BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF023A02

Length=722
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009595413.1|  PREDICTED: bifunctional monodehydroascorbate...    173   7e-49   Nicotiana tomentosiformis
ref|XP_009782909.1|  PREDICTED: bifunctional monodehydroascorbate...    171   5e-48   Nicotiana sylvestris
ref|XP_009776976.1|  PREDICTED: alpha carbonic anhydrase 7-like         168   6e-48   Nicotiana sylvestris
ref|XP_009776894.1|  PREDICTED: bifunctional monodehydroascorbate...    167   8e-47   Nicotiana sylvestris
ref|XP_009621603.1|  PREDICTED: alpha carbonic anhydrase 7              167   1e-46   Nicotiana tomentosiformis
ref|XP_006340169.1|  PREDICTED: bifunctional monodehydroascorbate...    166   2e-46   Solanum tuberosum [potatoes]
ref|XP_006340168.1|  PREDICTED: bifunctional monodehydroascorbate...    166   5e-46   Solanum tuberosum [potatoes]
sp|Q84UV8.1|NEC3_NICLS  RecName: Full=Bifunctional monodehydroasc...    165   7e-46   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_004251153.1|  PREDICTED: alpha carbonic anhydrase 7              163   5e-45   Solanum lycopersicum
ref|XP_011090098.1|  PREDICTED: alpha carbonic anhydrase 7              161   3e-44   
emb|CDP11563.1|  unnamed protein product                                159   1e-43   Coffea canephora [robusta coffee]
gb|KJB83847.1|  hypothetical protein B456_013G267400                    157   1e-42   Gossypium raimondii
ref|XP_011090042.1|  PREDICTED: alpha carbonic anhydrase 7-like         156   2e-42   Sesamum indicum [beniseed]
emb|CDP07086.1|  unnamed protein product                                156   3e-42   Coffea canephora [robusta coffee]
gb|KJB56187.1|  hypothetical protein B456_009G109100                    151   4e-41   Gossypium raimondii
ref|XP_009399717.1|  PREDICTED: alpha carbonic anhydrase 7-like         152   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004241280.1|  PREDICTED: bifunctional monodehydroascorbate...    151   1e-40   Solanum lycopersicum
gb|KHG27075.1|  Bifunctional monodehydroascorbate reductase and c...    151   1e-40   Gossypium arboreum [tree cotton]
ref|XP_004139554.1|  PREDICTED: bifunctional monodehydroascorbate...    151   1e-40   Cucumis sativus [cucumbers]
ref|XP_004160913.1|  PREDICTED: bifunctional monodehydroascorbate...    151   1e-40   
gb|KJB56186.1|  hypothetical protein B456_009G109100                    151   1e-40   Gossypium raimondii
ref|XP_008802055.1|  PREDICTED: alpha carbonic anhydrase 7-like         150   3e-40   Phoenix dactylifera
ref|XP_004242096.1|  PREDICTED: bifunctional monodehydroascorbate...    150   3e-40   
ref|XP_006424533.1|  hypothetical protein CICLE_v10029790mg             150   4e-40   Citrus clementina [clementine]
ref|XP_008359452.1|  PREDICTED: bifunctional monodehydroascorbate...    150   5e-40   
gb|KEH16352.1|  eukaryotic-type carbonic anhydrase                      149   7e-40   Medicago truncatula
ref|XP_006488639.1|  PREDICTED: bifunctional monodehydroascorbate...    149   1e-39   Citrus sinensis [apfelsine]
gb|KJB56185.1|  hypothetical protein B456_009G109000                    149   1e-39   Gossypium raimondii
ref|XP_009391366.1|  PREDICTED: alpha carbonic anhydrase 7-like         149   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO73356.1|  hypothetical protein CISIN_1g039445mg                   149   2e-39   Citrus sinensis [apfelsine]
ref|XP_009367040.1|  PREDICTED: alpha carbonic anhydrase 7-like         148   2e-39   Pyrus x bretschneideri [bai li]
ref|XP_008464591.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    147   4e-39   
ref|XP_008810946.1|  PREDICTED: alpha carbonic anhydrase 7-like         147   7e-39   Phoenix dactylifera
ref|XP_011459370.1|  PREDICTED: alpha carbonic anhydrase 7              146   1e-38   Fragaria vesca subsp. vesca
ref|XP_006473002.1|  PREDICTED: bifunctional monodehydroascorbate...    146   1e-38   Citrus sinensis [apfelsine]
gb|KDO73355.1|  hypothetical protein CISIN_1g046862mg                   146   2e-38   Citrus sinensis [apfelsine]
ref|XP_006424534.1|  hypothetical protein CICLE_v10030314mg             146   2e-38   Citrus clementina [clementine]
tpg|DAA48425.1|  TPA: carbonic anhydrase                                146   2e-38   
ref|XP_003541987.1|  PREDICTED: bifunctional monodehydroascorbate...    145   2e-38   Glycine max [soybeans]
ref|NP_001149032.1|  carbonic anhydrase precursor                       146   2e-38   Zea mays [maize]
ref|XP_006488640.1|  PREDICTED: bifunctional monodehydroascorbate...    145   2e-38   Citrus sinensis [apfelsine]
ref|XP_004506042.1|  PREDICTED: bifunctional monodehydroascorbate...    145   4e-38   Cicer arietinum [garbanzo]
gb|KDO81077.1|  hypothetical protein CISIN_1g038655mg                   145   4e-38   Citrus sinensis [apfelsine]
ref|XP_007016796.1|  Alpha carbonic anhydrase 7                         144   5e-38   Theobroma cacao [chocolate]
ref|XP_007150177.1|  hypothetical protein PHAVU_005G133000g             144   5e-38   Phaseolus vulgaris [French bean]
ref|XP_008810960.1|  PREDICTED: alpha carbonic anhydrase 7-like         144   6e-38   
gb|KHN39017.1|  Bifunctional monodehydroascorbate reductase and c...    144   8e-38   Glycine soja [wild soybean]
ref|XP_006433902.1|  hypothetical protein CICLE_v10003227mg             144   1e-37   
ref|XP_010272832.1|  PREDICTED: alpha carbonic anhydrase 7-like         144   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_003539200.1|  PREDICTED: bifunctional monodehydroascorbate...    144   1e-37   Glycine max [soybeans]
ref|XP_010043780.1|  PREDICTED: alpha carbonic anhydrase 7-like         143   2e-37   Eucalyptus grandis [rose gum]
ref|XP_002529419.1|  carbonic anhydrase, putative                       143   2e-37   Ricinus communis
ref|XP_003537009.2|  PREDICTED: bifunctional monodehydroascorbate...    144   2e-37   Glycine max [soybeans]
ref|XP_002529418.1|  carbonic anhydrase, putative                       143   2e-37   Ricinus communis
ref|XP_004506040.1|  PREDICTED: bifunctional monodehydroascorbate...    144   2e-37   Cicer arietinum [garbanzo]
ref|XP_010916592.1|  PREDICTED: alpha carbonic anhydrase 7-like         143   3e-37   Elaeis guineensis
gb|KDP44023.1|  hypothetical protein JCGZ_05490                         143   3e-37   Jatropha curcas
gb|KGN64825.1|  hypothetical protein Csa_1G120410                       142   3e-37   Cucumis sativus [cucumbers]
ref|XP_004166480.1|  PREDICTED: bifunctional monodehydroascorbate...    142   3e-37   
ref|XP_010488326.1|  PREDICTED: alpha carbonic anhydrase 7              142   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010475599.1|  PREDICTED: alpha carbonic anhydrase 7-like         142   4e-37   Camelina sativa [gold-of-pleasure]
ref|XP_004139552.1|  PREDICTED: bifunctional monodehydroascorbate...    142   4e-37   
ref|XP_010916593.1|  PREDICTED: alpha carbonic anhydrase 7-like         142   4e-37   Elaeis guineensis
ref|XP_006384924.1|  hypothetical protein POPTR_0004s22280g             142   4e-37   Populus trichocarpa [western balsam poplar]
ref|XP_010450977.1|  PREDICTED: alpha carbonic anhydrase 8              143   6e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010458032.1|  PREDICTED: alpha carbonic anhydrase 7              142   6e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002445622.1|  hypothetical protein SORBIDRAFT_07g022860          142   6e-37   Sorghum bicolor [broomcorn]
ref|XP_006409842.1|  hypothetical protein EUTSA_v10017075mg             142   6e-37   Eutrema salsugineum [saltwater cress]
ref|XP_007016793.1|  Alpha carbonic anhydrase 7                         142   6e-37   
ref|XP_002282495.2|  PREDICTED: alpha carbonic anhydrase 7              142   7e-37   Vitis vinifera
ref|XP_004242097.1|  PREDICTED: bifunctional monodehydroascorbate...    141   8e-37   Solanum lycopersicum
gb|KHN38743.1|  Bifunctional monodehydroascorbate reductase and c...    141   1e-36   Glycine soja [wild soybean]
ref|XP_010521744.1|  PREDICTED: alpha carbonic anhydrase 7-like         141   1e-36   Tarenaya hassleriana [spider flower]
ref|XP_009400916.1|  PREDICTED: alpha carbonic anhydrase 7-like         140   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDF47511.1|  bifunctional monodehydroascorbate reductase and ...    137   2e-36   Cucumis sativus [cucumbers]
ref|XP_006303231.1|  hypothetical protein CARUB_v10012300mg             140   3e-36   Capsella rubella
ref|XP_009380700.1|  PREDICTED: alpha carbonic anhydrase 7-like         140   3e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK43125.1|  hypothetical protein AALP_AA1G083600                    140   3e-36   Arabis alpina [alpine rockcress]
ref|XP_002892434.1|  carbonic anhydrase family protein                  140   3e-36   Arabidopsis lyrata subsp. lyrata
ref|XP_002445625.1|  hypothetical protein SORBIDRAFT_07g022890          140   3e-36   Sorghum bicolor [broomcorn]
ref|XP_006365755.1|  PREDICTED: bifunctional monodehydroascorbate...    140   3e-36   
ref|XP_010414580.1|  PREDICTED: alpha carbonic anhydrase 2-like         140   3e-36   Camelina sativa [gold-of-pleasure]
gb|KDP44024.1|  hypothetical protein JCGZ_05491                         140   4e-36   Jatropha curcas
ref|XP_008462825.1|  PREDICTED: bifunctional monodehydroascorbate...    139   4e-36   Cucumis melo [Oriental melon]
ref|XP_008462835.1|  PREDICTED: bifunctional monodehydroascorbate...    139   4e-36   
ref|XP_006845947.1|  hypothetical protein AMTR_s00157p00092470          139   5e-36   
ref|XP_009356885.1|  PREDICTED: alpha carbonic anhydrase 7-like         139   5e-36   Pyrus x bretschneideri [bai li]
sp|Q9FM99.2|ATCA8_ARATH  RecName: Full=Alpha carbonic anhydrase 8...    139   5e-36   
ref|XP_008778933.1|  PREDICTED: alpha carbonic anhydrase 7-like         139   6e-36   Phoenix dactylifera
ref|XP_009148066.1|  PREDICTED: alpha carbonic anhydrase 7-like         139   6e-36   Brassica rapa
gb|KFK32339.1|  hypothetical protein AALP_AA6G228800                    139   7e-36   Arabis alpina [alpine rockcress]
ref|XP_006401345.1|  hypothetical protein EUTSA_v10014359mg             139   7e-36   Eutrema salsugineum [saltwater cress]
ref|XP_004973662.1|  PREDICTED: bifunctional monodehydroascorbate...    139   7e-36   Setaria italica
ref|NP_001147028.1|  carbonic anhydrase precursor                       139   7e-36   Zea mays [maize]
ref|XP_008385339.1|  PREDICTED: bifunctional monodehydroascorbate...    139   9e-36   Malus domestica [apple tree]
dbj|BAD09854.1|  putative dioscorin class A precursor                   139   1e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010109499.1|  hypothetical protein L484_007519                   138   1e-35   Morus notabilis
ref|XP_010046439.1|  PREDICTED: alpha carbonic anhydrase 7-like         138   1e-35   Eucalyptus grandis [rose gum]
ref|XP_009113037.1|  PREDICTED: alpha carbonic anhydrase 2-like         138   1e-35   Brassica rapa
gb|ADW27480.1|  carbonic anhydrase                                      138   1e-35   Zea mays [maize]
ref|XP_009148224.1|  PREDICTED: alpha carbonic anhydrase 7-like         138   1e-35   Brassica rapa
emb|CDX95095.1|  BnaC05g05760D                                          138   1e-35   
ref|XP_010696305.1|  PREDICTED: alpha carbonic anhydrase 7-like         138   2e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004973661.1|  PREDICTED: bifunctional monodehydroascorbate...    138   2e-35   Setaria italica
ref|XP_008226047.1|  PREDICTED: bifunctional monodehydroascorbate...    138   2e-35   Prunus mume [ume]
ref|XP_006659489.1|  PREDICTED: bifunctional monodehydroascorbate...    138   2e-35   Oryza brachyantha
ref|XP_006417733.1|  hypothetical protein EUTSA_v10008451mg             138   2e-35   Eutrema salsugineum [saltwater cress]
ref|XP_011040911.1|  PREDICTED: alpha carbonic anhydrase 7-like         137   2e-35   Populus euphratica
gb|AFK36418.1|  unknown                                                 138   2e-35   Lotus japonicus
ref|XP_010510675.1|  PREDICTED: alpha carbonic anhydrase 7-like i...    137   2e-35   
emb|CDY45963.1|  BnaA09g13030D                                          137   3e-35   Brassica napus [oilseed rape]
emb|CDY04545.1|  BnaA07g13710D                                          137   3e-35   
ref|XP_008664513.1|  PREDICTED: bifunctional monodehydroascorbate...    138   3e-35   Zea mays [maize]
emb|CDY45480.1|  BnaC09g12980D                                          137   3e-35   Brassica napus [oilseed rape]
ref|XP_009103655.1|  PREDICTED: alpha carbonic anhydrase 2              137   3e-35   Brassica rapa
ref|XP_010510674.1|  PREDICTED: alpha carbonic anhydrase 2-like i...    137   4e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010470128.1|  PREDICTED: alpha carbonic anhydrase 2-like i...    137   4e-35   Camelina sativa [gold-of-pleasure]
emb|CDY23976.1|  BnaC03g17150D                                          137   5e-35   Brassica napus [oilseed rape]
ref|XP_004139553.1|  PREDICTED: bifunctional monodehydroascorbate...    137   5e-35   
gb|KGN64826.1|  hypothetical protein Csa_1G120420                       137   5e-35   Cucumis sativus [cucumbers]
gb|AAD29832.1|  putative carbonic anhydrase                             136   5e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011077301.1|  PREDICTED: alpha carbonic anhydrase 7-like         137   5e-35   Sesamum indicum [beniseed]
ref|XP_004973745.1|  PREDICTED: bifunctional monodehydroascorbate...    137   6e-35   Setaria italica
ref|XP_009132759.1|  PREDICTED: alpha carbonic anhydrase 2-like         136   7e-35   Brassica rapa
ref|XP_010470127.1|  PREDICTED: alpha carbonic anhydrase 2-like i...    136   7e-35   Camelina sativa [gold-of-pleasure]
ref|XP_007144378.1|  hypothetical protein PHAVU_007G151300g             136   8e-35   Phaseolus vulgaris [French bean]
ref|XP_007144380.1|  hypothetical protein PHAVU_007G151500g             136   9e-35   Phaseolus vulgaris [French bean]
ref|XP_003538184.1|  PREDICTED: bifunctional monodehydroascorbate...    136   9e-35   Glycine max [soybeans]
ref|NP_172287.1|  alpha carbonic anhydrase 7                            136   1e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KEH42156.1|  eukaryotic-type carbonic anhydrase                      136   1e-34   Medicago truncatula
ref|XP_008227262.1|  PREDICTED: bifunctional monodehydroascorbate...    136   1e-34   Prunus mume [ume]
ref|XP_002445624.1|  hypothetical protein SORBIDRAFT_07g022880          136   1e-34   Sorghum bicolor [broomcorn]
ref|XP_011044411.1|  PREDICTED: alpha carbonic anhydrase 7-like         135   1e-34   Populus euphratica
ref|XP_007144381.1|  hypothetical protein PHAVU_007G151500g             136   1e-34   Phaseolus vulgaris [French bean]
emb|CDX94018.1|  BnaC07g36520D                                          135   1e-34   
ref|XP_006594167.1|  PREDICTED: bifunctional monodehydroascorbate...    135   1e-34   Glycine max [soybeans]
gb|KHN48240.1|  Bifunctional monodehydroascorbate reductase and c...    135   2e-34   Glycine soja [wild soybean]
ref|XP_010443286.1|  PREDICTED: alpha carbonic anhydrase 8-like         137   2e-34   Camelina sativa [gold-of-pleasure]
emb|CDX93593.1|  BnaA06g04550D                                          139   2e-34   
ref|XP_008462774.1|  PREDICTED: bifunctional monodehydroascorbate...    135   2e-34   
gb|EEE68846.1|  hypothetical protein OsJ_27636                          134   3e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002314288.2|  hypothetical protein POPTR_0009s01540g             134   3e-34   
gb|EYU41598.1|  hypothetical protein MIMGU_mgv1a011586mg                134   3e-34   Erythranthe guttata [common monkey flower]
ref|XP_007211988.1|  hypothetical protein PRUPE_ppa010973mg             133   6e-34   
ref|XP_007206520.1|  hypothetical protein PRUPE_ppa019410mg             134   6e-34   Prunus persica
gb|KHN39018.1|  Bifunctional monodehydroascorbate reductase and c...    134   6e-34   Glycine soja [wild soybean]
ref|XP_010098808.1|  hypothetical protein L484_022573                   134   7e-34   Morus notabilis
emb|CDX93595.1|  BnaA06g04530D                                          134   7e-34   
ref|XP_006391784.1|  hypothetical protein EUTSA_v10023909mg             133   9e-34   Eutrema salsugineum [saltwater cress]
ref|XP_009134167.1|  PREDICTED: alpha carbonic anhydrase 4-like         133   1e-33   Brassica rapa
gb|KEH42158.1|  eukaryotic-type carbonic anhydrase                      133   1e-33   Medicago truncatula
emb|CDX79018.1|  BnaA01g10850D                                          133   1e-33   
ref|XP_002445628.1|  hypothetical protein SORBIDRAFT_07g022910          133   1e-33   Sorghum bicolor [broomcorn]
ref|XP_010696309.1|  PREDICTED: alpha carbonic anhydrase 7-like         133   1e-33   Beta vulgaris subsp. vulgaris [field beet]
gb|EEC83720.1|  hypothetical protein OsI_29556                          133   1e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_008462808.1|  PREDICTED: bifunctional monodehydroascorbate...    133   2e-33   Cucumis melo [Oriental melon]
ref|XP_007132283.1|  hypothetical protein PHAVU_011G081900g             132   2e-33   Phaseolus vulgaris [French bean]
gb|AFK33933.1|  unknown                                                 133   2e-33   Medicago truncatula
ref|XP_009137160.1|  PREDICTED: alpha carbonic anhydrase 4-like         132   2e-33   Brassica rapa
ref|XP_010510673.1|  PREDICTED: alpha carbonic anhydrase 2-like         132   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_008362138.1|  PREDICTED: bifunctional monodehydroascorbate...    132   2e-33   
gb|KFK43123.1|  hypothetical protein AALP_AA1G083400                    132   3e-33   Arabis alpina [alpine rockcress]
ref|XP_010530484.1|  PREDICTED: alpha carbonic anhydrase 7-like         130   3e-33   Tarenaya hassleriana [spider flower]
ref|XP_003535188.1|  PREDICTED: bifunctional monodehydroascorbate...    132   4e-33   Glycine max [soybeans]
ref|XP_011018803.1|  PREDICTED: alpha carbonic anhydrase 7-like         132   5e-33   Populus euphratica
ref|XP_004160914.1|  PREDICTED: bifunctional monodehydroascorbate...    131   5e-33   
gb|EMT00558.1|  Bifunctional monodehydroascorbate reductase and c...    132   5e-33   
ref|XP_010696308.1|  PREDICTED: alpha carbonic anhydrase 7-like         131   6e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011094588.1|  PREDICTED: alpha carbonic anhydrase 7-like         131   8e-33   Sesamum indicum [beniseed]
emb|CAM59682.1|  a-type carbonic anhydrase                              130   8e-33   Lotus japonicus
ref|XP_006304810.1|  hypothetical protein CARUB_v10012428mg             130   9e-33   
ref|XP_003574630.1|  PREDICTED: alpha carbonic anhydrase 7-like         130   1e-32   Brachypodium distachyon [annual false brome]
dbj|BAD09858.1|  putative dioscorin class A precursor                   130   1e-32   Oryza sativa Japonica Group [Japonica rice]
emb|CDX95097.1|  BnaC05g05740D                                          130   1e-32   
ref|XP_009148063.1|  PREDICTED: alpha carbonic anhydrase 5              130   2e-32   Brassica rapa
gb|KFK28694.1|  hypothetical protein AALP_AA7G034200                    129   2e-32   Arabis alpina [alpine rockcress]
dbj|BAK01826.1|  predicted protein                                      129   3e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009795833.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    128   3e-32   Nicotiana sylvestris
ref|XP_004139442.1|  PREDICTED: bifunctional monodehydroascorbate...    129   4e-32   Cucumis sativus [cucumbers]
ref|XP_008462491.1|  PREDICTED: bifunctional monodehydroascorbate...    129   4e-32   Cucumis melo [Oriental melon]
ref|XP_010475597.1|  PREDICTED: alpha carbonic anhydrase 5-like         129   4e-32   Camelina sativa [gold-of-pleasure]
ref|XP_002892432.1|  carbonate dehydratase/ zinc ion binding protein    129   5e-32   
dbj|BAK02152.1|  predicted protein                                      129   5e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004143278.1|  PREDICTED: bifunctional monodehydroascorbate...    129   5e-32   Cucumis sativus [cucumbers]
ref|XP_008464600.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    129   5e-32   
ref|XP_010267256.1|  PREDICTED: alpha carbonic anhydrase 7-like         129   5e-32   Nelumbo nucifera [Indian lotus]
gb|KDP29186.1|  hypothetical protein JCGZ_16575                         125   5e-32   Jatropha curcas
gb|KDP26093.1|  hypothetical protein JCGZ_21126                         129   6e-32   Jatropha curcas
ref|XP_010036662.1|  PREDICTED: alpha carbonic anhydrase 4-like i...    129   6e-32   Eucalyptus grandis [rose gum]
gb|AFK49331.1|  unknown                                                 127   6e-32   Lotus japonicus
ref|XP_006582742.1|  PREDICTED: bifunctional monodehydroascorbate...    128   6e-32   
ref|XP_006339092.1|  PREDICTED: bifunctional monodehydroascorbate...    128   7e-32   Solanum tuberosum [potatoes]
ref|XP_004515925.1|  PREDICTED: bifunctional monodehydroascorbate...    128   7e-32   Cicer arietinum [garbanzo]
ref|XP_010241820.1|  PREDICTED: alpha carbonic anhydrase 7-like         128   8e-32   Nelumbo nucifera [Indian lotus]
ref|XP_008462817.1|  PREDICTED: bifunctional monodehydroascorbate...    128   1e-31   Cucumis melo [Oriental melon]
gb|KCW47832.1|  hypothetical protein EUGRSUZ_K01571                     128   1e-31   Eucalyptus grandis [rose gum]
ref|XP_009767316.1|  PREDICTED: alpha carbonic anhydrase 7-like         128   1e-31   Nicotiana sylvestris
ref|XP_002528758.1|  carbonic anhydrase, putative                       128   1e-31   Ricinus communis
ref|XP_010036307.1|  PREDICTED: alpha carbonic anhydrase 4-like         128   1e-31   Eucalyptus grandis [rose gum]
ref|XP_006381381.1|  hypothetical protein POPTR_0006s12380g             127   1e-31   
emb|CAO98737.1|  dioscorin 4 precursor                                  127   1e-31   Dioscorea japonica [yama-no-imo]
emb|CDX76404.1|  BnaA08g09960D                                          127   1e-31   
emb|CDY27409.1|  BnaC03g64490D                                          127   1e-31   Brassica napus [oilseed rape]
ref|XP_008351630.1|  PREDICTED: bifunctional monodehydroascorbate...    127   1e-31   
ref|XP_006292541.1|  hypothetical protein CARUB_v10018775mg             127   2e-31   Capsella rubella
ref|XP_004249474.1|  PREDICTED: alpha carbonic anhydrase 7-like         127   2e-31   Solanum lycopersicum
gb|ACT36291.1|  dioscorin precursor                                     127   2e-31   Dioscorea japonica [yama-no-imo]
ref|XP_010098809.1|  hypothetical protein L484_022574                   127   2e-31   
gb|ACT36289.1|  dioscorin precursor                                     127   2e-31   Dioscorea japonica [yama-no-imo]
ref|XP_006413835.1|  hypothetical protein EUTSA_v10027157mg             127   2e-31   Eutrema salsugineum [saltwater cress]
ref|XP_006660200.1|  PREDICTED: bifunctional monodehydroascorbate...    128   2e-31   
emb|CAO98738.1|  dioscorin 5 precursor                                  127   2e-31   Dioscorea japonica [yama-no-imo]
ref|XP_002268233.1|  PREDICTED: alpha carbonic anhydrase 7              127   2e-31   Vitis vinifera
dbj|BAK03530.1|  predicted protein                                      127   2e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002529417.1|  carbonic anhydrase, putative                       127   2e-31   
gb|EYU38572.1|  hypothetical protein MIMGU_mgv1a011717mg                127   2e-31   Erythranthe guttata [common monkey flower]
ref|XP_009407045.1|  PREDICTED: alpha carbonic anhydrase 7-like         127   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008387558.1|  PREDICTED: bifunctional monodehydroascorbate...    127   2e-31   
emb|CDX76409.1|  BnaA08g09910D                                          127   2e-31   
ref|XP_010322405.1|  PREDICTED: bifunctional monodehydroascorbate...    127   2e-31   Solanum lycopersicum
ref|XP_008227274.1|  PREDICTED: bifunctional monodehydroascorbate...    127   3e-31   Prunus mume [ume]
emb|CAO98739.1|  dioscorin 6 precursor                                  127   3e-31   Dioscorea japonica [yama-no-imo]
ref|XP_010050537.1|  PREDICTED: alpha carbonic anhydrase 7-like         127   3e-31   Eucalyptus grandis [rose gum]
gb|KHN43087.1|  Bifunctional monodehydroascorbate reductase and c...    123   3e-31   Glycine soja [wild soybean]
dbj|BAJ99342.1|  predicted protein                                      127   3e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010434249.1|  PREDICTED: alpha carbonic anhydrase 4-like         126   3e-31   Camelina sativa [gold-of-pleasure]
emb|CBI33385.3|  unnamed protein product                                126   3e-31   Vitis vinifera
