (2%)
 Frame = -1

Query  680  KKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSG-KTP  504
            K+  +  GTP RP   +   +FAL+NENQKPGP +ER++G+ YPN   +Y + L+  +  
Sbjct  292  KRVLTGGGTPLRPNDPLDVYLFALFNENQKPGPTSERNYGLFYPNEQKVYNVPLTAAQIG  351

Query  503  ESEFPPLPKPTTNQ---PYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGAC  333
            ++   P      ++   P  G+ WCV    A    + D L++ACG+G   C PIQPG  C
Sbjct  352  DAAVAPASANNGSKVVVPPTGQTWCVANEQAGEEKLQDGLNWACGEGKADCRPIQPGATC  411

Query  332  YNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            YNP +L+ HASYAF+SY+       GTC F G A      P +G+CK+P+
Sbjct  412  YNPGTLVAHASYAFNSYYQMKARSTGTCDFGGAAHVVTQSPQFGSCKFPT  461



>ref|XP_006280442.1| hypothetical protein CARUB_v10026374mg [Capsella rubella]
 gb|EOA13340.1| hypothetical protein CARUB_v10026374mg [Capsella rubella]
Length=457

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 97/171 (57%), Gaps = 8/171 (5%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKT-  507
            VK+  +  GTP +P   +   +FAL+NENQK GP +ER++G+ YPN   +Y + LSGK+ 
Sbjct  289  VKRVLTGNGTPLKPKEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVSLSGKST  348

Query  506  ---PESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGA  336
                E E     KP+    + G+ WCV         + + L YACG+G   C PIQPG  
Sbjct  349  PVNDEKEKVTPVKPS----HVGQTWCVANGKTTKEKLQEGLDYACGEGGADCRPIQPGAT  404

Query  335  CYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            CY+P SL  HASYAF+SY+ +     GTC F G A      P YG C++P+
Sbjct  405  CYDPESLEAHASYAFNSYYQKNARGTGTCDFKGAAYVVSQPPKYGKCEFPT  455



>ref|XP_010539314.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Tarenaya hassleriana]
Length=462

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 99/171 (58%), Gaps = 5/171 (3%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDL----S  516
            +K+  +  GTP RP   +   +FAL+NENQKPGP +ER++G+ YP+   +Y + L    +
Sbjct  291  IKRVLTGNGTPLRPKDPLNVYLFALFNENQKPGPTSERNYGLFYPSEEKVYDVPLGMAGA  350

Query  515  GKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGA  336
            G TP +E      PTT +  + + WCV         +  AL YACG+G   C PIQPG  
Sbjct  351  GSTPVNE-SKAQVPTTERGVQSRTWCVANGKLGEEKLQKALDYACGEGGADCRPIQPGAT  409

Query  335  CYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            CY+PN+L  HASYAF+SY+ +     GTC F G A      P +G C++P+
Sbjct  410  CYDPNTLEAHASYAFNSYYQKNARGVGTCDFGGSAYVVTQPPRFGKCEFPT  460



>ref|XP_006297495.1| hypothetical protein CARUB_v10013514mg [Capsella rubella]
 gb|EOA30393.1| hypothetical protein CARUB_v10013514mg [Capsella rubella]
Length=499

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 101/165 (61%), Gaps = 11/165 (7%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            VK+  +  G P++PG+ I T I+ LY+E+++ GP +E+++G+L+PNGT++YP+ LSG   
Sbjct  293  VKRVLNNSGPPSQPGIPINTYIYELYSEDKRAGPVSEKNWGILFPNGTSVYPLSLSGGAN  352

Query  503  ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNP  324
             +            P    ++CV    A    + D L++ACGQG   C  IQPG  CY P
Sbjct  353  SAS-----------PNGSSLFCVAKADAEDDKLVDGLNWACGQGQANCAAIQPGHPCYLP  401

Query  323  NSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKY  189
            +++  HAS+A++ Y+ + +S GGTC F+G A+ T  DPSY  C Y
Sbjct  402  DNIKSHASFAYNDYYQKMKSAGGTCDFSGTAITTTRDPSYKTCAY  446



>ref|XP_004294998.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461676.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Fragaria vesca 
subsp. vesca]
Length=494