ref|XP_008364026.1|  PREDICTED: bifunctional monodehydroascorbate...    126   4e-31   
ref|XP_002278815.1|  PREDICTED: alpha carbonic anhydrase 4-like         126   4e-31   Vitis vinifera
ref|XP_008227264.1|  PREDICTED: bifunctional monodehydroascorbate...    126   4e-31   Prunus mume [ume]
ref|XP_003520661.2|  PREDICTED: bifunctional monodehydroascorbate...    126   4e-31   
gb|ACT36293.1|  dioscorin precursor                                     126   4e-31   Dioscorea japonica [yama-no-imo]
ref|XP_010458030.1|  PREDICTED: alpha carbonic anhydrase 5              126   4e-31   Camelina sativa [gold-of-pleasure]
ref|XP_009768444.1|  PREDICTED: alpha carbonic anhydrase 7-like         122   5e-31   Nicotiana sylvestris
gb|ACT36292.1|  dioscorin precursor                                     126   5e-31   Dioscorea japonica [yama-no-imo]
dbj|BAD18021.1|  tuber storage protein                                  126   6e-31   Dioscorea polystachya [Chinese yam]
gb|EMT14740.1|  Bifunctional monodehydroascorbate reductase and c...    126   6e-31   
ref|XP_007213463.1|  hypothetical protein PRUPE_ppa024299mg             126   6e-31   Prunus persica
emb|CDX84811.1|  BnaA03g14190D                                          125   6e-31   
ref|XP_009775004.1|  PREDICTED: alpha carbonic anhydrase 7-like         125   8e-31   Nicotiana sylvestris
ref|XP_008360674.1|  PREDICTED: bifunctional monodehydroascorbate...    125   8e-31   
gb|KJB35974.1|  hypothetical protein B456_006G135100                    125   8e-31   Gossypium raimondii
ref|XP_011048097.1|  PREDICTED: alpha carbonic anhydrase 4-like         125   9e-31   Populus euphratica
ref|XP_010904591.1|  PREDICTED: alpha carbonic anhydrase 7-like         126   9e-31   
ref|XP_003553396.1|  PREDICTED: bifunctional monodehydroascorbate...    125   9e-31   Glycine max [soybeans]
ref|XP_008241447.1|  PREDICTED: bifunctional monodehydroascorbate...    125   9e-31   
gb|EMT11024.1|  Bifunctional monodehydroascorbate reductase and c...    125   9e-31   
ref|XP_006489872.1|  PREDICTED: bifunctional monodehydroascorbate...    125   1e-30   Citrus sinensis [apfelsine]
ref|NP_193831.1|  alpha carbonic anhydrase 4                            125   1e-30   Arabidopsis thaliana [mouse-ear cress]
gb|ACT36290.1|  dioscorin precursor                                     125   1e-30   Dioscorea japonica [yama-no-imo]
ref|XP_002519458.1|  carbonic anhydrase, putative                       125   1e-30   Ricinus communis
dbj|BAC99799.1|  putative dioscorin                                     125   1e-30   Oryza sativa Japonica Group [Japonica rice]
gb|KHN11228.1|  Bifunctional monodehydroascorbate reductase and c...    125   2e-30   Glycine soja [wild soybean]
emb|CDY56563.1|  BnaCnng30610D                                          124   2e-30   Brassica napus [oilseed rape]
gb|ABK22387.1|  unknown                                                 125   2e-30   Picea sitchensis
ref|XP_009363226.1|  PREDICTED: alpha carbonic anhydrase 4-like         125   2e-30   Pyrus x bretschneideri [bai li]
gb|KCW89335.1|  hypothetical protein EUGRSUZ_A01626                     124   2e-30   Eucalyptus grandis [rose gum]
gb|EAZ07037.1|  hypothetical protein OsI_29284                          125   2e-30   Oryza sativa Indica Group [Indian rice]
gb|KGN59000.1|  hypothetical protein Csa_3G742880                       125   2e-30   Cucumis sativus [cucumbers]
ref|XP_004168624.1|  PREDICTED: bifunctional monodehydroascorbate...    125   2e-30   
gb|KDO48229.1|  hypothetical protein CISIN_1g025618mg                   124   2e-30   Citrus sinensis [apfelsine]
ref|XP_010050504.1|  PREDICTED: alpha carbonic anhydrase 7-like         125   2e-30   Eucalyptus grandis [rose gum]
ref|XP_002869915.1|  carbonic anhydrase family protein                  124   2e-30   
ref|XP_006421163.1|  hypothetical protein CICLE_v10005610mg             124   2e-30   Citrus clementina [clementine]
ref|XP_010451325.1|  PREDICTED: alpha carbonic anhydrase 4-like         124   2e-30   
gb|AEN14505.1|  dioscorin A3                                            123   3e-30   Dioscorea alata [greater yam]
emb|CDP14170.1|  unnamed protein product                                124   4e-30   Coffea canephora [robusta coffee]
ref|XP_007028635.1|  Alpha carbonic anhydrase 4, putative               124   4e-30   
gb|AAF63334.1|AF245019_1  dioscorin A                                   124   5e-30   Dioscorea alata [greater yam]
ref|XP_011048125.1|  PREDICTED: alpha carbonic anhydrase 4-like         124   5e-30   Populus euphratica
ref|XP_004137981.1|  PREDICTED: bifunctional monodehydroascorbate...    125   5e-30   
ref|XP_009622096.1|  PREDICTED: alpha carbonic anhydrase 7-like         123   6e-30   Nicotiana tomentosiformis
ref|XP_006845943.1|  hypothetical protein AMTR_s00157p00085110          123   6e-30   
ref|XP_002308927.2|  hypothetical protein POPTR_0006s04600g             123   6e-30   Populus trichocarpa [western balsam poplar]
emb|CDP15287.1|  unnamed protein product                                124   6e-30   Coffea canephora [robusta coffee]
ref|XP_009762364.1|  PREDICTED: uncharacterized protein LOC104214403    123   7e-30   Nicotiana sylvestris
emb|CAO98736.1|  dioscorin 3 precursor                                  123   8e-30   Dioscorea japonica [yama-no-imo]
ref|XP_011015725.1|  PREDICTED: alpha carbonic anhydrase 4-like         124   8e-30   Populus euphratica
ref|XP_009802475.1|  PREDICTED: uncharacterized protein LOC104248002    122   8e-30   Nicotiana sylvestris
emb|CAN60024.1|  hypothetical protein VITISV_006907                     122   8e-30   
ref|NP_172285.2|  alpha carbonic anhydrase 5                            123   8e-30   
ref|XP_010312400.1|  PREDICTED: alpha carbonic anhydrase 4              121   9e-30   
ref|XP_010439535.1|  PREDICTED: alpha carbonic anhydrase 4              122   9e-30   
gb|AAF60191.1|AF242551_1  dioscorin A                                   122   1e-29   
ref|XP_010050530.1|  PREDICTED: alpha carbonic anhydrase 7-like         123   1e-29   
gb|KHN14952.1|  Bifunctional monodehydroascorbate reductase and c...    122   1e-29   
gb|KJB62358.1|  hypothetical protein B456_009G413500                    121   1e-29   
ref|XP_010488317.1|  PREDICTED: alpha carbonic anhydrase 5              122   1e-29   
ref|XP_010279581.1|  PREDICTED: alpha carbonic anhydrase 4-like         122   1e-29   
emb|CAA53781.1|  storage protein                                        122   1e-29   
ref|XP_009592985.1|  PREDICTED: alpha carbonic anhydrase 7-like         122   1e-29   
ref|XP_011015541.1|  PREDICTED: alpha carbonic anhydrase 4-like         122   2e-29   
ref|XP_004303634.1|  PREDICTED: alpha carbonic anhydrase 4-like         122   2e-29   
gb|KJB16757.1|  hypothetical protein B456_002G246000                    123   2e-29   
gb|ACN85275.1|  unknown                                                 122   2e-29   
pir||S57767  dioscorin class B - Dioscorea cayenensis (fragment)        121   2e-29
ref|XP_010911217.1|  PREDICTED: alpha carbonic anhydrase 8-like         118   2e-29   
gb|AFW61791.1|  hypothetical protein ZEAMMB73_990747                    121   2e-29   
gb|ABO36620.1|  eukaryotic-type carbonic anhydrase family protein       121   2e-29   
ref|XP_010696307.1|  PREDICTED: alpha carbonic anhydrase 7-like         122   2e-29   
ref|XP_006284932.1|  hypothetical protein CARUB_v10006231mg             121   2e-29   
ref|XP_006845945.1|  hypothetical protein AMTR_s00157p00088030          121   2e-29   
ref|XP_011033188.1|  PREDICTED: alpha carbonic anhydrase 4-like         122   3e-29   
ref|XP_010036660.1|  PREDICTED: alpha carbonic anhydrase 4-like         121   3e-29   
gb|KJB62359.1|  hypothetical protein B456_009G413500                    121   3e-29   
gb|KHG29611.1|  Bifunctional monodehydroascorbate reductase and c...    121   3e-29   
ref|XP_006351243.1|  PREDICTED: bifunctional monodehydroascorbate...    120   5e-29   
ref|XP_007203913.1|  hypothetical protein PRUPE_ppa016859mg             122   5e-29   
ref|XP_004973744.1|  PREDICTED: bifunctional monodehydroascorbate...    121   5e-29   
ref|XP_009358738.1|  PREDICTED: alpha carbonic anhydrase 4-like         122   5e-29   
ref|XP_004149223.1|  PREDICTED: bifunctional monodehydroascorbate...    120   6e-29   
gb|EMS63766.1|  hypothetical protein TRIUR3_00235                       117   6e-29   
ref|XP_004161225.1|  PREDICTED: bifunctional monodehydroascorbate...    120   6e-29   
ref|XP_011075611.1|  PREDICTED: alpha carbonic anhydrase 7-like         120   6e-29   
ref|XP_010555357.1|  PREDICTED: alpha carbonic anhydrase 4              120   7e-29   
ref|XP_008442725.1|  PREDICTED: bifunctional monodehydroascorbate...    120   8e-29   
gb|AAF79837.1|AC026875_17  T6D22.16                                     120   9e-29   
ref|XP_008241384.1|  PREDICTED: bifunctional monodehydroascorbate...    120   9e-29   
ref|XP_006417731.1|  hypothetical protein EUTSA_v10009315mg             119   1e-28   
ref|XP_003520509.1|  PREDICTED: bifunctional monodehydroascorbate...    119   1e-28   
ref|XP_008241448.1|  PREDICTED: bifunctional monodehydroascorbate...    120   1e-28   
gb|ACN85335.1|  unknown                                                 119   2e-28   
ref|XP_010036672.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    119   2e-28   
ref|XP_002323272.2|  hypothetical protein POPTR_0016s04300g             119   2e-28   
ref|XP_006294831.1|  hypothetical protein CARUB_v10023883mg             119   2e-28   
ref|XP_011075357.1|  PREDICTED: alpha carbonic anhydrase 4-like         119   2e-28   
ref|XP_002323427.2|  hypothetical protein POPTR_0016s08050g             119   2e-28   
ref|NP_001061831.1|  Os08g0423500                                       119   2e-28   
ref|NP_001047030.1|  Os02g0533300                                       119   2e-28   
ref|XP_010646590.1|  PREDICTED: alpha carbonic anhydrase 4 isofor...    119   2e-28   
ref|XP_002278828.1|  PREDICTED: alpha carbonic anhydrase 4 isofor...    119   2e-28   
ref|XP_007028632.1|  Carbonic anhydrase, putative                       119   2e-28   
ref|XP_007202419.1|  hypothetical protein PRUPE_ppa009714mg             119   2e-28   
ref|XP_010101554.1|  hypothetical protein L484_015378                   119   3e-28   
ref|XP_008383977.1|  PREDICTED: bifunctional monodehydroascorbate...    120   3e-28   
ref|XP_008244285.1|  PREDICTED: bifunctional monodehydroascorbate...    119   3e-28   
ref|XP_011075358.1|  PREDICTED: alpha carbonic anhydrase 7-like         119   3e-28   
ref|XP_004300792.1|  PREDICTED: alpha carbonic anhydrase 7-like         119   3e-28   
ref|XP_007027757.1|  Alpha carbonic anhydrase 1, putative               118   3e-28   
gb|EMT08879.1|  Bifunctional monodehydroascorbate reductase and c...    116   3e-28   
ref|XP_004954966.1|  PREDICTED: bifunctional monodehydroascorbate...    118   4e-28   
ref|XP_008784028.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    119   4e-28   
gb|AAK96658.1|  carbonic anhydrase (CAH1)                               116   4e-28   
ref|XP_006660137.1|  PREDICTED: bifunctional monodehydroascorbate...    118   4e-28   
ref|XP_007027463.1|  Alpha carbonic anhydrase 7 isoform 1               118   4e-28   
emb|CAB45894.1|  carbonic anhydrase-like protein                        115   5e-28   
ref|XP_010918699.1|  PREDICTED: alpha carbonic anhydrase 7-like         117   7e-28   
emb|CDY70224.1|  BnaCnng67290D                                          114   7e-28   
emb|CDX98682.1|  BnaA03g44670D                                          114   8e-28   
gb|EYU38639.1|  hypothetical protein MIMGU_mgv1a011347mg                117   9e-28   
ref|XP_011004239.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    117   9e-28   
gb|EYU18694.1|  hypothetical protein MIMGU_mgv11b010420mg               117   9e-28   
emb|CDY65169.1|  BnaC05g49130D                                          117   1e-27   
gb|ACT36288.1|  dioscorin precursor                                     117   1e-27   
ref|XP_011004112.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    117   1e-27   
ref|XP_002877879.1|  carbonic anhydrase family protein                  117   1e-27   
ref|XP_010931134.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    117   1e-27   
ref|XP_010036663.1|  PREDICTED: alpha carbonic anhydrase 4-like i...    117   1e-27   
dbj|BAD18020.1|  tuber storage protein                                  117   1e-27   
ref|XP_010109502.1|  hypothetical protein L484_007522                   117   2e-27   
gb|EYU18692.1|  hypothetical protein MIMGU_mgv1a011638mg                117   2e-27   
emb|CDP15426.1|  unnamed protein product                                117   2e-27   
ref|XP_007204039.1|  hypothetical protein PRUPE_ppa021069mg             116   2e-27   
ref|XP_006301790.1|  hypothetical protein CARUB_v10022254mg             116   2e-27   
gb|KEH24050.1|  eukaryotic-type carbonic anhydrase                      116   2e-27   
gb|KHN46012.1|  Bifunctional monodehydroascorbate reductase and c...    116   3e-27   
ref|NP_001175588.1|  Os08g0424100                                       116   3e-27   
ref|XP_008443579.1|  PREDICTED: bifunctional monodehydroascorbate...    116   3e-27   
ref|XP_010912301.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    116   3e-27   
ref|XP_008442846.1|  PREDICTED: bifunctional monodehydroascorbate...    116   3e-27   
gb|KHN10833.1|  Bifunctional monodehydroascorbate reductase and c...    115   3e-27   
gb|KHG05281.1|  Bifunctional monodehydroascorbate reductase and c...    116   3e-27   
ref|XP_002309427.2|  hypothetical protein POPTR_0006s22940g             115   3e-27   
ref|XP_010269790.1|  PREDICTED: alpha carbonic anhydrase 4-like         116   3e-27   
ref|XP_010912303.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    116   3e-27   
gb|EAZ07038.1|  hypothetical protein OsI_29285                          115   4e-27   
dbj|BAH20029.1|  AT3G52720                                              115   4e-27   
gb|ACN85320.1|  unknown                                                 116   4e-27   
ref|XP_004494904.1|  PREDICTED: bifunctional monodehydroascorbate...    115   4e-27   
emb|CAO98735.1|  dioscorin 2 precursor                                  115   4e-27   
gb|KCW47834.1|  hypothetical protein EUGRSUZ_K01571                     115   4e-27   
ref|XP_008442726.1|  PREDICTED: bifunctional monodehydroascorbate...    115   5e-27   
ref|XP_010090219.1|  hypothetical protein L484_016558                   115   5e-27   
ref|XP_011077861.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    115   5e-27   
ref|NP_566971.2|  alpha carbonic anhydrase 1                            115   5e-27   
ref|XP_010050514.1|  PREDICTED: alpha carbonic anhydrase 7-like         115   5e-27   
ref|XP_006577712.1|  PREDICTED: bifunctional monodehydroascorbate...    115   6e-27   
ref|XP_010262876.1|  PREDICTED: alpha carbonic anhydrase 7-like         115   6e-27   
gb|KHN18685.1|  Bifunctional monodehydroascorbate reductase and c...    115   6e-27   
ref|XP_006403779.1|  hypothetical protein EUTSA_v10010611mg             115   6e-27   
ref|XP_004493459.1|  PREDICTED: bifunctional monodehydroascorbate...    115   7e-27   
ref|XP_004493458.1|  PREDICTED: bifunctional monodehydroascorbate...    115   7e-27   
ref|NP_001242755.1|  uncharacterized protein LOC100797401 precursor     115   7e-27   
gb|ACN85304.1|  unknown                                                 115   7e-27   
ref|XP_009377055.1|  PREDICTED: alpha carbonic anhydrase 4-like         116   8e-27   
ref|XP_010683725.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    114   8e-27   
emb|CAO98734.1|  dioscorin 1 precursor                                  115   8e-27   
ref|XP_006286119.1|  hypothetical protein CARUB_v10007668mg             114   9e-27   
ref|XP_002532664.1|  carbonic anhydrase, putative                       114   9e-27   
ref|XP_007144395.1|  hypothetical protein PHAVU_007G152600g             114   1e-26   
gb|KEH42020.1|  eukaryotic-type carbonic anhydrase                      114   1e-26   
gb|AAF44711.1|AF243526_1  dioscorin B                                   114   1e-26   
ref|XP_010504017.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    114   1e-26   
gb|KEH42021.1|  eukaryotic-type carbonic anhydrase                      114   1e-26   
ref|XP_009389630.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    114   1e-26   
gb|KEH42022.1|  eukaryotic-type carbonic anhydrase                      114   1e-26   
ref|XP_008442729.1|  PREDICTED: bifunctional monodehydroascorbate...    115   1e-26   
gb|EYU20767.1|  hypothetical protein MIMGU_mgv1a019017mg                113   2e-26   
gb|EEE68706.1|  hypothetical protein OsJ_27361                          114   2e-26   
ref|XP_006604587.1|  PREDICTED: bifunctional monodehydroascorbate...    114   2e-26   
ref|XP_006291539.1|  hypothetical protein CARUB_v10017694mg             114   2e-26   
ref|XP_009770757.1|  PREDICTED: alpha carbonic anhydrase 4-like         113   2e-26   
ref|XP_004142716.1|  PREDICTED: bifunctional monodehydroascorbate...    114   2e-26   
ref|XP_009115968.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    114   3e-26   
ref|XP_002308928.2|  hypothetical protein POPTR_0006s04610g             114   3e-26   
dbj|BAK00887.1|  predicted protein                                      113   3e-26   
emb|CDX78118.1|  BnaA09g33130D                                          114   3e-26   
ref|XP_002880942.1|  hypothetical protein ARALYDRAFT_320571             112   3e-26   
gb|EPS62533.1|  hypothetical protein M569_12260                         112   4e-26   
gb|KJB16758.1|  hypothetical protein B456_002G246100                    113   4e-26   
ref|XP_004172039.1|  PREDICTED: bifunctional monodehydroascorbate...    112   4e-26   
gb|KHG14539.1|  Bifunctional monodehydroascorbate reductase and c...    113   4e-26   
emb|CDX73611.1|  BnaC08g23920D                                          113   4e-26   
ref|XP_004304476.1|  PREDICTED: alpha carbonic anhydrase 7-like         113   4e-26   
ref|XP_010050524.1|  PREDICTED: alpha carbonic anhydrase 7-like         113   4e-26   
gb|EYU18693.1|  hypothetical protein MIMGU_mgv1a011955mg                112   5e-26   
ref|XP_010426891.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    113   5e-26   
gb|KGN58999.1|  hypothetical protein Csa_3G742870                       112   6e-26   
ref|XP_010515745.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    113   6e-26   
ref|XP_007028639.1|  Carbonic anhydrase, putative                       112   6e-26   
ref|XP_004168623.1|  PREDICTED: bifunctional monodehydroascorbate...    112   6e-26   
emb|CDP14169.1|  unnamed protein product                                112   7e-26   
gb|KDP37303.1|  hypothetical protein JCGZ_06757                         112   9e-26   
ref|XP_009390032.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    112   9e-26   
ref|XP_008784764.1|  PREDICTED: alpha carbonic anhydrase 7-like         112   9e-26   
ref|XP_010423620.1|  PREDICTED: alpha carbonic anhydrase 3              112   9e-26   
ref|XP_007202870.1|  hypothetical protein PRUPE_ppa015691mg             111   1e-25   
ref|XP_007162791.1|  hypothetical protein PHAVU_001G180900g             111   1e-25   
ref|XP_009125546.1|  PREDICTED: alpha carbonic anhydrase 3-like i...    111   1e-25   
gb|EPS73716.1|  hypothetical protein M569_01041                         110   1e-25   
ref|XP_009125547.1|  PREDICTED: alpha carbonic anhydrase 3-like i...    111   1e-25   
ref|XP_009796023.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    111   1e-25   
ref|XP_011468689.1|  PREDICTED: alpha carbonic anhydrase 7-like         111   1e-25   
gb|EMT13869.1|  Bifunctional monodehydroascorbate reductase and c...    111   2e-25   
gb|KEH42018.1|  eukaryotic-type carbonic anhydrase                      109   2e-25   
ref|XP_007162157.1|  hypothetical protein PHAVU_001G129100g             110   2e-25   
ref|XP_011468146.1|  PREDICTED: alpha carbonic anhydrase 7-like         111   2e-25   
ref|XP_003560592.1|  PREDICTED: alpha carbonic anhydrase 7-like         111   3e-25   
ref|XP_009599195.1|  PREDICTED: alpha carbonic anhydrase 4-like i...    110   3e-25   
ref|XP_008810945.1|  PREDICTED: alpha carbonic anhydrase 7-like i...    111   3e-25   
gb|ACN85281.1|  unknown                                                 111   3e-25   
ref|XP_006843475.1|  hypothetical protein AMTR_s00053p00197030          110   3e-25   
ref|XP_006403777.1|  hypothetical protein EUTSA_v10010611mg             110   3e-25   
ref|XP_010490921.1|  PREDICTED: alpha carbonic anhydrase 3-like         110   4e-25   
ref|XP_002446414.1|  hypothetical protein SORBIDRAFT_06g015600          110   4e-25   
ref|XP_009413153.1|  PREDICTED: alpha carbonic anhydrase 7-like         110   4e-25   
ref|XP_008810944.1|  PREDICTED: alpha carbonic anhydrase 7-like i...    110   4e-25   
ref|XP_007203398.1|  hypothetical protein PRUPE_ppa021144mg             109   4e-25   
ref|XP_010449136.1|  PREDICTED: alpha carbonic anhydrase 4-like         110   4e-25   
ref|XP_006430188.1|  hypothetical protein CICLE_v10013720mg             110   5e-25   
ref|XP_004975564.1|  PREDICTED: bifunctional monodehydroascorbate...    110   5e-25   
ref|XP_010527573.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    110   6e-25   
ref|XP_011094325.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    109   6e-25   
ref|XP_009606839.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    109   8e-25   
ref|XP_002978389.1|  hypothetical protein SELMODRAFT_108874             108   9e-25   
ref|XP_006481762.1|  PREDICTED: bifunctional monodehydroascorbate...    109   1e-24   
ref|XP_003579701.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    109   1e-24   
ref|XP_010239880.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    109   1e-24   
ref|XP_008243568.1|  PREDICTED: bifunctional monodehydroascorbate...    108   1e-24   
emb|CAM59683.1|  a-type carbonic anhydrase                              108   1e-24   
ref|XP_006354411.1|  PREDICTED: bifunctional monodehydroascorbate...    109   1e-24   
ref|XP_010439534.1|  PREDICTED: alpha carbonic anhydrase 4-like         108   1e-24   
ref|XP_006286833.1|  hypothetical protein CARUB_v10003788mg             108   1e-24   
ref|XP_011044414.1|  PREDICTED: LOW QUALITY PROTEIN: alpha carbon...    108   2e-24   
gb|KDP37301.1|  hypothetical protein JCGZ_06755                         108   2e-24   
ref|XP_009374764.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    108   2e-24   
ref|XP_004494036.1|  PREDICTED: bifunctional monodehydroascorbate...    108   2e-24   
ref|XP_002873139.1|  carbonic anhydrase family protein                  108   2e-24   
ref|XP_002532665.1|  carbonic anhydrase, putative                       108   2e-24   
ref|XP_006341109.1|  PREDICTED: bifunctional monodehydroascorbate...    108   2e-24   
ref|XP_007150181.1|  hypothetical protein PHAVU_005G133400g             108   2e-24   
ref|XP_010090214.1|  hypothetical protein L484_016553                   108   2e-24   
gb|KGN59002.1|  hypothetical protein Csa_3G743390                       108   2e-24   
ref|XP_009358737.1|  PREDICTED: alpha carbonic anhydrase 7-like         108   3e-24   
ref|XP_006845948.1|  hypothetical protein AMTR_s00157p00093970          104   3e-24   
ref|XP_010325903.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    107   3e-24   
gb|EAZ07308.1|  hypothetical protein OsI_29555                          105   3e-24   
ref|XP_008383978.1|  PREDICTED: bifunctional monodehydroascorbate...    108   3e-24   
emb|CDY61773.1|  BnaAnng17740D                                          112   4e-24   
ref|XP_002980639.1|  hypothetical protein SELMODRAFT_420338             107   5e-24   
ref|XP_006398874.1|  hypothetical protein EUTSA_v10014397mg             107   5e-24   
ref|XP_009599194.1|  PREDICTED: alpha carbonic anhydrase 4-like i...    107   5e-24   
ref|XP_009379811.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    107   5e-24   
ref|NP_196038.1|  alpha carbonic anhydrase 3                            107   7e-24   
gb|ABK28680.1|  unknown                                                 107   7e-24   
ref|XP_010245039.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    106   8e-24   
ref|XP_004154197.1|  PREDICTED: bifunctional monodehydroascorbate...    103   8e-24   
ref|XP_006647342.1|  PREDICTED: bifunctional monodehydroascorbate...    106   9e-24   
ref|XP_011468148.1|  PREDICTED: alpha carbonic anhydrase 7-like         106   1e-23   
ref|XP_010520706.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    106   1e-23   



>ref|XP_009595413.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Nicotiana tomentosiformis]
Length=269

 Score =   173 bits (438),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 106/135 (79%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R++ EAHLVH S+DG+ AV+ +MY+IG  P+  LS+IE DLK LA T G+++ I
Sbjct  129  HTINGKRFNLEAHLVHESDDGKTAVIGIMYKIGR-PDFFLSMIEKDLKALANTKGIERAI  187

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DPNL++  G++YYRY+GSLT PPCTE VVWT+ R ++++TK+Q+ LIR A+HDES+T
Sbjct  188  GTIDPNLIKMDGKKYYRYIGSLTVPPCTEDVVWTIDRKVKTITKRQMKLIREAVHDESET  247

Query  362  NARPLQTINDRFVKV  318
            NARP Q +N R +K 
Sbjct  248  NARPAQPVNRRPIKF  262



>ref|XP_009782909.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Nicotiana sylvestris]
Length=270

 Score =   171 bits (432),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 104/135 (77%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R++ EAHLVH S+DG+ AV+ +MY+IG  P+  LS+IE DLK LA T GV++ I
Sbjct  130  HTINGKRFNLEAHLVHESDDGKTAVIGIMYKIGR-PDSFLSMIEKDLKALASTKGVERAI  188

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP L++  G+ YYRY+GSLT PPCTE VVWT+ R ++++TK+Q+ LIR A+HDES+T
Sbjct  189  GTIDPKLIKMDGKTYYRYIGSLTVPPCTEDVVWTIDRKVKTITKRQMKLIREAVHDESET  248

Query  362  NARPLQTINDRFVKV  318
            NARP Q +N R +K 
Sbjct  249  NARPAQPVNRRPIKF  263



>ref|XP_009776976.1| PREDICTED: alpha carbonic anhydrase 7-like [Nicotiana sylvestris]
Length=198

 Score =   168 bits (426),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 104/135 (77%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+D E HLVH SNDG+ AV+ +MY+IG   +  LS+IEDDLK LA T GV++ I
Sbjct  57   HTINGRRFDLEVHLVHESNDGKTAVVGIMYKIGRA-DFFLSMIEDDLKALAHTKGVERNI  115

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPCT+ VVWT++R +R+VT++Q+ LIR A+HDES+T
Sbjct  116  GVIDPKQVKLGSRKYYRYIGSLTVPPCTQDVVWTIVRKVRTVTREQMKLIREAVHDESET  175

Query  362  NARPLQTINDRFVKV  318
            N+RP+Q  N R +++
Sbjct  176  NSRPVQATNKRSIRL  190



>ref|XP_009776894.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3, partial [Nicotiana sylvestris]
Length=260

 Score =   167 bits (423),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+D E HLVH SNDG+ AV+ +MY+IG   +  LS+IEDDLK LA T GV++ I
Sbjct  132  HTINGRRFDLEVHLVHESNDGKTAVVGIMYKIGRA-DSFLSMIEDDLKALAHTKGVERNI  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPCT+ VVWT++R +R+VT++Q+ LIR A+HDES+T
Sbjct  191  GVIDPKQVKLGSRKYYRYIGSLTVPPCTQDVVWTIVRKVRTVTREQMKLIREAVHDESET  250

Query  362  NARPLQTIN  336
            N+RP+Q  N
Sbjct  251  NSRPVQAAN  259



>ref|XP_009621603.1| PREDICTED: alpha carbonic anhydrase 7 [Nicotiana tomentosiformis]
Length=273

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 103/135 (76%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+D E HLVH SNDG+ AV+ +MY+IG   +  LS IEDDLK LA T GV++ I
Sbjct  132  HTINGKRFDLEVHLVHESNDGKTAVVGIMYKIGRA-DSFLSKIEDDLKALAHTKGVERNI  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPCT+ VVWT++R +R+VT++Q+ LIR A+HDES+T
Sbjct  191  GIIDPKQVKLGSRKYYRYIGSLTVPPCTQDVVWTIVRKVRTVTREQMKLIREAVHDESET  250

Query  362  NARPLQTINDRFVKV  318
            N+RP+Q  N R +++
Sbjct  251  NSRPVQAANKRPIRL  265



>ref|XP_006340169.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=275

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 102/135 (76%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+D E HLVH S DG+ AV+ +MY+IG   +P LS+IE DLK LA T  V++ I
Sbjct  134  HTINGRRFDLEVHLVHESEDGKTAVVGIMYKIGRA-DPFLSMIESDLKALAHTKNVERNI  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPCT+ VVWT++R +R+VTK+Q+ LIR A+HDES+T
Sbjct  193  GVIDPKKVKLGSRKYYRYIGSLTVPPCTQDVVWTIVRKVRTVTKEQMKLIREAVHDESET  252

Query  362  NARPLQTINDRFVKV  318
            N+RP+Q  N R +++
Sbjct  253  NSRPVQATNKRTIRL  267



>ref|XP_006340168.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=275

 Score =   166 bits (419),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 102/135 (76%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+D E HLVH S DG+ AV+ +MY+IG   +P L++IE DLK LA T  V++ I
Sbjct  134  HTINGRRFDLEVHLVHESEDGKTAVVGIMYKIGRA-DPFLTMIESDLKALAHTKNVERNI  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPCT+ VVWT++R +R+VTK+Q+ LIR A+HDES+T
Sbjct  193  GVIDPKKVKLGSRKYYRYIGSLTVPPCTQDVVWTIVRKVRTVTKEQMKLIREAVHDESET  252

Query  362  NARPLQTINDRFVKV  318
            N+RP+Q  N R +++
Sbjct  253  NSRPVQATNKRTIRL  267



>sp|Q84UV8.1|NEC3_NICLS RecName: Full=Bifunctional monodehydroascorbate reductase and 
carbonic anhydrase nectarin-3; AltName: Full=Nectarin-III; 
Contains: RecName: Full=Nectarin-2; Flags: Precursor [Nicotiana 
langsdorffii x Nicotiana sanderae]
 gb|AAO85482.1| nectarin III [Nicotiana langsdorffii x Nicotiana sanderae]
Length=274

 Score =   165 bits (418),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R++ EAHLVH SN+G+  V+ ++Y+IG  P+P LS+IE+DLK  A   G+++GI
Sbjct  129  HTINGERFNLEAHLVHESNNGKFVVIGIVYEIGLWPDPFLSMIENDLKVPANKKGIERGI  188

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DPN ++  G++Y+RY+GSLTTPPCTEGVVW + R +++VT++Q+ L++ A+HD  +T
Sbjct  189  GIIDPNQIKLDGKKYFRYIGSLTTPPCTEGVVWIIDRKVKTVTRRQIKLLQEAVHDGFET  248

Query  362  NARPLQTINDRFV  324
            NARP Q  N+R++
Sbjct  249  NARPTQPENERYI  261



>ref|XP_004251153.1| PREDICTED: alpha carbonic anhydrase 7 [Solanum lycopersicum]
Length=276

 Score =   163 bits (412),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 101/135 (75%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+D E HLVH S DG+ AV+ +MY+IG   +  LS+IE DLK LA T  V++ I
Sbjct  135  HTINGRRFDLEVHLVHESEDGKTAVVGIMYKIGRA-DSFLSMIESDLKALAHTKNVERKI  193

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPCT+ VVWT++R +R+VTK+Q+ LIR A+HDES+T
Sbjct  194  GIIDPKKVKLGSRKYYRYIGSLTVPPCTQDVVWTIVRKVRTVTKEQMKLIREAVHDESET  253

Query  362  NARPLQTINDRFVKV  318
            N+RP+Q  N R +++
Sbjct  254  NSRPVQATNKRTIRL  268



>ref|XP_011090098.1| PREDICTED: alpha carbonic anhydrase 7 [Sesamum indicum]
Length=271

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 106/135 (79%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H ++G R+D E HLVH S+D RIAV+ +MY+IG  P+  LS+++ +LK +AE   V+K I
Sbjct  131  HTISGRRFDMEVHLVHQSDDNRIAVIGIMYKIGR-PDSFLSMMKRNLKAVAEMRDVEKTI  189

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP L++   R+YYRY+GSLTTPPCT+ V+WT++R +R+VT++QV LIR+ +HD+S+ 
Sbjct  190  GIIDPKLIKLGSRKYYRYIGSLTTPPCTQNVIWTIVRKVRTVTREQVELIRDVVHDDSEA  249

Query  362  NARPLQTINDRFVKV  318
            NARP+Q +++R V++
Sbjct  250  NARPIQPVHERLVEL  264



>emb|CDP11563.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 102/135 (76%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RYD EAHLVH S DG+IAV+ ++Y+IG  P+P LS++E  L+ LA+T   ++ +
Sbjct  132  HAINGERYDLEAHLVHQSPDGKIAVIGILYKIGR-PDPFLSMLEHYLEALADTLEEEEVV  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G++DPN +    + YYRY GSLTTPPCTE V+WT++  + +V++ QV LIRNA+HD SK 
Sbjct  191  GFVDPNQITFGSKGYYRYSGSLTTPPCTEDVLWTIVDKVGTVSRHQVKLIRNAVHDGSKM  250

Query  362  NARPLQTINDRFVKV  318
            NARPLQ INDR +++
Sbjct  251  NARPLQPINDRPIRL  265



>gb|KJB83847.1| hypothetical protein B456_013G267400 [Gossypium raimondii]
Length=274

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 102/135 (76%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+D EAHLVH   DG+IAV+ +MY+IG  P+P L  +E+DL  + +T   ++ +
Sbjct  133  HTINGRRFDLEAHLVHEGADGKIAVIGIMYKIGR-PDPFLLSLEEDLTAITDTTEAERAV  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G ++P  ++   R+YYRY+GSLT PPCTE VVW+ ++ +R+VT++QV L+R A+HD+S T
Sbjct  192  GVMNPRGIKFGSRKYYRYIGSLTAPPCTENVVWSFVQKVRTVTREQVRLLRVAVHDDSDT  251

Query  362  NARPLQTINDRFVKV  318
            NARPLQ IN+R++++
Sbjct  252  NARPLQPINERWIQL  266



>ref|XP_011090042.1| PREDICTED: alpha carbonic anhydrase 7-like [Sesamum indicum]
Length=274

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 100/131 (76%), Gaps = 1/131 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+D E HLVH S+D R AV+ +MY+IG  P+  LS+++ D + + ET  V++ +
Sbjct  133  HTINGKRFDMETHLVHESDDKRTAVIGIMYKIGR-PDAFLSMLKRDFEAIVETRDVERTV  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G ++P L++   R+YYRYMGSLT PPCT+ ++WT+++ +R+VT++QV LIR A+HDES+ 
Sbjct  192  GVVNPKLVELGSRKYYRYMGSLTVPPCTQDIIWTMVKKVRTVTREQVELIREAVHDESEM  251

Query  362  NARPLQTINDR  330
            NARP+Q +N+R
Sbjct  252  NARPIQPMNER  262



>emb|CDP07086.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 105/135 (78%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RYD EAHLVH + +GRIAV+ ++Y+IG + +  LS++E+ LK LA+T  ++K +
Sbjct  132  HSINGKRYDLEAHLVHEALNGRIAVIGIIYEIGRS-DSFLSMMENKLKALADTRDLEKVV  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPCT+ VVWT+++ +R+VT+ QV +IR A+HDES+ 
Sbjct  191  GVIDPKQIKLGSRKYYRYIGSLTIPPCTQNVVWTIVKKVRTVTRDQVKMIREAVHDESEA  250

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +++R +++
Sbjct  251  NARPLQPLHNRPIRM  265



>gb|KJB56187.1| hypothetical protein B456_009G109100 [Gossypium raimondii]
Length=212

 Score =   151 bits (381),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 101/135 (75%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RYD E H+VH S DG++AV+ +MY+ G  P+  LS + D L+ + +    ++ +
Sbjct  70   HTINGRRYDLELHMVHESEDGKVAVIGIMYKTGR-PDSFLSSLMDHLEAITDITDGERAV  128

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPCTE VVW+++R +R+VT++Q++L+R A+HD+S T
Sbjct  129  GVIDPRHIKFGSRKYYRYIGSLTVPPCTENVVWSIVRKVRTVTREQMSLLRVAVHDDSDT  188

Query  362  NARPLQTINDRFVKV  318
            NARPLQ+IN+R +++
Sbjct  189  NARPLQSINNRPIQL  203



>ref|XP_009399717.1| PREDICTED: alpha carbonic anhydrase 7-like [Musa acuminata subsp. 
malaccensis]
Length=272

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 98/133 (74%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H V+G RY  E H+VH S D + AV+ ++Y IG   +P L+ +E  ++K+A+    ++ +
Sbjct  131  HTVDGRRYSLEMHMVHESTDNKTAVVGILYTIGRH-DPFLAKLERYIEKIADKHEAEEAV  189

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRYMGSLTTPPCTEGVVWT+++ +R+VT++QVAL+R A+HD+S+ 
Sbjct  190  GMVDPRHIKRGSRKYYRYMGSLTTPPCTEGVVWTIVKKVRTVTREQVALLREAVHDDSEM  249

Query  362  NARPLQTINDRFV  324
            NARP Q INDR +
Sbjct  250  NARPTQKINDRMI  262



>ref|XP_004241280.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X1 [Solanum lycopersicum]
Length=273

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H ++G RYD EAHLVH+S+DG+IAV+A++Y+IG  P+ +L+++E DL  +A+  G +K +
Sbjct  128  HSIDGKRYDMEAHLVHMSSDGKIAVIAILYEIGLLPDDLLTILEGDLIAVADKKGAEKPM  187