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 100/165 (61%), Gaps = 13/165 (8%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            +++  +  G P++P   I   I+ L+NE+++PGP +E+++GVL+ NG+ +YP+ L   TP
Sbjct  293  IRRVLNDSGPPSKPTFPINAYIYELFNEDKRPGPVSEKNWGVLFTNGSTVYPLTLGTSTP  352

Query  503  ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNP  324
                               ++CV    A+   + D L++ACGQG   C PIQ G  CY P
Sbjct  353  TGN-------------SSGLFCVAKSEADPDKLEDGLNWACGQGQADCTPIQQGQGCYLP  399

Query  323  NSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKY  189
            N+L+ HASYA++ Y+ + +S+GGTC F+G A  T  DPSYG+CK+
Sbjct  400  NTLVNHASYAYNDYYQRMQSVGGTCDFDGTAKTTTIDPSYGSCKF  444



>ref|XP_010545233.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Tarenaya hassleriana]
Length=461

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 101/171 (59%), Gaps = 5/171 (3%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIY--PIDLSG-  513
            +K+  +  GTP RP   +   +FAL+NENQKPGP +ER++G+ YPN   +Y  P+ ++G 
Sbjct  290  IKRVLTGNGTPLRPKDPLNVYLFALFNENQKPGPTSERNYGLFYPNEEKVYDVPLGMAGG  349

Query  512  -KTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGA  336
              TP +E      PT  +  + + WCV    +    +  AL YACG+G   C PIQPG  
Sbjct  350  RSTPVNE-SKAQVPTAARGGQARTWCVANGESEEEKLQKALDYACGEGGADCRPIQPGAT  408

Query  335  CYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            CY+PN+L  HASYAF+SY+ +     GTC F G+A      P +G C++P+
Sbjct  409  CYDPNTLEAHASYAFNSYYHKNARGTGTCDFGGVAYVVTQPPRFGKCEFPT  459



>ref|XP_007142328.1| hypothetical protein PHAVU_008G271000g [Phaseolus vulgaris]
 gb|ESW14322.1| hypothetical protein PHAVU_008G271000g [Phaseolus vulgaris]
Length=466

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 100/176 (57%), Gaps = 10/176 (6%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDL-----  519
            V++   + GTP RP   +   +FAL+NENQK GP +ER++G+ YP+   +Y I L     
Sbjct  290  VRRVLGQSGTPLRPNDSLDVFLFALFNENQKTGPTSERNYGLFYPSEKKVYDIPLKAEGV  349

Query  518  ----SGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPI  351
                S    +S+ P   + +T     G+ WCV    A+   + + L+YACG+G   C+ I
Sbjct  350  TEAPSSGVEKSQVPASGEVSTTS-RDGQTWCVANGGASEEKLQNGLNYACGEGGADCSAI  408

Query  350  QPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            QP   CYNPN+L  HASYAF+SY+ +     GTC F G A    + P YG+C++PS
Sbjct  409  QPDATCYNPNTLEAHASYAFNSYYQKKARAAGTCDFGGTAYVVTHPPKYGSCEFPS  464



>ref|XP_009375652.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Pyrus x bretschneideri]
 ref|XP_009375659.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Pyrus x bretschneideri]
Length=494

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 103/165 (62%), Gaps = 12/165 (7%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            +++  +  G P++P + I T I+ L+NE+Q+PGP +E+++GV Y NG+ +YP+ L+    
Sbjct  293  IRRVLNGSGPPSQPKLPINTYIYELFNEDQRPGPVSEKNWGVFYTNGSAVYPLSLNDSN-  351

Query  503  ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNP  324
                    + T N      V+CV    A+   + D L++ACGQG   C PIQ G  CY P
Sbjct  352  --------QITGN---SSGVFCVAKADADPDKLQDGLNWACGQGGANCTPIQKGQRCYLP  400

Query  323  NSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKY  189
            ++++ HASYAF+ Y+ + +S GGTC F+G A+ T  DPSYGACK+
Sbjct  401  DTIVNHASYAFNDYYQKMQSAGGTCDFDGTAMTTTVDPSYGACKF  445



>ref|XP_010063042.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Eucalyptus 
grandis]
 gb|KCW70222.1| hypothetical protein EUGRSUZ_F03495 [Eucalyptus grandis]
Length=456