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DPN+++     YYRY+GSLTTPPCT+GVVWT+   + SVT +Q+ L+++A+ +  ++
Sbjct  188  GIIDPNIIKLDVNIYYRYIGSLTTPPCTQGVVWTIDGKVNSVTARQIKLLQDAVVNGFES  247

Query  362  NARPLQTINDRFVKVD  315
            NARP+Q +N+R +K++
Sbjct  248  NARPVQPLNERSIKLN  263



>gb|KHG27075.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Gossypium arboreum]
Length=274

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RYD E H+VH S DG++AV+ +MY+IG  P+  LS + D L+ + +    ++ +
Sbjct  132  HTINGRRYDLELHMVHESADGKVAVIGIMYKIGR-PDSFLSSLMDHLEAITDITDGERAV  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPCTE VVW+++R +R+VT++QV  +R A+HDES +
Sbjct  191  GVIDPRHIKFGSRKYYRYVGSLTIPPCTENVVWSIVRKVRTVTREQVRFLRVAVHDESDS  250

Query  362  NARPLQTINDRFVKV  318
            NARPLQ+IN R +++
Sbjct  251  NARPLQSINKRSIQL  265



>ref|XP_004139554.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=269

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 102/135 (76%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H ++G  +D EAHLVH S++G I+V+ ++YQIGE P+  LS IE+DL+  + T   ++ I
Sbjct  128  HTIDGKTFDLEAHLVHESSNGMISVIGILYQIGE-PDYFLSTIEEDLEVASNTHEEERVI  186

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DPN+L+   ++YYRY+GSLT PPCTE V+WT+I  +R+VT++QV L+R A+HD+S +
Sbjct  187  GIIDPNILKMGSKQYYRYIGSLTVPPCTENVMWTIIHQVRTVTEEQVKLLRVAVHDDSDS  246

Query  362  NARPLQTINDRFVKV  318
            NARPLQ   DR +++
Sbjct  247  NARPLQPFYDRTMQL  261



>ref|XP_004160913.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=269

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 102/135 (76%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H ++G  +D EAHLVH S++G I+V+ ++YQIGE P+  LS IE+DL+  + T   ++ I
Sbjct  128  HTIDGKTFDLEAHLVHESSNGMISVIGILYQIGE-PDYFLSTIEEDLEVASNTHEEERVI  186

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DPN+L+   ++YYRY+GSLT PPCTE V+WT+I  +R+VT++QV L+R A+HD+S +
Sbjct  187  GIIDPNILKMGSKQYYRYIGSLTVPPCTENVMWTIIHQVRTVTEEQVKLLRVAVHDDSDS  246

Query  362  NARPLQTINDRFVKV  318
            NARPLQ   DR +++
Sbjct  247  NARPLQPFYDRTMQL  261



>gb|KJB56186.1| hypothetical protein B456_009G109100 [Gossypium raimondii]
Length=274

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 101/135 (75%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RYD E H+VH S DG++AV+ +MY+ G  P+  LS + D L+ + +    ++ +
Sbjct  132  HTINGRRYDLELHMVHESEDGKVAVIGIMYKTGR-PDSFLSSLMDHLEAITDITDGERAV  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPCTE VVW+++R +R+VT++Q++L+R A+HD+S T
Sbjct  191  GVIDPRHIKFGSRKYYRYIGSLTVPPCTENVVWSIVRKVRTVTREQMSLLRVAVHDDSDT  250

Query  362  NARPLQTINDRFVKV  318
            NARPLQ+IN+R +++
Sbjct  251  NARPLQSINNRPIQL  265



>ref|XP_008802055.1| PREDICTED: alpha carbonic anhydrase 7-like [Phoenix dactylifera]
Length=275

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 98/132 (74%), Gaps = 2/132 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK-G  546
            H +NG RY  E H+VH S D +IAV+ ++Y+IG  P+P L+ +ED +KK+ +    ++  
Sbjct  133  HTINGRRYSLELHMVHQSADEKIAVVGILYKIGR-PDPFLAKMEDYIKKMEDMEESEEEK  191

Query  545  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  366
            +G +DP  ++   R+YYRYMGSLTTPPCTEGVVWT+IR +R+V KQQV L+R A+HD ++
Sbjct  192  LGLVDPGDVKKGSRKYYRYMGSLTTPPCTEGVVWTIIRKVRTVAKQQVNLLREAVHDHAE  251

Query  365  TNARPLQTINDR  330
             NARPLQ INDR
Sbjct  252  KNARPLQLINDR  263



>ref|XP_004242096.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum lycopersicum]
Length=264

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RYD EAHLVH+S+D + AV+ ++Y+IG  P+ +L+++E DLK +A+  G +KG+
Sbjct  126  HSINGKRYDMEAHLVHMSSDRKTAVIGILYEIGSLPDDLLTILEGDLKAVADKRGAEKGM  185

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DPN+++     YYRY+GSLTTPPCTEG+VWT+   + SVT +Q+ L+++A  +  + 
Sbjct  186  GIIDPNIIKLDDNIYYRYIGSLTTPPCTEGLVWTIDGKVNSVTARQIKLLQDAAVNGFEF  245

Query  362  NARPLQTINDRFVKVD  315
            NARP+Q +N R +K +
Sbjct  246  NARPVQLLNGRSIKFN  261



>ref|XP_006424533.1| hypothetical protein CICLE_v10029790mg [Citrus clementina]
 gb|ESR37773.1| hypothetical protein CICLE_v10029790mg [Citrus clementina]
Length=275

 Score =   150 bits (379),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 101/135 (75%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  EAH+VH S DG+IAV+ +MY+IG  P+ +L+ I D L+++A +   +  +
Sbjct  132  HTINGERFALEAHMVHESQDGKIAVVGIMYKIGR-PDSLLASIADHLRQIAGSDERETVV  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLTTPPCTE V+WT++R +R+VT++QV L+R A+HD+S T
Sbjct  191  GVIDPRGIKLGSRKYYRYIGSLTTPPCTENVIWTIVRKVRTVTREQVKLLRVAVHDDSGT  250

Query  362  NARPLQTINDRFVKV  318
            NARP Q IN R +K+
Sbjct  251  NARPQQPINLRTIKL  265



>ref|XP_008359452.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=275

 Score =   150 bits (378),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+D EAHLVH S+ G+IAV  ++Y+IG  P+P LS + D L +++ T   ++ +
Sbjct  133  HTINGKRFDLEAHLVHESSTGKIAVTGILYKIG-APDPFLSSMMDSLAEVSGTSEEEEAV  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++ R  +YYRY+GSLT PPCT+ V WT+++ +R+V+++QV  +R A+HD+SKT
Sbjct  192  GTVDPKKIKTRSTKYYRYIGSLTIPPCTQNVTWTIVQEVRTVSEEQVEFLRVAVHDDSKT  251

Query  362  NARPLQTINDRFVKV  318
            NARP+Q  N R V+V
Sbjct  252  NARPVQPRNGRVVQV  266



>gb|KEH16352.1| eukaryotic-type carbonic anhydrase [Medicago truncatula]
Length=274

 Score =   149 bits (377),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAE-TPGVKKG  546
            H +NG R+D E HLVH +     AV+ V+Y IG  P+P LSL+EDDL+ ++  T G ++ 
Sbjct  133  HTINGVRFDLELHLVHQTPLNETAVIGVLYTIG-MPDPFLSLLEDDLEAISNNTAGEERA  191

Query  545  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  366
            +G +DPN +     +YYRYMGSLTTPPC+E V WTVI+ ++SV+++Q+ L++ A+HD+  
Sbjct  192  VGVIDPNQINFNTTKYYRYMGSLTTPPCSENVTWTVIKEVKSVSQEQIELLQAAVHDDYD  251

Query  365  TNARPLQTINDRFVKVD  315
             NARPLQ +N+R V+++
Sbjct  252  YNARPLQPLNNRLVQLN  268



>ref|XP_006488639.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Citrus sinensis]
Length=275

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 101/135 (75%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H ++G R+  EAH+VH S DG+IAV+ +MY+IG  P+ +L+ I D L+++A +   +  +
Sbjct  132  HTIDGERFALEAHMVHESQDGKIAVVGIMYKIGR-PDSLLASISDHLRQIAGSNERETVV  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLTTPPCTE V+WT++R +R+VT++QV L+R A+HD+S T
Sbjct  191  GVIDPRGIKLGSRKYYRYIGSLTTPPCTENVIWTIVRKVRTVTREQVKLLRVAVHDDSGT  250

Query  362  NARPLQTINDRFVKV  318
            NARP Q IN R VK+
Sbjct  251  NARPQQPINLRTVKL  265



>gb|KJB56185.1| hypothetical protein B456_009G109000 [Gossypium raimondii]
Length=274

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RYD E H+VH S DG++AV+ +MY+IG   +  LSL+ D L+ + +    ++ +
Sbjct  132  HTINGRRYDLELHMVHESADGKVAVIGIMYKIGRQ-DSFLSLLMDHLEAITDITDRERAV  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPCTE VVW+++R +R+VT++QV  +R A+HDE  +
Sbjct  191  GVIDPRHIKFGSRKYYRYIGSLTIPPCTENVVWSIVRKVRTVTREQVRFLRVAVHDEWDS  250

Query  362  NARPLQTINDRFVKV  318
            NARPLQ+IN R +++
Sbjct  251  NARPLQSINKRSIQL  265



>ref|XP_009391366.1| PREDICTED: alpha carbonic anhydrase 7-like [Musa acuminata subsp. 
malaccensis]
Length=272

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 97/133 (73%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RY  E H+VH S D  IAV+ ++Y++G   +P L+ +E  +KK+A+    ++  
Sbjct  131  HTINGRRYSLELHMVHESADKNIAVVGILYKMGRH-DPFLAKLERYIKKIADKHDAEEVA  189

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRYMGSLTTPPCTEGVVWT+I+ +R+V+++QVAL+R A+HD+S+ 
Sbjct  190  GMVDPRHIRKGSRKYYRYMGSLTTPPCTEGVVWTIIKKVRTVSREQVALLREAVHDDSEM  249

Query  362  NARPLQTINDRFV  324
            NARP Q IN R V
Sbjct  250  NARPTQQINGRIV  262



>gb|KDO73356.1| hypothetical protein CISIN_1g039445mg [Citrus sinensis]
Length=275

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 101/135 (75%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H ++G R+  EAH+VH S DG+IAV+ +MY+IG  P+ +L+ I D L+++A +   +  +
Sbjct  132  HTIDGERFALEAHMVHESQDGKIAVVGIMYKIGR-PDSLLASISDHLRQIAGSNERETVV  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLTTPPCTE V+WT++R +R+VT++QV L+R A+HD+S T
Sbjct  191  GVIDPRGIKLGSRKYYRYIGSLTTPPCTENVIWTIVRKVRTVTREQVKLLRVAVHDDSGT  250

Query  362  NARPLQTINDRFVKV  318
            NARP Q IN R +K+
Sbjct  251  NARPQQPINLRTIKL  265



>ref|XP_009367040.1| PREDICTED: alpha carbonic anhydrase 7-like [Pyrus x bretschneideri]
Length=275

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+D EAHLVH S+ G+IAV  ++Y+IG  P+P LS + D L +++ T   ++ +
Sbjct  133  HTINGKRFDLEAHLVHESSTGKIAVTGILYKIG-APDPFLSSMMDSLAEVSGTSEEEEVV  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++ R  +YYRY+GSLT PPCT+ V WT+ + +R+V+K+QV  +R A+HD+SKT
Sbjct  192  GTVDPKKIKTRSTKYYRYIGSLTIPPCTQNVTWTIDQEVRTVSKEQVKFLRVAVHDDSKT  251

Query  362  NARPLQTINDRFVKV  318
            NARP+Q  N R V+V
Sbjct  252  NARPVQQRNGRVVQV  266



>ref|XP_008464591.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional monodehydroascorbate 
reductase and carbonic anhydrase nectarin-3-like [Cucumis 
melo]
Length=268

 Score =   147 bits (372),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 103/135 (76%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H ++G  +D EAHLVH S++G ++V+ ++YQIGE P+  LS I++DL+  + T   ++ +
Sbjct  128  HTIDGKNFDLEAHLVHESSNGMVSVIGILYQIGE-PDYFLSTIKEDLEVASNTHEEERVV  186

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DPN+L+   ++YYRY+GSLT PPCTE V+WT+I  +R+VT++QV L+R A+HD+S +
Sbjct  187  GIIDPNILKMGSKQYYRYIGSLTVPPCTEDVMWTIIHQVRTVTEEQVKLLRVAVHDDSNS  246

Query  362  NARPLQTINDRFVKV  318
            NARPLQ I +R +++
Sbjct  247  NARPLQPIYNRTMQL  261



>ref|XP_008810946.1| PREDICTED: alpha carbonic anhydrase 7-like [Phoenix dactylifera]
Length=284

 Score =   147 bits (371),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RYD E H+VH S+D + AV+ +MY+IG  P+  LS + + +K++A+    +  +
Sbjct  133  HSINGKRYDLEIHMVHQSSDQKNAVVGIMYKIGR-PDTFLSELMEHIKEIADAEEKETNV  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRYMGSLTTPPCT+GVVWT+ + +R+V+++QV L+R A+HD +K 
Sbjct  192  GMVDPRDIKIGSRKYYRYMGSLTTPPCTQGVVWTITKKVRTVSREQVRLLREAVHDNAKN  251

Query  362  NARPLQTINDRFVKV  318
            NARP+Q IN+R ++ 
Sbjct  252  NARPIQPINEREIQF  266



>ref|XP_011459370.1| PREDICTED: alpha carbonic anhydrase 7 [Fragaria vesca subsp. 
vesca]
Length=275

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 100/135 (74%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG ++D EAH+VH   +G IAV+ ++Y+IG+ P+P L+ + D ++ L+E+ G +K I
Sbjct  133  HKINGKQFDLEAHMVHDGPNGSIAVIGILYKIGK-PDPFLTQMMDYIEDLSESSGEEKVI  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++    +YYRY+GSLT PPCT+ V+W ++  +R+V+K+QV  +R A+HDES+T
Sbjct  192  GMVDPKQIKTVSTKYYRYIGSLTIPPCTQNVLWNLVGEVRTVSKEQVEFLREAVHDESET  251

Query  362  NARPLQTINDRFVKV  318
            NARPLQ IN R V++
Sbjct  252  NARPLQPINTRSVRL  266



>ref|XP_006473002.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Citrus sinensis]
Length=275

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H ++G R+  EAH+VH S+DG++AV+ ++Y+IG  P+  L+ I D L+ ++ +      +
Sbjct  132  HTIDGKRFALEAHMVHESHDGKVAVVGIVYKIGR-PDSFLASISDHLRNISGSNERDATV  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++    +YYRY+GSLT PPCTE V WT++R +RSVT++QV L+R A+HDES T
Sbjct  191  GVIDPRAIKIGSSKYYRYIGSLTVPPCTENVTWTIVRKVRSVTREQVRLLRVAVHDESNT  250

Query  362  NARPLQTINDRFVKV  318
            NARPLQ IN R VK+
Sbjct  251  NARPLQPINMRSVKL  265



>gb|KDO73355.1| hypothetical protein CISIN_1g046862mg [Citrus sinensis]
Length=275

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  EAH+VHVS DG+IAV+ +MY+IG  P+  L  I D L ++A +   +   
Sbjct  132  HTINGQRFALEAHMVHVSQDGKIAVVGIMYKIGR-PDSFLESISDHLTQVAGSNERETVA  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPCTE V+WT++R +R+VT++QV  +R A+HDES T
Sbjct  191  GVIDPRGIKIGSRKYYRYIGSLTIPPCTENVLWTIVRKVRTVTREQVRSLRVAVHDESDT  250

Query  362  NARPLQTINDRFVK  321
            NARP Q IN R VK
Sbjct  251  NARPQQPINLRIVK  264



>ref|XP_006424534.1| hypothetical protein CICLE_v10030314mg [Citrus clementina]
 gb|ESR37774.1| hypothetical protein CICLE_v10030314mg [Citrus clementina]
Length=275

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  EAH+VHVS DG+IAV+ +MY+IG  P+  L  I D L ++A +   +   
Sbjct  132  HTINGQRFALEAHMVHVSQDGKIAVVGIMYKIGR-PDSFLESISDHLTQVAGSNERETVA  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPCTE V+WT++R +R+VT++QV  +R A+HDES T
Sbjct  191  GVIDPRGIKIGSRKYYRYIGSLTIPPCTENVLWTIVRKVRTVTREQVRSLRVAVHDESDT  250

Query  362  NARPLQTINDRFVK  321
            NARP Q IN R VK
Sbjct  251  NARPQQPINLRIVK  264



>tpg|DAA48425.1| TPA: carbonic anhydrase [Zea mays]
Length=291

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H V+G RY  E H+VH S  G+ AV+ ++Y+IG  P+P L  +E  ++++A+    ++ I
Sbjct  137  HTVDGRRYAMELHMVHESAAGKAAVIGILYEIGLVPDPFLLRLEPFIRRIADRKDREEPI  196

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP L +     YYRYMGSLTTPPC+EGVVWT+I+ +RSV+K+Q+ L+R A+HD ++ 
Sbjct  197  GVVDPRLARGTASAYYRYMGSLTTPPCSEGVVWTIIKKVRSVSKRQLELLREAVHDGNEN  256

Query  362  NARPLQTINDRFVKV  318
            NARP+Q +NDR + +
Sbjct  257  NARPVQDLNDRDISL  271



>ref|XP_003541987.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
 gb|KHN21504.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=274

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H ++G R D E H+VH +  G+ AV+ ++Y+IG +P+  LS + D LK +++T   ++ +
Sbjct  130  HTIDGKRLDLELHMVHETPSGQSAVIGMLYKIG-SPDSFLSSLTDHLKAISDTTEAERVV  188

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   ++YYRY+GSLT PPCTE V WT+IR I+SV+K+QV L+R A+HDES T
Sbjct  189  GVVDPRQIKIFYKQYYRYIGSLTIPPCTENVSWTIIRKIQSVSKEQVRLLRVAVHDESDT  248

Query  362  NARPLQTINDRFVKV  318
            NARPLQ IN+R VK+
Sbjct  249  NARPLQLINNRLVKL  263



>ref|NP_001149032.1| carbonic anhydrase precursor [Zea mays]
 gb|ACG33896.1| carbonic anhydrase precursor [Zea mays]
Length=291

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H V+G RY  E H+VH S  G+ AV+ ++Y+IG  P+P L  +E  ++++A+    ++ I
Sbjct  137  HTVDGRRYAMELHMVHESAAGKAAVIGILYEIGLVPDPFLLRLEPFIRRIADRKDREEPI  196

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP L +     YYRYMGSLTTPPC+EGVVWT+I+ +RSV+K+Q+ L+R A+HD ++ 
Sbjct  197  GVVDPRLARGTASAYYRYMGSLTTPPCSEGVVWTIIKKVRSVSKRQLELLREAVHDGNEN  256

Query  362  NARPLQTINDRFVKV  318
            NARP+Q +NDR + +
Sbjct  257  NARPVQDLNDRDISL  271



>ref|XP_006488640.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Citrus sinensis]
Length=275

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  EAH+VHVS DG+IAV+ ++Y+IG  P+  L  I D L ++A +   +  +
Sbjct  132  HTINGQRFALEAHMVHVSQDGKIAVVGIVYKIGR-PDSFLESISDHLTQVAGSNERETVV  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPCTE V+WT++R +R+VT++QV  +R A+HDES T
Sbjct  191  GVIDPRGIKIGSRKYYRYIGSLTIPPCTENVLWTIVRKVRTVTREQVRSLRVAVHDESDT  250

Query  362  NARPLQTINDRFVK  321
            NARP Q IN R VK
Sbjct  251  NARPQQPINLRIVK  264



>ref|XP_004506042.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cicer arietinum]
Length=269

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 93/135 (69%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H ++G R+D E H+VH +  G+ AV+ ++Y+ G  PNP  SL+  DL+ ++E    ++ +
Sbjct  133  HTIDGKRFDLELHMVHQTPSGQTAVIGILYKTGR-PNPFFSLLRSDLEAISEKTEEERAL  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  +      YYRY+GSLTTP C+E + WT+I+ +RSV+K+Q+ L R A HDES +
Sbjct  192  GVIDPRWINFGKTHYYRYIGSLTTPSCSENITWTIIQEVRSVSKEQIKLFRVAAHDESNS  251

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +NDR V++
Sbjct  252  NARPLQPLNDRLVQL  266



>gb|KDO81077.1| hypothetical protein CISIN_1g038655mg [Citrus sinensis]
Length=275

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H ++G R+  EAH+VH S+DG++AV+ ++Y+IG  P+  L+ I D L+ ++ +      +
Sbjct  132  HTIDGKRFALEAHMVHESHDGKVAVVGIVYKIGR-PDSFLASISDHLRNISGSNERDATV  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++    +YYRY+GSLT PPCTE V WT++R +RSVT++QV ++R A+HDES T
Sbjct  191  GVIDPRAIKIGSSKYYRYIGSLTVPPCTENVTWTIVRKVRSVTREQVRVLRVAVHDESNT  250

Query  362  NARPLQTINDRFVKV  318
            NARPLQ IN R VK+
Sbjct  251  NARPLQPINMRSVKL  265



>ref|XP_007016796.1| Alpha carbonic anhydrase 7 [Theobroma cacao]
 gb|EOY34415.1| Alpha carbonic anhydrase 7 [Theobroma cacao]
Length=275

 Score =   144 bits (364),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RYD E HLVH S DG++AV+ +MY+IG  P+  LS + D L  + +    +   
Sbjct  133  HTINGRRYDLEVHLVHESADGKVAVIGIMYKIGR-PDSFLSSLLDHLASITDITEGESVA  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPC E VVW+++R +R+VT++QV L+R A+HD S T
Sbjct  192  GVIDPRHIKIGSRKYYRYIGSLTVPPCDENVVWSIVRKVRTVTREQVRLLRVAVHDASDT  251

Query  362  NARPLQTINDRFVKV  318
            NARPLQ IN R V++
Sbjct  252  NARPLQPINKRSVQL  266



>ref|XP_007150177.1| hypothetical protein PHAVU_005G133000g [Phaseolus vulgaris]
 gb|ESW22171.1| hypothetical protein PHAVU_005G133000g [Phaseolus vulgaris]
Length=271

 Score =   144 bits (364),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H ++G R+D E H+VH +  G+  V+ ++Y+IG TP+  LS +   +K ++ +   ++ +
Sbjct  129  HTIDGKRFDLELHIVHETPSGQTTVIGILYKIGRTPDSFLSSLTSHIKVISNSTEAERMV  188

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   ++YYRYMGSLT PPCTE V WT++R IRSV+K+QV L+R A+ DES+T
Sbjct  189  GVVDPRQIKIFYKQYYRYMGSLTIPPCTENVSWTIVREIRSVSKEQVRLLRAAVDDESET  248

Query  362  NARPLQTINDRFVKV  318
            NARPLQ IN+R +++
Sbjct  249  NARPLQLINNRLLQL  263



>ref|XP_008810960.1| PREDICTED: alpha carbonic anhydrase 7-like [Phoenix dactylifera]
Length=263

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+D E H+VH S+D + AV+ +MY+IG  P+  LS + + +K++A+    +  +
Sbjct  116  HSINGKRFDLEIHMVHQSSDQKNAVVGIMYKIGR-PDTFLSELMEHIKEIADAEEKETNV  174

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRYMGSLTTPPCT+GVVWT+ + +R+V+++QV L+R A+HD ++ 
Sbjct  175  GMVDPRDIKIGSRKYYRYMGSLTTPPCTQGVVWTITKKVRTVSREQVRLLREAVHDNAEN  234

Query  362  NARPLQTINDRFVKV  318
            NARP+Q IN+R ++ 
Sbjct  235  NARPIQPINEREIQF  249



>gb|KHN39017.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=296

 Score =   144 bits (364),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 91/126 (72%), Gaps = 1/126 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RYD E H+VHVS D +I V+  +Y+ G  P+  LS +E D+K L +   V++ I
Sbjct  151  HSMNGRRYDLEMHMVHVSPDNKIFVVGALYKFGHRPDRFLSQLEKDIKHLVDNE-VERAI  209

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G  +P+ LQ RG  YYRY+GSLTTPPCTEGV+W + R IR+V+++QV L+R A+HD ++ 
Sbjct  210  GETNPSGLQTRGNAYYRYVGSLTTPPCTEGVIWNIDRKIRTVSEEQVRLLREAVHDHAER  269

Query  362  NARPLQ  345
            NARP+Q
Sbjct  270  NARPMQ  275



>ref|XP_006433902.1| hypothetical protein CICLE_v10003227mg [Citrus clementina]
 gb|ESR47142.1| hypothetical protein CICLE_v10003227mg [Citrus clementina]
Length=275

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H ++G R+  EAH+VH S+DG++AV+ ++Y+IG  P+  L+ I D L+ ++ +      +
Sbjct  132  HTIDGKRFALEAHMVHESHDGKVAVVGIVYKIGR-PDSFLASISDHLRNISGSNERDATV  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++    +YYRY+GSLT PPCTE V WT++R +RSVT++QV ++R A+HDES T
Sbjct  191  GVIDPRAIKIGSSKYYRYIGSLTVPPCTENVTWTIVRKVRSVTREQVRVLRVAVHDESNT  250

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +N R VK+
Sbjct  251  NARPLQPLNMRSVKL  265



>ref|XP_010272832.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
 ref|XP_010272833.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
Length=270

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 97/133 (73%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RY  E H+VH S+D ++AV+ ++Y+ G  P+  LS++E+ + K A+  G ++ +
Sbjct  131  HTINGVRYALEGHMVHESSDKKVAVVGILYKFGR-PDRFLSMMENYVFKTADKEGAEEEL  189

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G ++P  ++  G  YYRYMGSLTTPPCTEGVVWT+++ +++V+K+QV L+R A+HD+S+ 
Sbjct  190  GIVNPKRIKLGGTEYYRYMGSLTTPPCTEGVVWTILKKVKTVSKEQVELLRMAVHDDSEM  249

Query  362  NARPLQTINDRFV  324
            NARP Q  N R V
Sbjct  250  NARPTQPTNYRSV  262



>ref|XP_003539200.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=276

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 99/138 (72%), Gaps = 2/138 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H ++G R D E H+VH +  G+ AV+ ++Y+ G  P+P LSL+ + LK ++ + G ++ +
Sbjct  133  HTIDGRRLDLELHMVHETPSGQTAVIGILYKAGRRPDPFLSLLTNHLKAISNSTGAEREV  192

Query  542  GYLDPNLLQ--ARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES  369
            G +DP L++       YYRY+GSLTTPPCTE + WT+++ ++SV+K+Q+ L+R+A+HD+ 
Sbjct  193  GVMDPRLVKIGTSTTLYYRYIGSLTTPPCTENIAWTMLKKVKSVSKEQIRLLRDAVHDDF  252

Query  368  KTNARPLQTINDRFVKVD  315
              NARPLQ IN+R V+++
Sbjct  253  DANARPLQPINNRLVQLN  270



>ref|XP_010043780.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW85764.1| hypothetical protein EUGRSUZ_B02520 [Eucalyptus grandis]
Length=278

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 100/135 (74%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG R+D E H+VH S +G++AV+ VMY++G  P+  LS +   ++ +A+T G ++ +
Sbjct  132  HAVNGRRFDLELHMVHDSPEGKVAVVGVMYKLGR-PDTFLSTMMKHIQGIADTHGAERTV  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G ++P  ++   R+YYRY+GSLT PPCT+ V+WT++R +R+VT++QV L+R A+ D+S+ 
Sbjct  191  GIVNPKHIKIGSRKYYRYVGSLTVPPCTQNVLWTIVRKVRTVTREQVKLLREAVRDDSEF  250

Query  362  NARPLQTINDRFVKV  318
            NARPLQ IN R V++
Sbjct  251  NARPLQPINKRPVQL  265



>ref|XP_002529419.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF32945.1| carbonic anhydrase, putative [Ricinus communis]
Length=272

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG  Y  E H+VH S DG+IAV+ +MY IG  P+  LS + D L+ +A T   +   
Sbjct  132  HTVNGKSYALELHMVHESLDGKIAVVGIMYTIGR-PDSFLSSLTDRLQLVAGTREYETAA  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G ++P  ++   R+YYRYMGSLT PPCTE V+WT++R +R+VT++QV L+R A+HDES +
Sbjct  191  GTVNPKDIKIGSRKYYRYMGSLTVPPCTENVLWTIVRKVRTVTREQVRLLRVAVHDESNS  250

Query  362  NARPLQTINDRFVKV  318
            NARP+Q IN R V++
Sbjct  251  NARPIQGINGRSVQL  265



>ref|XP_003537009.2| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=296

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 91/126 (72%), Gaps = 1/126 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RYD E H+VHVS D +I V+  +Y+ G  P+  LS +E D+K L +   V++ I
Sbjct  151  HSMNGRRYDLEMHMVHVSPDNKIFVVGALYKFGHRPDRFLSQLEKDIKHLVDNE-VEREI  209

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G  +P+ LQ RG  YYRY+GSLTTPPCTEGV+W + R IR+V+++QV L+R A+HD ++ 
Sbjct  210  GETNPSGLQTRGNAYYRYVGSLTTPPCTEGVIWNIDRKIRTVSEEQVRLLREAVHDHAER  269

Query  362  NARPLQ  345
            NARP+Q
Sbjct  270  NARPMQ  275



>ref|XP_002529418.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF32944.1| carbonic anhydrase, putative [Ricinus communis]
Length=274

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H ++G R+  E H+VH S DG++AV+ VMY IG   + +LSL  D L+ ++ T   ++ +
Sbjct  132  HTLDGRRFALELHMVHESPDGKVAVVGVMYTIGRPDSFLLSLT-DHLRSISGTEEEERVV  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G ++P  ++   R+YYRYMGSLT PPCTE V+WT+++ +R+VT++QV+L+R A+HDES T
Sbjct  191  GIINPKDIKIGSRKYYRYMGSLTVPPCTENVIWTIVKKVRTVTREQVSLLRVAVHDESDT  250

Query  362  NARPLQTINDRFVKV  318
            NARPLQ IN R V +
Sbjct  251  NARPLQQINGRSVHL  265



>ref|XP_004506040.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cicer arietinum]
Length=298

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 100/136 (74%), Gaps = 1/136 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R D E H+VH +  G+IAV+ V+Y+IG+ P+ +LSL+  DL+ ++   G ++ +
Sbjct  137  HTINGRRLDLELHMVHQTPSGQIAVIGVLYRIGK-PDTLLSLLRKDLRAISGQTGEERVV  195

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G ++P L++     YYRY GSLTTP C++ + WT+IR ++SV+K+Q+ L+R A+HDES +
Sbjct  196  GVINPKLVKLDRDEYYRYNGSLTTPACSQNITWTIIREVKSVSKKQIELLRVAVHDESDS  255

Query  362  NARPLQTINDRFVKVD  315
            NARPLQ +NDR V+++
Sbjct  256  NARPLQPLNDRLVQLN  271



>ref|XP_010916592.1| PREDICTED: alpha carbonic anhydrase 7-like [Elaeis guineensis]
Length=275

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAE-TPGVKKG  546
            H +N  RY  E H+VH + D + AV+ ++Y+IG  P+P L+ +E  +KK+ +     ++ 
Sbjct  133  HTINRHRYSLELHMVHQTTDNKTAVVGILYKIGR-PDPFLAKMEKYIKKMEDMAESEEEK  191

Query  545  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  366
            +G +DP  ++   R+YYRYMGSLTTPPCTEGVVWT+IR +R+V+K QV L+R A+HD ++
Sbjct  192  LGMVDPRDVKKGSRKYYRYMGSLTTPPCTEGVVWTIIRKVRTVSKHQVNLLREAVHDHAE  251

Query  365  TNARPLQTINDRFV  324
             NARPLQ +N+R V
Sbjct  252  MNARPLQLLNNRPV  265



>gb|KDP44023.1| hypothetical protein JCGZ_05490 [Jatropha curcas]
Length=275

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG R+  E H+VH S DG++AV+ VMY IG  P+  LS ++  L+ +A T  ++  +
Sbjct  133  HSVNGVRFALELHMVHESLDGKVAVIGVMYIIGR-PDSFLSSVDKHLRSVAGTRKLQTVV  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G ++P  ++ R R+YYRY GSLT PPCTE V+WT++  +R+V+++QV L+R A+HDES T
Sbjct  192  GMVNPKSIKLRSRKYYRYKGSLTVPPCTENVLWTIVTKVRTVSREQVRLLRVAVHDESDT  251

Query  362  NARPLQTINDRFVKV  318
            NARP+Q +N R V++
Sbjct  252  NARPIQLMNGRSVQL  266



>gb|KGN64825.1| hypothetical protein Csa_1G120410 [Cucumis sativus]
Length=254

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 101/135 (75%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  EAHLVH S +G  AV+ V+Y IG  P+ +LS ++++L+++++T   +K +
Sbjct  114  HTINGRRFALEAHLVHQSQNGNYAVIGVVYNIGRRPDYLLSKMKENLEEISDTCE-EKAL  172

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +D ++L+ +   YYRY+GSLTTPPC++ V+WT++R +R+VT +QV L+R A HD+S T
Sbjct  173  DVIDLSMLKMQSSLYYRYIGSLTTPPCSQNVLWTIVRKVRTVTTEQVKLLRVASHDDSNT  232

Query  362  NARPLQTINDRFVKV  318
            NARPLQ INDR +++
Sbjct  233  NARPLQPINDRKIQL  247



>ref|XP_004166480.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like, partial [Cucumis sativus]
Length=242

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 101/135 (75%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  EAHLVH S +G  AV+ V+Y IG  P+ +LS ++++L+++++T   +K +
Sbjct  102  HTINGRRFALEAHLVHQSQNGNYAVIGVVYNIGRRPDYLLSKMKENLEEISDT-CEEKAL  160

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +D ++L+ +   YYRY+GSLTTPPC++ V+WT++R +R+VT +QV L+R A HD+S T
Sbjct  161  DVIDLSMLKMQSSLYYRYIGSLTTPPCSQNVLWTIVRKVRTVTTEQVKLLRVASHDDSNT  220

Query  362  NARPLQTINDRFVKV  318
            NARPLQ INDR +++
Sbjct  221  NARPLQPINDRKIQL  235



>ref|XP_010488326.1| PREDICTED: alpha carbonic anhydrase 7 [Camelina sativa]
Length=276

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG R+  E H+VH    GR+AV++V+Y+IG     I SL E++L+ +AE    +K +
Sbjct  138  HTVNGRRFALELHMVHEGKKGRMAVVSVLYKIGRADTFIRSL-ENELEGIAEMEEAEKNV  196

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY GSLTTPPCT+ V WTV+R +R+VT++QV L+R A+HD+S +
Sbjct  197  GMIDPTKIKIGSRKYYRYTGSLTTPPCTQNVTWTVVRKVRTVTRKQVKLLRVAVHDDSNS  256

Query  362  NARPLQTINDRFVKV  318
            NARP+Q  N R V +
Sbjct  257  NARPVQPTNKRTVHM  271



>ref|XP_010475599.1| PREDICTED: alpha carbonic anhydrase 7-like [Camelina sativa]
Length=277

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG R+  E H+VH    GR+AV+ V+Y+IG     I SL E++L+ +AE    +K +
Sbjct  139  HTVNGRRFALELHMVHEGKKGRMAVVTVLYKIGRADTFIRSL-ENELEGIAEMEDAEKNV  197

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY GSLTTPPCT+ V WTV++ +R+VT++QV L+R A+HD+S +
Sbjct  198  GVIDPTKIKIGSRKYYRYTGSLTTPPCTQNVTWTVVKKVRTVTRKQVKLLRVAVHDDSNS  257

Query  362  NARPLQTINDRFV  324
            NARP+Q IN R V
Sbjct  258  NARPVQPINKRTV  270



>ref|XP_004139552.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=250

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 101/135 (75%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  EAHLVH S +G  AV+ V+Y IG  P+ +LS ++++L+++++T   +K +
Sbjct  110  HTINGRRFALEAHLVHQSQNGNYAVIGVVYNIGRRPDYLLSKMKENLEEISDT-CEEKAL  168

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +D ++L+ +   YYRY+GSLTTPPC++ V+WT++R +R+VT +QV L+R A HD+S T
Sbjct  169  DVIDLSMLKMQSSLYYRYIGSLTTPPCSQNVLWTIVRKVRTVTTEQVKLLRVASHDDSNT  228

Query  362  NARPLQTINDRFVKV  318
            NARPLQ INDR +++
Sbjct  229  NARPLQPINDRKIQL  243



>ref|XP_010916593.1| PREDICTED: alpha carbonic anhydrase 7-like [Elaeis guineensis]
Length=270

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 95/134 (71%), Gaps = 2/134 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK-G  546
            H +NG RY  E H+VH + D + AV+ ++Y+IG  P+P L+ +ED LKK+ +   +++  
Sbjct  133  HTINGRRYSLELHMVHQTADNKTAVVGILYKIGR-PDPFLAKMEDYLKKVEDLAELEEEK  191

Query  545  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  366
            +G +DP  ++     YYRYMGSLT PPCTEGVVW +IR +R+VT+QQV L+R A+HD+  
Sbjct  192  LGMVDPRDVRKGSSEYYRYMGSLTAPPCTEGVVWIIIRKVRTVTQQQVNLLREAVHDDVG  251

Query  365  TNARPLQTINDRFV  324
             NARPLQ IN+R V
Sbjct  252  MNARPLQPINNRSV  265



>ref|XP_006384924.1| hypothetical protein POPTR_0004s22280g [Populus trichocarpa]
 gb|ERP62721.1| hypothetical protein POPTR_0004s22280g [Populus trichocarpa]
Length=274

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H ++G R+  EAH+VH S DG++AV+ ++Y+IG  P+  LS + + L+ +A T      +
Sbjct  133  HTIDGKRFALEAHMVHESLDGKVAVVGILYKIGR-PDSFLSSLTEQLESVAGTNERDTVV  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLTTPPCTE V+WT+++ +R+ T++QV L+R A+HD+S T
Sbjct  192  GVVDPRNIEIGSRKYYRYLGSLTTPPCTENVLWTIVKKVRTATREQVRLLRVAVHDDSDT  251

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +N R VK+
Sbjct  252  NARPLQPLNGRSVKL  266



>ref|XP_010450977.1| PREDICTED: alpha carbonic anhydrase 8 [Camelina sativa]
Length=325

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RY  E HLVH S D R AV+A +Y++G + +P L  ++  LKK+ +T   ++ +
Sbjct  187  HTINGKRYALEKHLVHESKDKRYAVVAFLYKLGAS-DPFLLSLDKQLKKITDTHEAEEHV  245

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  L  + + YYRY+GSLT PPC+E V+W+V + IR+VT +QV L+R A+HD+S +
Sbjct  246  GIIDPKKLSFKSKLYYRYIGSLTAPPCSENVIWSVAKEIRTVTSKQVKLLRVAVHDDSNS  305

Query  362  NARPLQTINDRFV  324
            NARPLQ IN R V
Sbjct  306  NARPLQPINKRVV  318



>ref|XP_010458032.1| PREDICTED: alpha carbonic anhydrase 7 [Camelina sativa]
Length=276

 Score =   142 bits (357),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG R+  E H+VH    GR+AV+ V+Y+IG     I SL E++L+ +AE    +K +
Sbjct  138  HTVNGRRFALELHMVHEGKKGRMAVVTVLYKIGRADTFIRSL-ENELEGIAEMEEAEKNV  196

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY GSLTTPPCT+ V WTV+R +R+VT++QV L+R A+HD+S +
Sbjct  197  GMIDPTKIKIGSRKYYRYTGSLTTPPCTQNVTWTVVRKVRTVTRKQVKLLRVAVHDDSNS  256

Query  362  NARPLQTINDRFVKV  318
            NARP+Q  N R V +
Sbjct  257  NARPVQPTNKRTVHM  271



>ref|XP_002445622.1| hypothetical protein SORBIDRAFT_07g022860 [Sorghum bicolor]
 gb|EES15117.1| hypothetical protein SORBIDRAFT_07g022860 [Sorghum bicolor]
Length=280

 Score =   142 bits (358),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 90/135 (67%), Gaps = 0/135 (0%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H ++G RYD E HLVH +   + AV+ V+Y+IG   +P L ++E  ++ +  T    K I
Sbjct  136  HTIDGRRYDMELHLVHQTLANKTAVIGVLYEIGPIRDPFLQMLEPFIRSIENTKDQPKDI  195

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DPN  +  G  YYRYMGSLTTPPCTEGVVWTV+R I  V K QV L+R+A+ D +  
Sbjct  196  GVVDPNGARGSGSAYYRYMGSLTTPPCTEGVVWTVVRKISPVAKDQVKLLRDALQDGNTM  255

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +N+R + +
Sbjct  256  NARPLQEVNNRDISI  270



>ref|XP_006409842.1| hypothetical protein EUTSA_v10017075mg [Eutrema salsugineum]
 gb|ESQ51295.1| hypothetical protein EUTSA_v10017075mg [Eutrema salsugineum]
Length=271

 Score =   142 bits (357),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E HLVH S +GR+AV+ V+Y+IG  P+  L L+E+ L  + +    +K I
Sbjct  132  HTINGRRFAMELHLVHESINGRMAVVTVLYKIGR-PDSFLRLLENKLLAITDQNEKEKNI  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLTTPPCT+ V WTV++ +R+V+K QV L+R A+HD+S +
Sbjct  191  GLIDPKKIKFGSRKYYRYVGSLTTPPCTQNVTWTVVKKVRTVSKNQVRLLRVAVHDDSNS  250

Query  362  NARPLQTINDRFVKV  318
            NARP+Q  N R V +
Sbjct  251  NARPVQPTNKRVVNL  265



>ref|XP_007016793.1| Alpha carbonic anhydrase 7 [Theobroma cacao]
 gb|EOY34412.1| Alpha carbonic anhydrase 7 [Theobroma cacao]
Length=275

 Score =   142 bits (357),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 93/135 (69%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RYD E HLVH S D ++AV+ +MY+IG  P+  LS + D L  + +    +   
Sbjct  133  HTINGRRYDLEVHLVHESADDKVAVIGIMYKIGR-PDSFLSSLLDHLASITDITEGESVA  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPC E VVW+++R +R+VT++QV L+R A+HD S T
Sbjct  192  GVIDPRHIKIGSRKYYRYIGSLTVPPCDENVVWSIVRKVRTVTREQVRLLRVAVHDASDT  251

Query  362  NARPLQTINDRFVKV  318
            NARPLQ IN R V++
Sbjct  252  NARPLQPINKRSVQL  266



>ref|XP_002282495.2| PREDICTED: alpha carbonic anhydrase 7 [Vitis vinifera]
 emb|CBI16339.3| unnamed protein product [Vitis vinifera]
Length=274

 Score =   142 bits (357),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 96/133 (72%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG R+D E H++H +  G+ +V+ +MY+IG   +  LS + D L+ L+++   ++ +
Sbjct  132  HTVNGKRFDLELHMLHETPSGKTSVVGIMYKIGRA-DSFLSTLTDHLEALSDSSDQERDV  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRYMGSLTTPPCTE V+WT++  +R+VT++QV L+R A+HD+S +
Sbjct  191  GVVDPRHIKIGSRKYYRYMGSLTTPPCTEDVIWTIVNKVRTVTREQVNLLRVAVHDDSGS  250

Query  362  NARPLQTINDRFV  324
            NARP+Q IN R V
Sbjct  251  NARPIQPINRRSV  263



>ref|XP_004242097.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum lycopersicum]
Length=270

 Score =   141 bits (356),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 96/137 (70%), Gaps = 3/137 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGR-IAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG  546
            H +NG R+D E HLVH +NDG+ IAV+ ++Y+IG  P+  L++IE DL+ L      +K 
Sbjct  130  HTINGKRFDMEGHLVHETNDGKNIAVIGILYEIGLFPDLFLTMIEKDLEALRLAD--QKA  187

Query  545  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  366
            IG   PNL++   +RYYRYMGSLT PPCTE V+WT+    ++VT++Q+ L+R+ +HD  +
Sbjct  188  IGINHPNLIKIDEKRYYRYMGSLTVPPCTENVIWTIDGKTKTVTRRQIQLLRDVVHDGFE  247