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 93/167 (56%), Gaps = 0/167 (0%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            V++  +  GTP RP   +   +FAL+NENQK GP +ER++G+ YP+   +Y I L+ +  
Sbjct  288  VRRALTGTGTPLRPNNTVDVYLFALFNENQKTGPTSERNYGLFYPDEQKVYSIPLTLEQL  347

Query  503  ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNP  324
             S+     K        G+ WCV    A    +  AL YACG+G   C PIQ G ACYNP
Sbjct  348  ASDPNNASKAQVPTAPVGQTWCVANGKAGAKKLQAALDYACGKGGADCQPIQQGSACYNP  407

Query  323  NSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            N+L  HASYAF+SY+ +     GTC F G A      P YG C +P+
Sbjct  408  NTLEAHASYAFNSYYQKNARGAGTCNFGGAAFVVTQVPEYGECDFPT  454



>ref|XP_002864380.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40639.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 96/168 (57%), Gaps = 2/168 (1%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK-T  507
            VK+  +  GTP +P   +   +FAL+NENQK GP +ER++G+ YPN   +Y + LSGK T
Sbjct  293  VKRVLTGNGTPLKPKEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVSLSGKST  352

Query  506  PESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYN  327
            P ++      P     + G+ WCV         + + L YACG+G   C PIQPG  CYN
Sbjct  353  PVNDNKEKVVPV-KPSHVGQTWCVANGKTTKEKLQEGLDYACGEGGADCRPIQPGATCYN  411

Query  326  PNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            P SL  HASYAF+SY+ +     GTC F G A      P YG C++P+
Sbjct  412  PESLEAHASYAFNSYYQKNARGVGTCDFGGAAYVVSQPPKYGKCEFPT  459



>dbj|BAF01977.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
Length=314

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 96/169 (57%), Gaps = 6/169 (4%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            VK+  +  GTP RP   +   +FAL+NENQKPGP +ER++G+ YPN   +Y +  + K+ 
Sbjct  148  VKRVLTGKGTPLRPTEPLNVYLFALFNENQKPGPTSERNYGLFYPNEGKVYNVPFTKKST  207

Query  503  ESEFPPLPKPTTNQP--YKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  330
                 P+       P  ++G  WCV         + +AL YACG+G   C PIQPG  CY
Sbjct  208  T----PVNGNRGKVPVTHEGHTWCVSNGEVAKEKLQEALDYACGEGGADCRPIQPGATCY  263

Query  329  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            +P SL  HASYAF+SY+ +     GTC+F G A      P YG C++P+
Sbjct  264  HPESLEAHASYAFNSYYQKNSRRVGTCFFGGAAHVVTQPPRYGKCEFPT  312



>ref|XP_009794437.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Nicotiana 
sylvestris]
Length=475

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 96/185 (52%), Gaps = 18/185 (10%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK--  510
            V++  +  GTP +P   +   +FAL+NENQKPGP +ER++G+ YPN   +Y I L+ +  
Sbjct  289  VRRVLTGSGTPLKPNEPLDVFLFALFNENQKPGPTSERNYGLFYPNEQKVYDITLTKEGL  348

Query  509  ----------------TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACG  378
                             PE    P+          G  WCV    A    +  AL YACG
Sbjct  349  ENGPTMNNGSKNTVVTAPEPAAAPVSGGDVEASKVGNTWCVANEKAAREKLQAALDYACG  408

Query  377  QGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGA  198
            +G   C PIQ G  CY+P++L  HASYAF+SY+ +     GTC FNG A      P YG+
Sbjct  409  EGGADCRPIQQGATCYDPDTLEAHASYAFNSYYQKNTRGVGTCDFNGAAYVVTQHPKYGS  468

Query  197  CKYPS  183
            CK+P+
Sbjct  469  CKFPT  473



>dbj|BAB17320.1| elicitor inducible beta-1,3-glucanase NtEIG-E76 [Nicotiana tabacum]
Length=467

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 97/177 (55%), Gaps = 10/177 (6%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLS----  516
            V++  +  GTP +P   +   +FAL+NENQKPGP +ER++G+ YPN   +Y I L+    
Sbjct  289  VRRVLTGSGTPLKPNEPLDVFLFALFNENQKPGPTSERNYGLFYPNEQKVYDITLTKDGL  348