Query  365  TNARPLQTINDRFVKVD  315
             NARP+Q +N R +K +
Sbjct  248  YNARPIQQLNGRTIKFN  264



>gb|KHN38743.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=276

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 98/138 (71%), Gaps = 2/138 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H ++G R D E H+VH +  G+ AV+ ++Y+ G  P+P LSL+ + LK ++ + G ++ +
Sbjct  133  HTIDGRRLDLELHMVHETPSGQTAVIGILYKAGRRPDPFLSLLTNHLKAISNSTGAEREV  192

Query  542  GYLDPNLLQ--ARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES  369
            G +DP L++       YYRY+GSLTTPPCTE + WT+++ ++ V+K+Q+ L+R+A+HD+ 
Sbjct  193  GVMDPRLVKIGTSTTLYYRYIGSLTTPPCTENIAWTMLKEVKFVSKEQIRLLRDAVHDDF  252

Query  368  KTNARPLQTINDRFVKVD  315
              NARPLQ IN+R V+++
Sbjct  253  DANARPLQPINNRLVQLN  270



>ref|XP_010521744.1| PREDICTED: alpha carbonic anhydrase 7-like [Tarenaya hassleriana]
Length=274

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 97/133 (73%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH S +GR AV+ ++Y+IG  P+  L  +E+ L+++++    +K I
Sbjct  135  HTINGKRFALELHMVHESKNGRFAVVTILYKIGR-PDTFLQSLENGLEEVSDKHEAEKNI  193

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLTTPPCT+ VVWTV++ +R+VT++QV L+R ++HD+S +
Sbjct  194  GIIDPKKIKFGSRKYYRYIGSLTTPPCTQNVVWTVLKKVRTVTREQVRLLRVSVHDDSNS  253

Query  362  NARPLQTINDRFV  324
            NARP+Q  N R V
Sbjct  254  NARPIQRRNKRRV  266



>ref|XP_009400916.1| PREDICTED: alpha carbonic anhydrase 7-like [Musa acuminata subsp. 
malaccensis]
Length=282

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH S D R+AV+ +MY+IG  P+  L+ + + ++++A     ++ +
Sbjct  135  HSINGKRFALELHMVHQSADERVAVVGIMYKIGR-PDSFLTELMEYIEEIAGNKEEERVV  193

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G++DP  ++   R+YYRYMGSLTTPPC +GVVWT+   IR+V+K QV+L+R A+HD+++ 
Sbjct  194  GFVDPRYIKIGSRKYYRYMGSLTTPPCKQGVVWTISEKIRTVSKDQVSLLREAVHDDAEN  253

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +N R ++ 
Sbjct  254  NARPLQPLNGREIQF  268



>emb|CDF47511.1| bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Cucumis sativus]
Length=163

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  EAHLVH S  G+IAV+ ++Y IG+ P+  LS +   L +++ T    K +
Sbjct  21   HTINGRRFALEAHLVHQSQTGKIAVIGILYNIGQ-PDYFLSTMRQHLVEISGTQR-DKLL  78

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              ++P+LL+ R   YYRY+GSLT PPC++ V+WT++R +R+VT +QV L+R A+HD+S+T
Sbjct  79   NMVNPSLLKMRSSLYYRYIGSLTVPPCSQNVLWTIVRKVRTVTPEQVNLLRVAVHDDSET  138

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +N+R V++
Sbjct  139  NARPLQPLNNRNVQL  153



>ref|XP_006303231.1| hypothetical protein CARUB_v10012300mg [Capsella rubella]
 gb|EOA36129.1| hypothetical protein CARUB_v10012300mg [Capsella rubella]
Length=276

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R   E H+VH   +GR+AV+ V+Y+IG     I SL E++L+ +AE    +K +
Sbjct  138  HTINGRRLALELHMVHEGKNGRMAVVTVLYKIGRADTFIRSL-ENELEGIAEMEEAEKNV  196

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY GSLTTPPCT+ + WTV+R IR+VT++QV L+R A+HD+S +
Sbjct  197  GMIDPTKIKIGSRKYYRYTGSLTTPPCTQNITWTVVRKIRTVTRKQVKLLRVAVHDDSNS  256

Query  362  NARPLQTINDRFVKV  318
            NARP+Q  N R V +
Sbjct  257  NARPVQPTNKRTVHM  271



>ref|XP_009380700.1| PREDICTED: alpha carbonic anhydrase 7-like [Musa acuminata subsp. 
malaccensis]
Length=273

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 96/133 (72%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RY  E H+VH S D +IAV+ ++Y+IG   +P L+ +E  ++++++    ++ +
Sbjct  131  HTINGRRYPMEMHMVHESADNKIAVVGILYKIGHR-DPFLAELERYIERISDKHEAEEVV  189

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY GSLTTPPCTEGV WT+I+ +R+V+++Q+AL+R A+HD S+ 
Sbjct  190  GMVDPRHVRKGSRKYYRYTGSLTTPPCTEGVAWTIIKKVRTVSREQLALLREAVHDGSEM  249

Query  362  NARPLQTINDRFV  324
            NARP Q +N R V
Sbjct  250  NARPTQKMNKRIV  262



>gb|KFK43125.1| hypothetical protein AALP_AA1G083600 [Arabis alpina]
Length=272

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG R+  E H+VH + +GR+AV+ V+Y+IG   +  L  +E +L+ +A     +K  
Sbjct  134  HSVNGRRFALELHMVHEAKNGRMAVVTVLYKIGRA-DTFLGSLEKELEGIAVLEEAEKNA  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLTTPPCT+ V W+V+R +R+VT++QV L+R A+HD+  T
Sbjct  193  GIIDPKKIKIGSRKYYRYIGSLTTPPCTQNVTWSVVRKVRTVTRKQVRLLRVAVHDDQDT  252

Query  362  NARPLQTINDRFVKV  318
            NARP+Q IN R VK+
Sbjct  253  NARPVQPINKRMVKL  267



>ref|XP_002892434.1| carbonic anhydrase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68693.1| carbonic anhydrase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=275

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH    GR+AV+ V+Y+IG     I SL E++L+ +AE    +K +
Sbjct  137  HTINGRRFALELHMVHEGKKGRMAVVTVLYKIGRADTFIRSL-ENELEGIAEMEEAEKNV  195

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY GSLTTPPCT+ V W+V+R +R+VT++QV L+R A+HD++ +
Sbjct  196  GMIDPTKIKIGSRKYYRYTGSLTTPPCTQNVTWSVVRKVRTVTRKQVKLLRVAVHDDANS  255

Query  362  NARPLQTINDRFV  324
            NARP+Q  N R V
Sbjct  256  NARPVQPTNKRMV  268



>ref|XP_002445625.1| hypothetical protein SORBIDRAFT_07g022890 [Sorghum bicolor]
 gb|EES15120.1| hypothetical protein SORBIDRAFT_07g022890 [Sorghum bicolor]
Length=281

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 93/135 (69%), Gaps = 0/135 (0%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H V+G RYD E HLVH S D + AV+A++Y++G   +  L  +E  ++++A+    ++ +
Sbjct  138  HTVDGRRYDMELHLVHESADKKAAVIAILYEVGRHEDAFLRHLEPFIRRIADVRDREERV  197

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP   +     YYRYMGSLT PPCTEGV+WT+++ +RSV+K Q+ L+R A+HD+ + 
Sbjct  198  GVVDPRRARGTASVYYRYMGSLTAPPCTEGVIWTIVKRVRSVSKYQLELLREAVHDDMEN  257

Query  362  NARPLQTINDRFVKV  318
            NARPLQ  N+R + +
Sbjct  258  NARPLQEANNRHISI  272



>ref|XP_006365755.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=270

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 96/137 (70%), Gaps = 3/137 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGR-IAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG  546
            H ++G R+D E HLVH +NDG+ IAV+ ++Y+IG  P+  L++IE DL+ L        G
Sbjct  130  HTIDGKRFDMEGHLVHETNDGKNIAVIGILYEIGLFPDLFLTMIEKDLEALRLADQKAIG  189

Query  545  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  366
            I Y  PNL++   +RYYRYMGSLT PPCTE V+WT+   +++VT++Q+ L+R+ +HD  +
Sbjct  190  INY--PNLIKIDEKRYYRYMGSLTVPPCTENVIWTIDGKVKTVTRKQIQLLRDVVHDGFE  247

Query  365  TNARPLQTINDRFVKVD  315
             NARP+Q +N R +K +
Sbjct  248  YNARPIQPLNGRPIKFN  264



>ref|XP_010414580.1| PREDICTED: alpha carbonic anhydrase 2-like [Camelina sativa]
Length=276

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG R+  E H+VH S +G +AV+ V+Y+IG  PN  L L+E  L  + +    ++ +
Sbjct  137  HTVNGKRFALELHMVHESKNGSMAVVTVLYKIGR-PNSFLKLLEQKLVAITDQHDAERNV  195

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +DPN ++   R YYRY+GSLTTPPCT+ + WT+++ IR+V+K QV L+R A+HD+S +
Sbjct  196  VMIDPNKIKTESRNYYRYIGSLTTPPCTQNITWTILKKIRTVSKSQVNLLRVAVHDDSNS  255

Query  362  NARPLQTINDRFV  324
            NARP+Q  N R +
Sbjct  256  NARPVQPTNKRVI  268



>gb|KDP44024.1| hypothetical protein JCGZ_05491 [Jatropha curcas]
Length=274

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 96/135 (71%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H ++G R+  E H+VH S DG++AV+ +MY IG  P+  LS + + L++++ T   +  +
Sbjct  132  HTIDGGRFALELHMVHESQDGKVAVVGIMYIIGR-PDSFLSSLTEKLREVSGTEEEETVV  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G ++P  ++   R+YYRY+GSLT PPCTE VVWT+ R +R+VTK+QV L+R A+HDE+ T
Sbjct  191  GIVNPKDIKIGSRKYYRYIGSLTVPPCTENVVWTISRKVRTVTKEQVELLRVAVHDEADT  250

Query  362  NARPLQTINDRFVKV  318
            NARPLQ  N R V++
Sbjct  251  NARPLQPTNGRSVQL  265



>ref|XP_008462825.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X1 [Cucumis melo]
Length=271

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  EAHLVH S +G  AV+ V+Y+IG  P+  LS ++++L++++ T   +K +
Sbjct  132  HTINGKRFALEAHLVHQSQNGNYAVIGVVYKIGR-PDSFLSKMKENLEEISNTHE-EKAL  189

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +D +LL+ +   YYRY+GSLTTPPC++ V+WT++R +R+VT +Q+ L+R A HD+S T
Sbjct  190  DVIDLSLLEMQSSLYYRYIGSLTTPPCSQNVLWTIVRKVRTVTVEQIKLLRVAAHDDSNT  249

Query  362  NARPLQTINDRFVKV  318
            NARPLQ INDR +++
Sbjct  250  NARPLQPINDRKIQL  264



>ref|XP_008462835.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X2 [Cucumis melo]
Length=270

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  EAHLVH S +G  AV+ V+Y+IG  P+  LS ++++L++++ T   +K +
Sbjct  131  HTINGKRFALEAHLVHQSQNGNYAVIGVVYKIGR-PDSFLSKMKENLEEISNTHE-EKAL  188

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +D +LL+ +   YYRY+GSLTTPPC++ V+WT++R +R+VT +Q+ L+R A HD+S T
Sbjct  189  DVIDLSLLEMQSSLYYRYIGSLTTPPCSQNVLWTIVRKVRTVTVEQIKLLRVAAHDDSNT  248

Query  362  NARPLQTINDRFVKV  318
            NARPLQ INDR +++
Sbjct  249  NARPLQPINDRKIQL  263



>ref|XP_006845947.1| hypothetical protein AMTR_s00157p00092470 [Amborella trichopoda]
 gb|ERN07622.1| hypothetical protein AMTR_s00157p00092470 [Amborella trichopoda]
Length=253

 Score =   139 bits (350),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 93/135 (69%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H  NG+RY  E HLVH S DG+ AV+ + Y+IG  P+  L  +  ++  +A++   +  +
Sbjct  106  HTFNGSRYHLEVHLVHQSKDGKNAVVGITYKIGR-PDTFLKELMGNISSIADSKNAEAQV  164

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRYMGSLTTPPCT+GV W +++ +R+V+++Q+ L+R A+HDE++ 
Sbjct  165  GVVDPRHIKMGSRKYYRYMGSLTTPPCTQGVAWNIVKKVRTVSREQLRLLRAAVHDEAEA  224

Query  362  NARPLQTINDRFVKV  318
            NARP Q IN R V +
Sbjct  225  NARPTQPINKRVVDL  239



>ref|XP_009356885.1| PREDICTED: alpha carbonic anhydrase 7-like [Pyrus x bretschneideri]
Length=275

 Score =   139 bits (351),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+D E HLVH S  G IAV  V+Y+IG  P+P LS I D L  +++T   ++ +
Sbjct  133  HTINGKRFDLEVHLVHESATGNIAVTGVLYRIG-APDPFLSSIMDYLADVSDTTEEEEVV  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++    +YYRY+GSLTTPPCT+ V+WT+ R + +V+++QV  +R A+HD+S T
Sbjct  192  GMVDPRQMKTSSTKYYRYIGSLTTPPCTQNVIWTIAREVSTVSEEQVKSLRVAVHDDSDT  251

Query  362  NARPLQTINDRFVKV  318
            NARP+Q  N R V++
Sbjct  252  NARPVQPRNRRIVQL  266



>sp|Q9FM99.2|ATCA8_ARATH RecName: Full=Alpha carbonic anhydrase 8; Short=AtaCA8; Short=AtalphaCA8; 
AltName: Full=Alpha carbonate dehydratase 8; Flags: 
Precursor [Arabidopsis thaliana]
Length=277

 Score =   139 bits (351),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 89/133 (67%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E HLVH S D R AV+A +Y +G + +P L  +E  LKK+ +T   ++ +
Sbjct  134  HTINGKRFALEEHLVHESKDKRYAVVAFLYNLGAS-DPFLFSLEKQLKKITDTHASEEHV  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  L    + YYRY GSLT PPC+E V+W+V + IR+V+ +QV L+R A+HD S +
Sbjct  193  GIIDPKKLSFESKHYYRYSGSLTAPPCSENVIWSVSKEIRTVSSKQVKLLRVAVHDASDS  252

Query  362  NARPLQTINDRFV  324
            NARPLQ +N R V
Sbjct  253  NARPLQAVNKRKV  265



>ref|XP_008778933.1| PREDICTED: alpha carbonic anhydrase 7-like [Phoenix dactylifera]
Length=273

 Score =   139 bits (350),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RY  E H+VH S D ++AV+ ++Y+IG  P+  L  +E+++ K+ +  G ++ +
Sbjct  132  HTLNGRRYAVEMHMVHESADQKVAVVGILYKIGR-PDSFLEEVEEEIMKIGDLTGEEEVL  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G ++P   +   R+YYRY+GSLT PPCTEGVVWT+I+ +R+V+++QV  +R A+HD+ + 
Sbjct  191  GMVNPRHAKWGSRKYYRYLGSLTVPPCTEGVVWTIIKKVRTVSRKQVDRLREAVHDDFEM  250

Query  362  NARPLQTINDRFVKV  318
            NARP+Q IN+R V +
Sbjct  251  NARPIQEINERTVSL  265



>ref|XP_009148066.1| PREDICTED: alpha carbonic anhydrase 7-like [Brassica rapa]
Length=272

 Score =   139 bits (350),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG R+  E H+VH   +GR+AV+ V+Y+IG     I SL E +L+ + +    +K +
Sbjct  134  HTVNGRRFALELHMVHEGKNGRMAVVTVLYKIGRADTFIRSL-EKELEAITDLDDAEKHV  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +DP  ++   R+YYRY+GSLTTPPCT+ V W+V+R IR+VT++QV L+R A+HD+S T
Sbjct  193  RMIDPKQIKIGSRKYYRYIGSLTTPPCTQNVTWSVVRKIRTVTREQVRLLRVAVHDDSLT  252

Query  362  NARPLQTINDRFVKV  318
            NARP+Q IN R V++
Sbjct  253  NARPVQPINKRVVRL  267



>gb|KFK32339.1| hypothetical protein AALP_AA6G228800 [Arabis alpina]
Length=271

 Score =   139 bits (350),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH S +G +AVL ++Y+IG  P+  L L+E+ L  + +    +K +
Sbjct  132  HTINGRRFALELHMVHESINGTMAVLTILYKIGR-PDSFLRLMENKLGAVTDQHEGEKNV  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R++YRY+GSLTTPPCT+ V WT+++ IR+VTK+Q+ L+R A+HD+S T
Sbjct  191  GMIDPQKIEIGSRKFYRYIGSLTTPPCTQNVTWTIVKKIRTVTKEQIRLLRVAVHDDSNT  250

Query  362  NARPLQTINDRFVKV  318
            NARP+Q  N R V +
Sbjct  251  NARPVQPTNMRVVHL  265



>ref|XP_006401345.1| hypothetical protein EUTSA_v10014359mg [Eutrema salsugineum]
 gb|ESQ42798.1| hypothetical protein EUTSA_v10014359mg [Eutrema salsugineum]
Length=275

 Score =   139 bits (350),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  EAHLVH S +G+ AV+A +Y +G  P+  L  ++  LK++ +T   +  +
Sbjct  136  HTINGKRFALEAHLVHESKNGKYAVVAFLYNVG-APDAFLLSLDRHLKRITDTHEGEANV  194

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  +    ++YYRY GSLT PPC+E V+W++ R IR+VT QQV L+R A+HD S T
Sbjct  195  GSIDPKKISFESKQYYRYSGSLTAPPCSENVLWSISRQIRTVTSQQVKLLRVAVHDASNT  254

Query  362  NARPLQTINDRFV  324
            NARPLQ IN R V
Sbjct  255  NARPLQPINKRVV  267



>ref|XP_004973662.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Setaria italica]
Length=277

 Score =   139 bits (350),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 95/135 (70%), Gaps = 0/135 (0%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H V+G RYD E HLVH S + + AV+A++Y+IG   +P+L  +E  ++++A+    ++ +
Sbjct  133  HTVDGRRYDLELHLVHESAEKKAAVIAILYEIGRGHDPLLHQMEPFIRQIADKRDREERV  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +DP  ++ R   YYRYMGSLT PPCTEGV+WT+++ + +V+K Q+ L+R A+HD+ + 
Sbjct  193  SVVDPRAVRGRASVYYRYMGSLTVPPCTEGVIWTIVKRVHTVSKYQLELLREAVHDDMEK  252

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +N R V +
Sbjct  253  NARPLQEVNSRDVSL  267



>ref|NP_001147028.1| carbonic anhydrase precursor [Zea mays]
 gb|ACF88000.1| unknown [Zea mays]
 gb|ACG25129.1| carbonic anhydrase precursor [Zea mays]
 gb|AFW61792.1| carbonic anhydrase [Zea mays]
Length=277

 Score =   139 bits (350),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H V+G RYD E HLVH S+  + AV+ ++Y+IG   +P L  +E  + ++A+    ++ I
Sbjct  135  HTVDGRRYDMELHLVHESSANKAAVIGMLYEIG-AEDPFLQALEPSIHRIADRQDREEAI  193

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP   + R   YYRY+GSLTTPPCTEGV+WTV++ +R+V++ Q+ L+R A+HD  + 
Sbjct  194  GVVDPRRARGRASVYYRYVGSLTTPPCTEGVIWTVVKRVRTVSRHQLELLREAVHDGMEK  253

Query  362  NARPLQTINDRFVKV  318
            NARP+Q +NDR + +
Sbjct  254  NARPVQDVNDRDISI  268



>ref|XP_008385339.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=275

 Score =   139 bits (349),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+D E HLVH S  G IAV  ++Y+IG  P+P LS I D L  +++T   ++ +
Sbjct  133  HTINGKRFDLEVHLVHESATGNIAVTGILYRIG-APDPFLSSIMDYLADVSDTTEDEEVV  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++    +YYRY+GSLTTPPCT+ V+WT+ R + +V+++QV  +R A+HD+S T
Sbjct  192  GMVDPRQMKTSSTKYYRYIGSLTTPPCTQNVIWTIAREVSTVSEEQVKALRVAVHDDSDT  251

Query  362  NARPLQTINDRFVKV  318
            NARP+Q  N R V++
Sbjct  252  NARPVQPRNRRIVQL  266



>dbj|BAD09854.1| putative dioscorin class A precursor [Oryza sativa Japonica Group]
 gb|EAZ07303.1| hypothetical protein OsI_29552 [Oryza sativa Indica Group]
 gb|EAZ43045.1| hypothetical protein OsJ_27633 [Oryza sativa Japonica Group]
Length=275

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H V+G RYD E H+VH S + + AV+ ++Y++G  P+  L  +E  LK +A+    ++ +
Sbjct  133  HSVDGRRYDMELHMVHESAEKKAAVIGLLYEVGR-PDRFLQKMEPYLKMIADKEDREEKV  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP   + R   YYRYMGSLTTPPCT+GVVWT+++ +R+V++ Q+ L+R A+HDE + 
Sbjct  192  GMIDPRGARGRASVYYRYMGSLTTPPCTQGVVWTIVKRVRTVSRYQLDLLREAVHDEMEN  251

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +N+R + +
Sbjct  252  NARPLQAVNNRDISI  266



>ref|XP_010109499.1| hypothetical protein L484_007519 [Morus notabilis]
 gb|EXC22910.1| hypothetical protein L484_007519 [Morus notabilis]
Length=274

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 96/135 (71%), Gaps = 3/135 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG ++D E H VH +  G+  V  ++YQ GE P+P LS +ED L+++++T   ++ I
Sbjct  133  HTINGNKFDLELHAVHQTPTGQTFVFGILYQFGE-PDPFLSSVEDYLEEISDTG--EEII  189

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +DPN ++   +RYY Y+GSLTTPPCTE VVW V   IR+V+++QV+L+R A+HD+S T
Sbjct  190  VVIDPNKIKIGSQRYYNYIGSLTTPPCTENVVWIVASEIRTVSREQVSLLRVAVHDDSDT  249

Query  362  NARPLQTINDRFVKV  318
            NARP+Q  N R VK+
Sbjct  250  NARPIQETNGRTVKL  264



>ref|XP_010046439.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW85766.1| hypothetical protein EUGRSUZ_B02522 [Eucalyptus grandis]
Length=278

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG R+D E H+VH S +G++AV+ +MY++G  P+  LS++   ++ +A+    +K +
Sbjct  132  HAVNGRRFDLELHMVHESLNGKVAVVGIMYKLGR-PDTFLSMMMKHIEDIADIHEAEKAV  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G ++P  ++   R+YYRY+GSLT PPCTE V+WT+++ +R+V ++QV L+R A+ D+S+ 
Sbjct  191  GIVNPKRIKIGSRKYYRYVGSLTVPPCTENVLWTIVQKVRTVAREQVKLLRKAVRDDSEF  250

Query  362  NARPLQTINDRFVKV  318
            NARPLQ IN R V++
Sbjct  251  NARPLQPINIRSVQL  265



>ref|XP_009113037.1| PREDICTED: alpha carbonic anhydrase 2-like [Brassica rapa]
Length=271

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 95/136 (70%), Gaps = 2/136 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH S +G +AV+ V+Y+IG  P+  L+L+E+ L  + + P  +K I
Sbjct  133  HTINGRRFALELHMVHESLNGSLAVVTVLYKIGR-PDSFLNLLENKLSAMTD-PNEEKNI  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPCT+ V+WTV++ +++V + QV L+R A+HD S T
Sbjct  191  GMIDPRGIKFGSRKYYRYIGSLTIPPCTQNVIWTVVKEVKTVARNQVKLLRVAVHDHSNT  250

Query  362  NARPLQTINDRFVKVD  315
            NARP+Q  N R VK +
Sbjct  251  NARPVQPTNMRVVKFN  266



>gb|ADW27480.1| carbonic anhydrase [Zea mays]
Length=277

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H V+G RYD E HLVH S+  + AV+ ++Y+IG   +P L  +E  + ++A+    ++ I
Sbjct  135  HTVDGRRYDMELHLVHESSANKAAVIGMLYEIG-GEDPFLQALEPSIHRIADRQDREEAI  193

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP   + R   YYRY+GSLTTPPCTEGV+WTV++ +R+V++ Q+ L+R A+HD  + 
Sbjct  194  GVVDPRRARGRASVYYRYVGSLTTPPCTEGVIWTVVKRVRTVSRHQLELLREAVHDGMEK  253

Query  362  NARPLQTINDRFVKV  318
            NARP+Q +NDR + +
Sbjct  254  NARPVQDVNDRDISI  268



>ref|XP_009148224.1| PREDICTED: alpha carbonic anhydrase 7-like [Brassica rapa]
Length=272

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG R+  E H+VH   +GR+AV+ V+Y+IG     I SL E +L+ + +    +K +
Sbjct  134  HTVNGRRFALELHMVHEGKNGRMAVVTVLYKIGRADTFIRSL-EKELEAITDLDDAEKHV  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +DP  ++   R+YYRY+GSLTTPPCT+ V W+V+R IR+VT++QV L+R A+HD+S T
Sbjct  193  RMIDPKQIKIGSRKYYRYIGSLTTPPCTQNVTWSVVRKIRTVTREQVRLLRVAVHDDSLT  252

Query  362  NARPLQTINDRFV  324
            NARP+Q IN R V
Sbjct  253  NARPVQPINKRMV  265



>emb|CDX95095.1| BnaC05g05760D [Brassica napus]
Length=272

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG R+  E H+VH   +GR+AV+ V+Y+IG     I SL E +L+ + +    +K +
Sbjct  134  HTVNGRRFALELHMVHEGKNGRMAVVTVLYKIGRADTFIRSL-EKELEAITDLDDAEKHV  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +DP  ++   R+YYRY+GSLTTPPCT+ V W+V+R IR+VT++QV L+R A+HD+S T
Sbjct  193  RMIDPKQIKIGSRKYYRYIGSLTTPPCTQNVTWSVVRKIRTVTREQVRLLRVAVHDDSLT  252

Query  362  NARPLQTINDRFVKV  318
            NARP+Q IN R V +
Sbjct  253  NARPVQPINKRMVHL  267



>ref|XP_010696305.1| PREDICTED: alpha carbonic anhydrase 7-like [Beta vulgaris subsp. 
vulgaris]
Length=276

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 101/135 (75%), Gaps = 2/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RYD E H+VH S D + AV+ ++Y+IG+ PN  LS + ++++ ++ET  ++  +
Sbjct  134  HTINGKRYDMELHMVHQSRDNQTAVIGLLYKIGK-PNHFLSKLMNNIRLISETT-LELDV  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G ++P+ ++  GR+YYRY+GSLTTPPCTEGV+WT+   I +V+++QV+L+R A+HD ++ 
Sbjct  192  GIINPSRIKMGGRKYYRYLGSLTTPPCTEGVIWTLNTQIGTVSEEQVSLLREAVHDHAEE  251

Query  362  NARPLQTINDRFVKV  318
            NARPLQ  N R +++
Sbjct  252  NARPLQRTNGRNMRL  266



>ref|XP_004973661.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Setaria italica]
Length=285

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H V+G +YD E HLVH S +G+ AV+ V+Y++G   +  L  +E  + ++A+    ++ +
Sbjct  143  HTVDGRQYDMELHLVHQSAEGKAAVIGVLYEVG-AHDAFLHALEPAIHRIADRRDREEPV  201

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP   + R   YYRYMGSLTTPPCTEGV+WT+++ +R+V+K Q+ L+R A+HD+ + 
Sbjct  202  GVVDPRGARGRASVYYRYMGSLTTPPCTEGVIWTIVKRVRTVSKYQLELLREAVHDDMEK  261

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +NDR + +
Sbjct  262  NARPLQEVNDRDISI  276



>ref|XP_008226047.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3 [Prunus mume]
Length=275

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 93/135 (69%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VN   +D E HL+H S  G+IAV  ++Y+IGE P+P L+ I D L  ++ T   +K +
Sbjct  133  HTVNDKSFDLEVHLLHQSPTGKIAVTGILYKIGE-PDPFLTSIMDYLADISGTSEKQKVV  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++    +YYRY+GSLT PPCT+ V+WT++  +RSV+ +QV L+R A+HDES T
Sbjct  192  GMVDPKQIKTGSIKYYRYIGSLTIPPCTQDVIWTIVEKVRSVSSEQVKLLRVAVHDESDT  251

Query  362  NARPLQTINDRFVKV  318
            NARP+Q  N R V++
Sbjct  252  NARPVQPRNGRVVQL  266



>ref|XP_006659489.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Oryza brachyantha]
Length=276

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H V+G RYD E H+VH S + + AV+ ++Y++G  P+  L  +E  L+ +A+    ++ +
Sbjct  134  HSVDGRRYDMELHMVHESAEKKAAVIGLLYEVGR-PDRFLQKMEPYLRMIADKEDKEEKV  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP   + R   YYRYMGSLTTPPCTEGV+WT+++ +R+V+K Q+ L+R A+HD  + 
Sbjct  193  GVIDPRGARGRASVYYRYMGSLTTPPCTEGVIWTIVKRVRTVSKYQLELLREAVHDNMEN  252

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +N+R V +
Sbjct  253  NARPLQAVNNRDVSI  267



>ref|XP_006417733.1| hypothetical protein EUTSA_v10008451mg [Eutrema salsugineum]
 gb|ESQ36086.1| hypothetical protein EUTSA_v10008451mg [Eutrema salsugineum]
Length=274

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H + G R+  E H+VH S DGRIAV+A +Y++G  P+  L  +E  LK++ +T   ++ I
Sbjct  134  HTIGGRRFVLEEHVVHESKDGRIAVVAFLYKLGR-PDSFLLSLESQLKRITDTHESEEYI  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +DP  +    R YYRY+GSLTTPPC+E V+W++ + +R+VT +Q+ L+R A+HD+S T
Sbjct  193  RMVDPIRVNFESRLYYRYLGSLTTPPCSENVIWSISKEMRTVTIKQLELLRVAVHDQSNT  252

Query  362  NARPLQTINDRFVKV  318
            NARPLQ IN+R VK+
Sbjct  253  NARPLQRINERLVKL  267



>ref|XP_011040911.1| PREDICTED: alpha carbonic anhydrase 7-like [Populus euphratica]
Length=274

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R   E H+VH S DG++AV+ ++Y+IG  P+  LS + + L+ +A T      +
Sbjct  133  HTINGKRLALEVHMVHESLDGKVAVVGILYKIGR-PDSFLSSLTEQLQSVAGTNERDTVV  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPCTE V+WT+++ +R+ T++QV L+R A+HD+S T
Sbjct  192  GIVDPRNIKIGSRKYYRYLGSLTIPPCTENVLWTIVKKVRTATREQVRLLRVAVHDDSDT  251

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +N R VK+
Sbjct  252  NARPLQPLNSRPVKL  266



>gb|AFK36418.1| unknown [Lotus japonicus]
Length=280

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 97/139 (70%), Gaps = 5/139 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVH----VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +NG RY+ E H+VH    ++   +IAV+ VMY IG+ P+P+L+ +   +K +      
Sbjct  136  HTINGRRYELELHMVHESRKINGKSKIAVVGVMYNIGQ-PDPVLNKLSKYIKSMGSDHEA  194

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            +K IG +DP+ ++  G++YYRY+GSLT PPCTEGV+WT+ + IRSV+K Q+  +R A+H+
Sbjct  195  EKSIGVMDPSEIKLGGKKYYRYVGSLTIPPCTEGVIWTINKKIRSVSKAQINFLREAVHN  254

Query  374  ESKTNARPLQTINDRFVKV  318
             ++ NARP Q++N R +++
Sbjct  255  HAQRNARPAQSLNRRGIQL  273



>ref|XP_010510675.1| PREDICTED: alpha carbonic anhydrase 7-like isoform X2 [Camelina 
sativa]
Length=248

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 92/135 (68%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E HLVH + +G +AV+ V+Y+IG  P+  L  +E  L  + +    +K +
Sbjct  109  HTINGRRFALELHLVHENINGSLAVVTVLYKIGR-PDSFLESLEKKLSVITDQNEAEKNV  167

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +DP  +Q   R++YRY+GSLTTPPCT+ V+WTV++ +R+VTK QV L+R A+HD   T
Sbjct  168  EMIDPRNIQIGSRKFYRYLGSLTTPPCTQNVIWTVVKKVRTVTKSQVKLLRVAVHDNYDT  227

Query  362  NARPLQTINDRFVKV  318
            NARP+Q IN R VK+
Sbjct  228  NARPVQPINKRVVKL  242



>emb|CDY45963.1| BnaA09g13030D [Brassica napus]
Length=271

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 95/136 (70%), Gaps = 2/136 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH S +G +AV+ V+Y+IG  P+  L+L+E+ L  + + P  +K I
Sbjct  133  HTINGRRFALELHMVHESLNGSLAVVTVLYKIGR-PDSFLNLLENKLSAMTD-PNEEKNI  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPCT+ V+WTV++ +++V + QV ++R A+HD S T
Sbjct  191  GMIDPRGIKFGSRKYYRYIGSLTIPPCTQNVIWTVVKEVKTVARNQVKILRVAVHDHSNT  250

Query  362  NARPLQTINDRFVKVD  315
            NARP+Q  N R VK +
Sbjct  251  NARPVQPTNMRVVKFN  266



>emb|CDY04545.1| BnaA07g13710D [Brassica napus]
Length=272

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH S +G +AV+ V+Y+IG + +  L+L+E+ L  + +    +  I
Sbjct  133  HTINGRRFALELHMVHESINGSMAVVTVLYKIGRS-DSFLTLLENKLSAMTDQNEAEFNI  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLTTPPCT+ + WTV++ +R+V + QV L+R A+HD+S T
Sbjct  192  GMIDPKEIKIGSRKYYRYVGSLTTPPCTQNITWTVVKKVRTVARNQVRLLRVAVHDDSNT  251

Query  362  NARPLQTINDRFVKV  318
            NARP+Q  N R VK+
Sbjct  252  NARPVQPTNKRVVKL  266



>ref|XP_008664513.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3 [Zea mays]
 tpg|DAA48424.1| TPA: hypothetical protein ZEAMMB73_580242 [Zea mays]
Length=298

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 93/135 (69%), Gaps = 0/135 (0%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H V+G RYD E HLVH S + + AV+AV+Y+IG   + +L  +E  ++++A+    +  +
Sbjct  155  HTVDGRRYDMELHLVHESAENKAAVIAVLYEIGGHDDALLRQLEPAIRRVADVRDREMRV  214

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP   + R   YYRY+GSLT PPCTEGV+WT+++ +RSV+K Q+ L+R A+HD+ + 
Sbjct  215  GVVDPRRARGRASVYYRYVGSLTAPPCTEGVIWTIVKRVRSVSKHQLELLREAVHDDMEN  274

Query  362  NARPLQTINDRFVKV  318
            NARPLQ  N R V +
Sbjct  275  NARPLQEANHRDVSM  289



>emb|CDY45480.1| BnaC09g12980D [Brassica napus]
Length=271

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 95/136 (70%), Gaps = 2/136 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH S +G +AV+ V+Y+IG  P+  L+L+E+ L  + + P  +K I
Sbjct  133  HTINGRRFALELHMVHESLNGSLAVVTVLYKIGR-PDSFLNLLENKLSAMTD-PNEEKNI  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPCT+ V+WTV++ +++V + QV ++R A+HD S T
Sbjct  191  GMIDPRGIKFGSRKYYRYIGSLTIPPCTQNVIWTVVKEVKTVARNQVKILRVAVHDHSNT  250

Query  362  NARPLQTINDRFVKVD  315
            NARP+Q  N R VK +
Sbjct  251  NARPVQPTNMRVVKFN  266



>ref|XP_009103655.1| PREDICTED: alpha carbonic anhydrase 2 [Brassica rapa]
 emb|CDX71369.1| BnaC04g16040D [Brassica napus]
Length=272

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH S +G +AV+ V+Y+IG + +  L+L+E+ L  + +    +  I
Sbjct  133  HTINGRRFALELHMVHESINGSMAVVTVLYKIGRS-DSFLTLLENKLSAMTDQNEAEFNI  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLTTPPCT+ + WTV++ +R+V + QV L+R A+HD+S T
Sbjct  192  GMIDPKEIKIGSRKYYRYVGSLTTPPCTQNITWTVVKKVRTVARNQVRLLRVAVHDDSNT  251

Query  362  NARPLQTINDRFVKV  318
            NARP+Q  N R VK+
Sbjct  252  NARPVQPTNKRVVKL  266



>ref|XP_010510674.1| PREDICTED: alpha carbonic anhydrase 2-like isoform X1 [Camelina 
sativa]
Length=278

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 92/135 (68%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E HLVH + +G +AV+ V+Y+IG  P+  L  +E  L  + +    +K +
Sbjct  139  HTINGRRFALELHLVHENINGSLAVVTVLYKIGR-PDSFLESLEKKLSVITDQNEAEKNV  197

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +DP  +Q   R++YRY+GSLTTPPCT+ V+WTV++ +R+VTK QV L+R A+HD   T
Sbjct  198  EMIDPRNIQIGSRKFYRYLGSLTTPPCTQNVIWTVVKKVRTVTKSQVKLLRVAVHDNYDT  257

Query  362  NARPLQTINDRFVKV  318
            NARP+Q IN R VK+
Sbjct  258  NARPVQPINKRVVKL  272



>ref|XP_010470128.1| PREDICTED: alpha carbonic anhydrase 2-like isoform X2 [Camelina 
sativa]
Length=276

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 92/135 (68%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH S +G +AV+ V+Y+IG  PN  L L+E  L  + +    ++ +
Sbjct  137  HTINGXRFALELHMVHESKNGSMAVVTVLYKIGR-PNSFLKLLEHKLVAITDQHDAERNV  195

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +DP+ ++   R YYRY+GSLTTPPCT+ + WT+++ IR+V+K QV L+R A+HD+S +
Sbjct  196  VMIDPSKIKTESRNYYRYIGSLTTPPCTQNITWTILKKIRTVSKSQVNLLRVAVHDDSNS  255

Query  362  NARPLQTINDRFVKV  318
            NARP+Q  N R + +
Sbjct  256  NARPVQPANKRVIHL  270



>emb|CDY23976.1| BnaC03g17150D [Brassica napus]
Length=272

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 93/135 (69%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH S +G +AV+ V+Y+IG  P+  LSL+E+ L  + +    +  I
Sbjct  133  HTINGRRFALELHMVHESANGSLAVVTVLYKIGR-PDSFLSLLENKLCAITDHNEAEVNI  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPCT+ V+WTVI+ +R+V + QV L+R A+HD S T
Sbjct  192  GMIDPKDIKFGSRKYYRYIGSLTIPPCTQNVIWTVIKKVRTVARHQVKLLRVAVHDYSDT  251

Query  362  NARPLQTINDRFVKV  318
            NARP+Q  N R VK+
Sbjct  252  NARPVQPTNKRPVKL  266



>ref|XP_004139553.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
 ref|XP_004160915.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=274

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  EAHLVH S  G+IAV+ ++Y IG+ P+  LS +   L +++ T    K +
Sbjct  132  HTINGRRFALEAHLVHQSQTGKIAVIGILYNIGQ-PDYFLSTMRQHLVEISGTQR-DKLL  189

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              ++P+LL+ R   YYRY+GSLT PPC++ V+WT++R +R+VT +QV L+R A+HD+S+T
Sbjct  190  NMVNPSLLKMRSSLYYRYIGSLTVPPCSQNVLWTIVRKVRTVTPEQVNLLRVAVHDDSET  249

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +N+R V++
Sbjct  250  NARPLQPLNNRNVQL  264



>gb|KGN64826.1| hypothetical protein Csa_1G120420 [Cucumis sativus]
Length=275

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  EAHLVH S  G+IAV+ ++Y IG+ P+  LS +   L +++ T    K +
Sbjct  133  HTINGRRFALEAHLVHQSQTGKIAVIGILYNIGQ-PDYFLSTMRQHLVEISGTQR-DKLL  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              ++P+LL+ R   YYRY+GSLT PPC++ V+WT++R +R+VT +QV L+R A+HD+S+T
Sbjct  191  NMVNPSLLKMRSSLYYRYIGSLTVPPCSQNVLWTIVRKVRTVTPEQVNLLRVAVHDDSET  250

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +N+R V++
Sbjct  251  NARPLQPLNNRNVQL  265



>gb|AAD29832.1| putative carbonic anhydrase [Arabidopsis thaliana]
Length=248

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH + +G +AV+ V+Y+IG  P+  L L+E+ L  + +    +K +
Sbjct  109  HTMNGRRFALELHMVHENINGSLAVVTVLYKIGR-PDSFLGLLENKLSAITDQNEAEKYV  167

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +DP  ++   R++YRY+GSLTTPPCT+ V+WTV++ +R+VTK QV L+R A+HD S T
Sbjct  168  DVIDPRDIKIGSRKFYRYIGSLTTPPCTQNVIWTVVKKVRTVTKNQVKLLRVAVHDNSDT  227

Query  362  NARPLQTINDRFVKV  318
            NARP+Q  N R VK+
Sbjct  228  NARPVQPTNKRVVKL  242



>ref|XP_011077301.1| PREDICTED: alpha carbonic anhydrase 7-like [Sesamum indicum]
Length=278

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 96/137 (70%), Gaps = 5/137 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +NG RYD E HLVH++ D     +IAV+ V Y+IG+ PN  LS +  +++ + +    
Sbjct  134  HTINGRRYDLELHLVHLNTDPNVKNKIAVIGVFYKIGK-PNQFLSKLMTNIRSMIDKKDE  192

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            +K +G +DP  ++ R +RYYRYMGSLT PPCTEGV+WT+ + +++V++ QV L+R A+HD
Sbjct  193  EKILGMIDPEDIKIRSKRYYRYMGSLTVPPCTEGVIWTINKKVKTVSRDQVKLLREAVHD  252

Query  374  ESKTNARPLQTINDRFV  324
             ++ NARPLQ  ++R V
Sbjct  253  YAEENARPLQPKHNRDV  269



>ref|XP_004973745.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Setaria italica]
Length=282

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 91/135 (67%), Gaps = 0/135 (0%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H V+G RY  E HLVH + + + AV+ V Y+ G  P+  L  +E  ++++ +T   ++ I
Sbjct  139  HTVDGRRYVMELHLVHQTTENKTAVIGVFYETGNIPDLFLKTLEPSIRRIGDTRDREEPI  198

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DPN  +A G  YYRYMGSLTTPPCTEGVVWTV +T+R V K Q+ ++R A+ D  + 
Sbjct  199  GVVDPNGARATGSVYYRYMGSLTTPPCTEGVVWTVFKTVRHVAKYQLDILREAVADGYED  258

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +N+R + +
Sbjct  259  NARPLQEVNNRDISI  273



>ref|XP_009132759.1| PREDICTED: alpha carbonic anhydrase 2-like [Brassica rapa]
Length=268

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH S +G +AV+ V+Y+IG  P+  LSL+E+ L  + +    +  I
Sbjct  129  HTINGRRFALELHMVHESINGSMAVVTVLYKIGR-PDSFLSLLENKLCAITDHNEAEINI  187

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPCT+ V+WTVI+ +R+V++ QV L+R A+HD S T
Sbjct  188  GMIDPKDIKFGSRKYYRYIGSLTIPPCTQNVIWTVIKKVRTVSRNQVKLLRVAVHDYSDT  247

Query  362  NARPLQTINDRFVKV  318
            NARP+Q  N R VK+
Sbjct  248  NARPVQPTNMRTVKL  262



>ref|XP_010470127.1| PREDICTED: alpha carbonic anhydrase 2-like isoform X1 [Camelina 
sativa]
Length=277

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH S +G +AV+ V+Y+IG  PN  L L+E  L  + +    ++ +
Sbjct  138  HTINGRRFALELHMVHESKNGSMAVVTVLYKIGR-PNSFLKLLEHKLVAITDQHDAERNV  196

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +DP+ ++   R YYRY+GSLTTPPCT+ + WT+++ IR+V+K QV L+R A+HD+S +
Sbjct  197  VMIDPSKIKTESRNYYRYIGSLTTPPCTQNITWTILKKIRTVSKSQVNLLRVAVHDDSNS  256