Query  515  GKTP------ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNP  354
            G  P      +S     P+P       G  WCV    A    +  AL YACG+G   C P
Sbjct  349  GNGPTMNNGSKSTVVTAPEPALEASKVGNTWCVANEKAAREKLQAALDYACGEGGADCRP  408

Query  353  IQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            IQ G  CY+P++L  HASYAF+SY+ +      TC F+G A      P YG+CK+P+
Sbjct  409  IQQGATCYDPDTLEAHASYAFNSYYQKNTRGVSTCDFSGAAYVVTQHPKYGSCKFPT  465



>emb|CDY46679.1| BnaA03g48290D [Brassica napus]
Length=446

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 94/167 (56%), Gaps = 15/167 (9%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            V++  +  GTP RP   +   +FAL+NENQKPGP +ER++G+ YPN   +Y +  +    
Sbjct  293  VQRVLNGNGTPLRPKEPLNVFLFALFNENQKPGPTSERNYGLFYPNERKVYAVPFAA---  349

Query  503  ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNP  324
                      TT+ P  G+ WCV    A    +  AL YACG+G   C PIQPG  CY+P
Sbjct  350  ----------TTSTP--GETWCVSNGDAAKEKLQAALDYACGEGGADCRPIQPGATCYHP  397

Query  323  NSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
             SL  HAS+AF+SY+ +     GTCYF G A      P YG CK+P+
Sbjct  398  KSLEAHASFAFNSYYQKNARRDGTCYFGGTAHVVTQHPRYGKCKFPT  444



>ref|XP_004140121.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform 2 
[Cucumis sativus]
 ref|XP_004156096.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform 2 
[Cucumis sativus]
 gb|KGN47963.1| hypothetical protein Csa_6G421570 [Cucumis sativus]
Length=476

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 99/184 (54%), Gaps = 17/184 (9%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK-T  507
            V++  S  GTP RP   +   +FAL+NEN+K GP +ER++G+ YPN   +Y I  + +  
Sbjct  291  VRRILSGGGTPLRPKADLTVYLFALFNENKKNGPTSERNYGLFYPNEEKVYDIPFTTEGL  350

Query  506  PESEFPPLPKPTT----------------NQPYKGKVWCVVAPAANLTAVADALSYACGQ  375
             + E  P PKP +                ++   G  WCV +  A    +   L YACG+
Sbjct  351  KDFEDKPSPKPVSGGNAPTAPPASGDGGVSKSQTGNTWCVASGEAGKEKLQSGLDYACGE  410

Query  374  GNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGAC  195
            G   C PIQ G  CYNPN+L  HASYAF+SY+ +     GTCYF G A      P YG+C
Sbjct  411  GGADCRPIQVGATCYNPNTLEAHASYAFNSYYQKNSRKVGTCYFGGAAYVVTQPPKYGSC  470

Query  194  KYPS  183
            ++P+
Sbjct  471  EFPT  474



>ref|XP_006447645.1| hypothetical protein CICLE_v10015086mg [Citrus clementina]
 gb|ESR60885.1| hypothetical protein CICLE_v10015086mg [Citrus clementina]
Length=480

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 99/181 (55%), Gaps = 14/181 (8%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIY--PIDLSG-  513
            V++  +  GTP RP   +   +FAL+NE+QKPGP +ER++G+ YPN   +Y  P  + G 
Sbjct  298  VRRILTGGGTPLRPKADLTVYLFALFNEDQKPGPTSERNYGLFYPNEEKVYNIPFTVEGL  357

Query  512  ------KTPESEFPPLPKPT-----TNQPYKGKVWCVVAPAANLTAVADALSYACGQGNR  366
                  ++P +  P +  P       ++   G  WCV         +   L YACG+G  
Sbjct  358  KNYHDHRSPVNRSPTVRAPVNGGGGVSKSTSGNTWCVANAEVGKEKLQRGLDYACGEGGA  417

Query  365  TCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYP  186
             C PIQPG  CY+PN+L  HAS+AF+SY+ +    GG+CYF G A      P YG C++P
Sbjct  418  DCRPIQPGATCYSPNTLEAHASFAFNSYYQKQSRAGGSCYFGGAAYVVTQPPRYGVCEFP  477

Query  185  S  183
            +
Sbjct  478  T  478



>ref|XP_007014685.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 ref|XP_007014686.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY32304.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY32305.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=496

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 104/165 (63%), Gaps = 12/165 (7%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            +++ ++  G P++P + I T I+ L+NE+++PGP +E+++GVL+ NGT +YP+ LSG + 
Sbjct  293  IRRVSNNSGPPSQPTIPINTYIYELFNEDKRPGPASEKNWGVLFLNGTAVYPLSLSGSS-  351

Query  503  ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNP  324
                    + T N      V+CV     +   + D L++ACGQG   C+ IQ G  CY P
Sbjct  352  --------QITGNST---TVFCVAKDDTSEDKLQDGLNWACGQGQANCSAIQSGQPCYLP  400

Query  323  NSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKY  189
            N++  HASYA++ Y+ +  SLGGTC F+G A  T N+PSYG+C +
Sbjct  401  NNIKNHASYAYNDYYQKMHSLGGTCDFDGTATTTTNNPSYGSCIF  445



>ref|XP_008352033.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
4 [Malus domestica]
Length=469

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 103/165 (62%), Gaps = 12/165 (7%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            +++  +  G P++P + I T I+ L+NE+Q+PGP +E+++GV Y NG+ +YP+ L+    
Sbjct  268  IQRVLNGSGPPSQPKLPINTYIYELFNEDQRPGPVSEKNWGVFYTNGSAVYPLSLNDSN-  326

Query  503  ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNP  324
                    + T N      V+CV    A+   + D L++ACGQG   C PIQ G  CY P
Sbjct  327  --------QITGN---SSGVFCVAKADADPDKLQDGLNWACGQGGANCTPIQKGQRCYLP  375

Query  323  NSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKY  189
            +S++ HASYAF+ Y+ + +S GGTC F+G A+ T  DPS+GACK+
Sbjct  376  DSIVNHASYAFNDYYQKMQSAGGTCDFDGTAMTTTVDPSHGACKF  420



>ref|XP_007020717.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY12242.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=475

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 100/176 (57%), Gaps = 9/176 (5%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            V++  S  GTP RP   +   +FAL+NENQK GP +ER++G+ YPN   +Y I L+ +  
Sbjct  298  VRRVLSGNGTPLRPQDPLNVYLFALFNENQKSGPTSERNYGLFYPNEQKVYNIPLTKEEL  357

Query  503  ES-EFPPLPKPTTNQPYKGKV--------WCVVAPAANLTAVADALSYACGQGNRTCNPI  351
            ES +  P+   T+  P  G+V        WCV    A    +  AL YACG+G   C PI
Sbjct  358  ESGQSTPVNGNTSQVPATGEVSKTSVGQTWCVANKNAGEKTLQAALDYACGEGGADCKPI  417

Query  350  QPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            QPG  CY+PN+L  HASYAF+SY+ +     GTC F G A      P YG C++P+
Sbjct  418  QPGATCYSPNTLDAHASYAFNSYYQKKTRGTGTCDFGGAAYVVSQPPRYGNCEFPT  473



>ref|XP_008354983.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Malus domestica]
 ref|XP_008354984.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Malus domestica]
 ref|XP_008354985.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Malus domestica]
Length=494

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 103/165 (62%), Gaps = 12/165 (7%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            +++  +  G P++P + I T I+ L+NE+Q+PGP +E+++GV Y NG+ +YP+ L+    
Sbjct  293  IQRVLNGSGPPSQPKLPINTYIYELFNEDQRPGPVSEKNWGVFYTNGSAVYPLSLNDSN-  351

Query  503  ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNP  324
                    + T N      V+CV    A+   + D L++ACGQG   C PIQ G  CY P
Sbjct  352  --------QITGN---SSGVFCVAKADADPDKLQDGLNWACGQGGANCTPIQKGQRCYLP  400

Query  323  NSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKY  189
            +S++ HASYAF+ Y+ + +S GGTC F+G A+ T  DPS+GACK+
Sbjct  401  DSIVNHASYAFNDYYQKMQSAGGTCDFDGTAMTTTVDPSHGACKF  445



>gb|ACN39797.1| unknown [Picea sitchensis]
Length=474

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 98/181 (54%), Gaps = 14/181 (8%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            VK   S  GTP RP   + T +FAL+NEN+KPGP +ER++G+ YP+   +Y I L+    
Sbjct  292  VKHVMSNSGTPLRPKASLDTFLFALFNENKKPGPTSERNYGLFYPSEQRVYDIALTPSAV  351

Query  503  ESEFPPLPKPTTNQPY--------------KGKVWCVVAPAANLTAVADALSYACGQGNR  366
             +  P     +++ P                 + WCV    ++ + +  AL YACG+G+ 
Sbjct  352  NNPAPASGNSSSSTPAVSAHHHSSGTTPAGGSETWCVANSKSDTSKLQAALDYACGEGDA  411

Query  365  TCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYP  186
             C  IQPG  CYNPN+L  HASYAF+SY+ +     GTC F G A      P YG CK+P
Sbjct  412  DCQQIQPGAPCYNPNTLEAHASYAFNSYYQKNSRKIGTCDFAGAAYVVTQSPKYGDCKFP  471

Query  185  S  183
            +
Sbjct  472  T  472



>ref|XP_007141644.1| hypothetical protein PHAVU_008G213400g [Phaseolus vulgaris]
 gb|ESW13638.1| hypothetical protein PHAVU_008G213400g [Phaseolus vulgaris]
Length=473

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 101/183 (55%), Gaps = 16/183 (9%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKT-  507
            V+K  +  GTP RP   +   +FAL+NENQK GP +ER+FG+ YP+   +Y +  + +  
Sbjct  289  VRKILTGGGTPLRPKADLTVYLFALFNENQKSGPTSERNFGLFYPDEKRVYNVPFTAEEL  348

Query  506  PESEFPPLPKPTTNQPYK---------------GKVWCVVAPAANLTAVADALSYACGQG  372
             +    P+   + NQ  +               G  WCV  P A+   +  AL +ACG+G
Sbjct  349  KDYHDSPVKGGSHNQTTQAPAPNVSGGVSKSTTGNTWCVANPDADKVKLQAALDFACGEG  408

Query  371  NRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACK  192
               C PIQ G  CY+PN+++ HAS+AF+SY+ +    GG+CYF G +     +P YG C+
Sbjct  409  GADCAPIQHGATCYDPNTIVAHASFAFNSYYQKQARKGGSCYFGGTSYVVTQEPRYGNCE  468

Query  191  YPS  183
            +P+
Sbjct  469  FPT  471



>ref|XP_008354986.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Malus domestica]
Length=475

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 103/165 (62%), Gaps = 12/165 (7%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            +++  +  G P++P + I T I+ L+NE+Q+PGP +E+++GV Y NG+ +YP+ L+    
Sbjct  274  IQRVLNGSGPPSQPKLPINTYIYELFNEDQRPGPVSEKNWGVFYTNGSAVYPLSLNDSN-  332

Query  503  ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNP  324
                    + T N      V+CV    A+   + D L++ACGQG   C PIQ G  CY P
Sbjct  333  --------QITGN---SSGVFCVAKADADPDKLQDGLNWACGQGGANCTPIQKGQRCYLP  381

Query  323  NSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKY  189
            +S++ HASYAF+ Y+ + +S GGTC F+G A+ T  DPS+GACK+
Sbjct  382  DSIVNHASYAFNDYYQKMQSAGGTCDFDGTAMTTTVDPSHGACKF  426



>ref|XP_004161885.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
13-like [Cucumis sativus]
Length=458

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 94/168 (56%), Gaps = 1/168 (1%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            VK+  +  GTP RP   +   +FAL+NEN+K GP +ER++G+ YPN   +Y I L+    
Sbjct  289  VKRVLTGSGTPLRPKEPLNAYLFALFNENKKQGPTSERNYGLFYPNEEKVYEIPLTSADV  348

Query  503  ESEFPPLPKPTTNQPYK-GKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYN  327
            E      P    ++  K G+ WCV         +   L YACG+G   C+ IQPG  CYN
Sbjct  349  EGGVGSTPAVNGSKVIKNGQTWCVANGKVAPEKLQAGLDYACGEGGADCSSIQPGATCYN  408

Query  326  PNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            PNSL  HASYAF+SY+ + +   GTC F G A      P YG C++P+
Sbjct  409  PNSLEAHASYAFNSYYQKMKRAVGTCDFGGAAYVVTQPPQYGQCEFPT  456



>ref|XP_010914932.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Elaeis guineensis]
Length=527

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 99/167 (59%), Gaps = 5/167 (3%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            ++   +  GTPA+PG  I   IF+L+NEN+KPG  +ER++G+ YP+ T+IY +DL+G+  
Sbjct  320  IRHVINDTGTPAKPGEEIDVYIFSLFNENRKPGLESERNWGLFYPDRTSIYSLDLTGRGN  379

Query  503  ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNP  324
                      ++N       WCV +  A+   + +AL +ACG GN  C+ IQP   CY P
Sbjct  380  VDVITGGNMTSSN-----GTWCVASTNASELDLQNALDWACGPGNVDCSAIQPSQPCYQP  434

Query  323  NSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            ++L+ HASYAF+SY+ Q  +    C F G  V+T  DPSY  C Y +
Sbjct  435  DTLVSHASYAFNSYYQQNGATDVACSFGGTGVRTTKDPSYDNCIYAT  481



>ref|XP_006469612.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Citrus sinensis]
Length=540

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 99/181 (55%), Gaps = 14/181 (8%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIY--PIDLSG-  513
            V++  +  GTP RP   +   +FAL+NE+QKPGP +ER++G+ YPN   +Y  P  + G 
Sbjct  358  VRRILTGGGTPLRPKADLTVYLFALFNEDQKPGPTSERNYGLFYPNEEKVYNIPFTVEGL  417

Query  512  ------KTPESEFPPLPKPT-----TNQPYKGKVWCVVAPAANLTAVADALSYACGQGNR  366
                  ++P +  P +  P       ++   G  WCV         +   L YACG+G  
Sbjct  418  KNYHDHRSPVNRSPTVRAPVNGGGGVSKSTSGNTWCVANAEVGKEKLQRGLDYACGEGGA  477

Query  365  TCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYP  186
             C PIQPG  CY+PN+L  HAS+AF+SY+ +    GG+CYF G A      P YG C++P
Sbjct  478  DCRPIQPGATCYSPNTLEAHASFAFNSYYQKQSRAGGSCYFGGAAYVVTQPPRYGVCEFP  537

Query  185  S  183
            +
Sbjct  538  T  538



>ref|XP_004149346.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Cucumis 
sativus]
 gb|KGN56102.1| hypothetical protein Csa_3G073920 [Cucumis sativus]
Length=458

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 94/168 (56%), Gaps = 1/168 (1%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            VK+  +  GTP RP   +   +FAL+NEN+K GP +ER++G+ YPN   +Y I L+    
Sbjct  289  VKRVLTGSGTPLRPKEPLNAYLFALFNENKKQGPTSERNYGLFYPNEEKVYEIPLTSADV  348

Query  503  ESEFPPLPKPTTNQPYK-GKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYN  327
            E      P    ++  K G+ WCV         +   L YACG+G   C+ IQPG  CYN
Sbjct  349  EGGVGSTPAVNGSKVIKNGQTWCVANGKVAPEKLQAGLDYACGEGGADCSSIQPGATCYN  408

Query  326  PNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            PNSL  HASYAF+SY+ + +   GTC F G A      P YG C++P+
Sbjct  409  PNSLEAHASYAFNSYYQKMKRAVGTCDFGGAAYVVTQPPQYGQCEFPT  456



>ref|XP_010924450.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Elaeis guineensis]
Length=496

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 98/167 (59%), Gaps = 5/167 (3%)
 Frame = -1

Query  683  VKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTP  504
            ++   +  GTPA+PG  I   IF+L+NEN+KPG  +ER++G+ YP+ T+IY +DL+G+  
Sbjct  290  IRHVINDTGTPAKPGEEIDVYIFSLFNENRKPGLESERNWGLFYPDQTSIYSLDLTGRGN  349

Query  503  ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNP  324
                      ++N       WCV +  A+   + +AL +ACG GN  C+ IQP   CY P
Sbjct  350  VDVITGANITSSN-----GTWCVASSNASELDLQNALDWACGPGNVDCSAIQPSQPCYQP  404

Query  323  NSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  183
            ++L+ HASYAF+SY+ Q  +    C F G  VK   DPSY  C Y +
Sbjct  405  DTLLSHASYAFNSYYQQNGATDVACSFGGTGVKITKDPSYDKCVYAT  451



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117974212060