Query  362  NARPLQTINDRFV  324
            NARP+Q  N R +
Sbjct  257  NARPVQPANKRVI  269



>ref|XP_007144378.1| hypothetical protein PHAVU_007G151300g [Phaseolus vulgaris]
 gb|ESW16372.1| hypothetical protein PHAVU_007G151300g [Phaseolus vulgaris]
Length=279

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 98/139 (71%), Gaps = 6/139 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDG----RIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +NG RYD E H+VH S       +IAV+ ++++IG  P+PILS + + +K + E   V
Sbjct  136  HTINGRRYDLELHMVHESKSKNGKTKIAVVGILFKIGR-PDPILSKLSEIIKSMGENE-V  193

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            +K IG  DP+ ++  G++YYRY+GSLT PPCTEGV+WT+ + I++V++ QV L+R A+HD
Sbjct  194  EKKIGVFDPSEIKLGGKKYYRYIGSLTVPPCTEGVIWTINKKIKTVSRAQVNLLREAVHD  253

Query  374  ESKTNARPLQTINDRFVKV  318
             ++ N+RP Q +N R +++
Sbjct  254  HAELNSRPRQALNKRGIQL  272



>ref|XP_007144380.1| hypothetical protein PHAVU_007G151500g [Phaseolus vulgaris]
 gb|ESW16374.1| hypothetical protein PHAVU_007G151500g [Phaseolus vulgaris]
Length=280

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 90/131 (69%), Gaps = 1/131 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG +YD E H+VHVS + +I V+   Y+IG  P+  LS +E ++  L +   V++ I
Sbjct  136  HSINGRKYDLEMHMVHVSQEKKILVVGAFYKIGHRPDRFLSQLEKEIVHLVDEE-VEREI  194

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G  +P+ +Q RG  YYRY+GSLTTPPCTEGV+W + R IR+V++ QV L+R A+HD ++ 
Sbjct  195  GERNPSGIQTRGNMYYRYLGSLTTPPCTEGVIWNIDRKIRTVSEAQVRLLREAVHDHAQR  254

Query  362  NARPLQTINDR  330
            N+RP Q  N R
Sbjct  255  NSRPRQPRNQR  265



>ref|XP_003538184.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3 [Glycine max]
 gb|KHN38744.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=279

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 99/137 (72%), Gaps = 5/137 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H ++G R+D E H+VH ++ G IAV+ ++Y+ G  P+P+LSL+ + +K +++  G +  +
Sbjct  133  HTIDGRRFDLELHMVHEASSGEIAVIGMLYKAGR-PDPLLSLLGNHIKAISDCTGAEIEL  191

Query  542  GYLDPNLLQ-ARGR-RYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES  369
            G LDP L+   R R +YYRY GSLTTPPCTE V WTV+  +R V+++Q+ L+R A+HD+S
Sbjct  192  GVLDPWLVSICRSRTQYYRYSGSLTTPPCTENVAWTVLTEVRYVSREQIRLLRVAVHDDS  251

Query  368  KTNARPLQTINDRFVKV  318
              NARPLQ IN+R VK+
Sbjct  252  --NARPLQPINNRLVKL  266



>ref|NP_172287.1| alpha carbonic anhydrase 7 [Arabidopsis thaliana]
 sp|Q8L817.1|ATCA7_ARATH RecName: Full=Alpha carbonic anhydrase 7; Short=AtaCA7; Short=AtalphaCA7; 
AltName: Full=Alpha carbonate dehydratase 7; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAM67440.1| putative storage protein [Arabidopsis thaliana]
 gb|AEE28240.1| alpha carbonic anhydrase 7 [Arabidopsis thaliana]
Length=275

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 93/135 (69%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH   + R+AV+ V+Y+IG     I SL E +L+ +AE    +K +
Sbjct  137  HTINGRRFALELHMVHEGRNRRMAVVTVLYKIGRADTFIRSL-EKELEGIAEMEEAEKNV  195

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY GSLTTPPCT+ V W+V+R +R+VT++QV L+R A+HD++ +
Sbjct  196  GMIDPTKIKIGSRKYYRYTGSLTTPPCTQNVTWSVVRKVRTVTRKQVKLLRVAVHDDANS  255

Query  362  NARPLQTINDRFVKV  318
            NARP+Q  N R V +
Sbjct  256  NARPVQPTNKRIVHL  270



>gb|KEH42156.1| eukaryotic-type carbonic anhydrase [Medicago truncatula]
Length=286

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 94/134 (70%), Gaps = 4/134 (3%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSND---GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK  552
            H +NG +YD E H+VH+S +    +IAV+   ++IG  PN  LS +E+D+K + +    +
Sbjct  136  HSINGRKYDLEMHMVHISPNPKGNKIAVVGAFFKIGR-PNSFLSQLEEDIKHMVDEEEEE  194

Query  551  KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE  372
            + IG  DP+ +Q +G+ YYRY+GSLTTPPCTEGV+W + + IR+V+K QV L+R A+HD 
Sbjct  195  RVIGDKDPSQIQTKGKIYYRYVGSLTTPPCTEGVMWNLDKKIRTVSKAQVDLLRQAVHDH  254

Query  371  SKTNARPLQTINDR  330
            ++ NARP Q  N+R
Sbjct  255  AEMNARPRQPHNNR  268



>ref|XP_008227262.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X1 [Prunus mume]
Length=281

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 96/139 (69%), Gaps = 6/139 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +NG RYD E H+VH+S D     +IAV+A +Y+IG  P+  LS +  D+K + +    
Sbjct  135  HSINGRRYDMELHMVHLSPDPNVTNKIAVVAALYKIGR-PDSFLSKLTRDIKSMTDQ-KE  192

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            ++  G +DPN ++  G+ YYRYMGSLT PPCTEGV+WT+ + IR+V++ QV L R A+HD
Sbjct  193  ERSAGIIDPNKIKIPGKSYYRYMGSLTVPPCTEGVIWTINKKIRTVSRDQVKLFRVAVHD  252

Query  374  ESKTNARPLQTINDRFVKV  318
             ++TNARP+Q +N R + V
Sbjct  253  YAETNARPVQPLNLREIHV  271



>ref|XP_002445624.1| hypothetical protein SORBIDRAFT_07g022880 [Sorghum bicolor]
 gb|EES15119.1| hypothetical protein SORBIDRAFT_07g022880 [Sorghum bicolor]
Length=280

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 93/135 (69%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H V+G RYD E HLVH +   + AV+ ++Y+IG   +P L  +E  + ++A+    ++ +
Sbjct  138  HTVDGRRYDMELHLVHQTLANKTAVIGILYEIGGE-DPFLQALEPFIHRIADRKDREEPV  196

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP   + R   YYRYMGSLTTPPCTEGV+WTV++ +R+V+K Q+ L+R A+HD  + 
Sbjct  197  GVVDPRRARGRASVYYRYMGSLTTPPCTEGVIWTVVKRVRTVSKHQMELLREAVHDGMEK  256

Query  362  NARPLQTINDRFVKV  318
            NARP+Q +NDR + +
Sbjct  257  NARPVQDVNDRDISI  271



>ref|XP_011044411.1| PREDICTED: alpha carbonic anhydrase 7-like [Populus euphratica]
Length=274

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 91/135 (67%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R   E H+VH S DG++AV+ +MY IG  P+  LS +   L+ +A T       
Sbjct  133  HTINGKRLALEVHMVHESLDGKVAVVGIMYMIGR-PDSFLSSLTKQLQLVAGTYERDTVA  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRYMGSLT PPCTE V+WT++R +R+ T++QV ++R A+HDES T
Sbjct  192  GVVDPRNIKIGSRKYYRYMGSLTIPPCTENVLWTIVRKVRTATREQVRMLRVAVHDESDT  251

Query  362  NARPLQTINDRFVKV  318
            NAR +Q IN R VK+
Sbjct  252  NARQIQPINSRTVKL  266



>ref|XP_007144381.1| hypothetical protein PHAVU_007G151500g [Phaseolus vulgaris]
 gb|ESW16375.1| hypothetical protein PHAVU_007G151500g [Phaseolus vulgaris]
Length=295

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 90/131 (69%), Gaps = 1/131 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG +YD E H+VHVS + +I V+   Y+IG  P+  LS +E ++  L +   V++ I
Sbjct  151  HSINGRKYDLEMHMVHVSQEKKILVVGAFYKIGHRPDRFLSQLEKEIVHLVDEE-VEREI  209

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G  +P+ +Q RG  YYRY+GSLTTPPCTEGV+W + R IR+V++ QV L+R A+HD ++ 
Sbjct  210  GERNPSGIQTRGNMYYRYLGSLTTPPCTEGVIWNIDRKIRTVSEAQVRLLREAVHDHAQR  269

Query  362  NARPLQTINDR  330
            N+RP Q  N R
Sbjct  270  NSRPRQPRNQR  280



>emb|CDX94018.1| BnaC07g36520D [Brassica napus]
Length=268

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 95/131 (73%), Gaps = 4/131 (3%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNGTRYD E H+VH S  GRIAV+ V+Y++G+ PN  L+ + D LK + +    +K +
Sbjct  133  HTVNGTRYDLELHMVHTSARGRIAVIGVLYKLGK-PNEFLTRLLDGLKTVGKE---EKDL  188

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++ + +++YRY+GSLT PPCTEGV+WTV++ + +++ +Q+A +RNA+ D  +T
Sbjct  189  GIVDPRTIRFQTKKFYRYIGSLTVPPCTEGVIWTVVKRVNTISVEQIAALRNAVDDGYET  248

Query  362  NARPLQTINDR  330
            N+RP+Q  N R
Sbjct  249  NSRPVQDTNGR  259



>ref|XP_006594167.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=282

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 95/139 (68%), Gaps = 7/139 (5%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +NG RYD E H+VH S +     + AV+ + Y+IG  P+P+L  +   +K +    G 
Sbjct  140  HTINGRRYDLELHMVHESKNIKGKTKFAVVGLFYKIGR-PDPVLKKLSKFIKTMVY--GE  196

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            +K IG  DP+ ++  G++YYRYMGSLT PPCTEGV+WT+ + IR+V++ QV L+R A+HD
Sbjct  197  EKNIGVFDPSKIKLGGKKYYRYMGSLTVPPCTEGVIWTINKKIRTVSRAQVKLLREAVHD  256

Query  374  ESKTNARPLQTINDRFVKV  318
             ++ NARP+Q IN R +++
Sbjct  257  HAEKNARPIQPINRRGIQL  275



>gb|KHN48240.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=282

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 95/139 (68%), Gaps = 7/139 (5%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +NG RYD E H+VH S +     + AV+ + Y+IG  P+P+L  +   +K +    G 
Sbjct  140  HTINGRRYDLELHMVHESKNIKGKTKFAVVGLFYKIGR-PDPVLKKLSKFIKTMVY--GE  196

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            +K IG  DP+ ++  G++YYRYMGSLT PPCTEGV+WT+ + IR+V++ QV L+R A+HD
Sbjct  197  EKNIGVFDPSKIKLGGKKYYRYMGSLTVPPCTEGVIWTINKKIRTVSRAQVKLLREAVHD  256

Query  374  ESKTNARPLQTINDRFVKV  318
             ++ NARP+Q IN R +++
Sbjct  257  HAEKNARPIQPINRRGIQL  275



>ref|XP_010443286.1| PREDICTED: alpha carbonic anhydrase 8-like [Camelina sativa]
 ref|XP_010443287.1| PREDICTED: alpha carbonic anhydrase 8-like [Camelina sativa]
 ref|XP_010443289.1| PREDICTED: alpha carbonic anhydrase 8-like [Camelina sativa]
Length=355

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RY  E HLVH S D R AV+A +Y++G + +P L  ++  LKK+ +    ++ +
Sbjct  205  HTINGKRYALEKHLVHESEDERYAVVAFLYKLGAS-DPFLLSLDKQLKKITDAHESEEHV  263

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  L    + YYRY+GSLT PPC++ V+W+V + IR+VT +QV L+R A+HD S +
Sbjct  264  GIIDPKKLSFESKLYYRYIGSLTAPPCSDNVIWSVAKEIRTVTSKQVKLLRVAVHDASNS  323

Query  362  NARPLQTINDRFV  324
            NARPLQ IN R V
Sbjct  324  NARPLQPINKRVV  336



>emb|CDX93593.1| BnaA06g04550D [Brassica napus]
Length=547

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG R+  E H+VH   +GR+AV+ V+Y+IG     I SL E +L+ + +    +K +
Sbjct  134  HTVNGRRFALELHMVHEGKNGRMAVVTVLYKIGRADTFIRSL-EKELEAITDLDDAEKHV  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +DP  ++   R+YYRY+GSLTTPPCT+ V W+V+R IR+VT++QV L+R A+HD+S T
Sbjct  193  RMIDPKQIKIGSRKYYRYIGSLTTPPCTQNVTWSVVRKIRTVTREQVRLLRVAVHDDSLT  252

Query  362  NARPLQTINDRFVKV  318
            NARP+Q IN R V++
Sbjct  253  NARPVQPINKRVVRL  267


 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG R+  E H+VH   +GR+AV+ V+Y+IG     I SL E +L+ + +    +K +
Sbjct  409  HTVNGRRFALELHMVHEGKNGRMAVVTVLYKIGRADTFIRSL-EKELEAITDLDDAEKHV  467

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +DP  ++   R+YYRY+GSLTTPPCT+ V W+V+R IR+VT++QV L+R A+HD+S T
Sbjct  468  RMIDPKQIKIGSRKYYRYIGSLTTPPCTQNVTWSVVRKIRTVTREQVRLLRVAVHDDSLT  527

Query  362  NARPLQTINDRFV  324
            NARP+Q IN R V
Sbjct  528  NARPVQPINKRMV  540



>ref|XP_008462774.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=276

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG ++  EAHLVH S++G IAV+ ++YQ G  P+  LS I++ L++++ET    + +
Sbjct  133  HTINGEKFALEAHLVHQSHNGHIAVIGILYQFGH-PDYFLSTIKEHLEEISETNEYIE-V  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +DP+LL+     YY+Y GSLTTPPCT+ V+W + + +RSV   QV L+R A+HD+S T
Sbjct  191  NDIDPSLLRMDISSYYQYFGSLTTPPCTQNVLWIIAKKVRSVAPSQVELLRVAVHDDSNT  250

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +N+R +++
Sbjct  251  NARPLQPLNNRMIQL  265



>gb|EEE68846.1| hypothetical protein OsJ_27636 [Oryza sativa Japonica Group]
Length=272

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 91/135 (67%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG RYD E HLVH   +   AV+  +YQIG  P+P L ++E  ++++A+T    + I
Sbjct  131  HTVNGRRYDMELHLVHDDGNSNTAVIGNLYQIG-NPDPFLLMLEPFIRRIADTKDKSEPI  189

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP L ++    YYRYMGSLTTPPCTEGV+WTV +  ++V + Q+ L+R A+ D  + 
Sbjct  190  GVVDPQLAKSPDAVYYRYMGSLTTPPCTEGVIWTVFKRAQTVAQYQLDLLREAVADGYEN  249

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +N+R + +
Sbjct  250  NARPLQKVNNRNISI  264



>ref|XP_002314288.2| hypothetical protein POPTR_0009s01540g [Populus trichocarpa]
 gb|EEE88243.2| hypothetical protein POPTR_0009s01540g [Populus trichocarpa]
Length=277

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 91/135 (67%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R   E H+VH S DG++AV+ +MY IG  P+  LS +   L+ +A T       
Sbjct  136  HTINGKRLALEVHMVHESLDGKVAVVGIMYMIGR-PDSFLSSLTKQLQSVAGTYERDTVA  194

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPCTE V+WT++R +R+ T++QV ++R A+HDES T
Sbjct  195  GVVDPRNIKIGSRKYYRYIGSLTIPPCTENVLWTIVRKVRTATREQVRMLRVAVHDESDT  254

Query  362  NARPLQTINDRFVKV  318
            NAR +Q IN R VK+
Sbjct  255  NARQIQPINSRTVKL  269



>gb|EYU41598.1| hypothetical protein MIMGU_mgv1a011586mg [Erythranthe guttata]
Length=277

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 96/137 (70%), Gaps = 5/137 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDG----RIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +NG RYD E H+VH++ D     +IAV+ ++Y+IG+ P+  LS +  ++  + +    
Sbjct  133  HTINGRRYDMELHMVHLNTDSNVTTKIAVVGILYKIGK-PDKFLSKLMRNISSIVDNKDE  191

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            +  IG ++PN ++ R +RYYRYMGSLT PPCTEGV+WT+ + +++V+++QV L+R A+HD
Sbjct  192  QVNIGMINPNDIKLRSKRYYRYMGSLTVPPCTEGVIWTLNKKVKTVSREQVNLLREAVHD  251

Query  374  ESKTNARPLQTINDRFV  324
             ++ NARPLQ  N R +
Sbjct  252  YAEVNARPLQPHNKRGI  268



>ref|XP_007211988.1| hypothetical protein PRUPE_ppa010973mg [Prunus persica]
 gb|EMJ13187.1| hypothetical protein PRUPE_ppa010973mg [Prunus persica]
Length=228

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 97/139 (70%), Gaps = 6/139 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +NG RYD E H+VH+S +     +IAV+A +Y+IG  P+  L+ +  D++ + +    
Sbjct  82   HSINGRRYDMELHMVHLSPNPNVTNKIAVVAALYKIGR-PDSFLTKLTRDIQSMTDQKE-  139

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            ++ +G +DPN ++  G+ YYRYMGSLT PPCTEGV+WT+ + IR+V++ QV L R A+HD
Sbjct  140  ERSVGIIDPNKIKIPGKSYYRYMGSLTVPPCTEGVIWTINKKIRTVSRDQVKLFRVAVHD  199

Query  374  ESKTNARPLQTINDRFVKV  318
             ++TNARP+Q +N R + V
Sbjct  200  YAETNARPVQPLNLREIHV  218



>ref|XP_007206520.1| hypothetical protein PRUPE_ppa019410mg [Prunus persica]
 gb|EMJ07719.1| hypothetical protein PRUPE_ppa019410mg [Prunus persica]
Length=275

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 92/135 (68%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VN   +D E HLVH S  G+ AV  ++Y+IGE P+P L+ I D L  ++ T   +K +
Sbjct  133  HTVNDKSFDLEVHLVHQSPTGKNAVTGILYKIGE-PDPFLTSIMDYLADISGTCEKQKVV  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++A   +YYRY+GSLT PPCT+ V+WT++  +RSV+ +QV L+R A+HD S T
Sbjct  192  GMVDPKQIKAGSIKYYRYIGSLTIPPCTQDVIWTIVEKVRSVSSEQVKLLRVAVHDGSDT  251

Query  362  NARPLQTINDRFVKV  318
            NARP+Q  N R V++
Sbjct  252  NARPVQPRNRRVVQL  266



>gb|KHN39018.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=278

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 97/139 (70%), Gaps = 6/139 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVH----VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +NG RYD E H+VH    ++  G+IAV+ + Y+IG  P+ +L+ +   +K + +    
Sbjct  135  HTINGRRYDLELHMVHESKRINGKGKIAVVGLFYKIGR-PDSVLNKLSKFIKTMVDEE-E  192

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            +K IG  DP+ ++  G++YYRYMGSLT PPCTEGV+WT+ + IR+V++ QV L+R A+HD
Sbjct  193  EKNIGAFDPSKIKLGGKKYYRYMGSLTVPPCTEGVIWTINKKIRTVSRAQVNLLREAVHD  252

Query  374  ESKTNARPLQTINDRFVKV  318
             ++ NARP+Q +N R +++
Sbjct  253  HAEKNARPIQPLNRRGIQL  271



>ref|XP_010098808.1| hypothetical protein L484_022573 [Morus notabilis]
 gb|EXB75896.1| hypothetical protein L484_022573 [Morus notabilis]
Length=280

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 94/135 (70%), Gaps = 6/135 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +NG R+  E H+VH S D      IAV+ V+Y++G  P+  LS +  D+  +++    
Sbjct  137  HTINGRRFHMELHMVHQSTDKTVKNNIAVIGVLYKLGR-PDSFLSKLMKDITAISDKKE-  194

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            +K +G +DP+ ++  G+RYYRYMGSLT PPCTEGV+WT+ + IR+V+KQQV L+R A+HD
Sbjct  195  EKHMGIIDPSEIKLGGKRYYRYMGSLTVPPCTEGVIWTISKKIRTVSKQQVELLRVAVHD  254

Query  374  ESKTNARPLQTINDR  330
             ++ NARP+Q IN R
Sbjct  255  YAEENARPVQPINRR  269



>emb|CDX93595.1| BnaA06g04530D [Brassica napus]
Length=274

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 91/135 (67%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H++H S DGR+AV+A +Y +G  P+  L  +E  LK++ +  G +  +
Sbjct  134  HTINGKRFVLEQHMLHQSKDGRLAVVAFLYSLGR-PDSFLLSLERQLKRITDAHGSEDFV  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +DP  +  + R YYRY+GSLTTPPC+E V W++ R +R+VT +Q+ L+R ++HD+S T
Sbjct  193  SLIDPRAVNFKTRLYYRYLGSLTTPPCSENVTWSISREMRTVTLKQLDLLRVSVHDQSNT  252

Query  362  NARPLQTINDRFVKV  318
            NARPLQ  N R VK 
Sbjct  253  NARPLQRQNGRPVKF  267



>ref|XP_006391784.1| hypothetical protein EUTSA_v10023909mg [Eutrema salsugineum]
 gb|ESQ29070.1| hypothetical protein EUTSA_v10023909mg [Eutrema salsugineum]
Length=273

 Score =   133 bits (335),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 94/133 (71%), Gaps = 4/133 (3%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NGTRYD E H+VH S  G+ AV+ V+Y++GE PN  L+ + + +K + +    +K +
Sbjct  138  HTINGTRYDMELHMVHTSAQGKTAVIGVLYRLGE-PNEFLTKLLNGIKTVEKE---EKNL  193

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++    ++YRY+GSLT PPCTEGV+WTV+  + +++K+Q+A +RNA+ D  +T
Sbjct  194  GIVDPRTIRVENEKFYRYIGSLTVPPCTEGVIWTVVERVNTISKEQIAALRNAVDDGYET  253

Query  362  NARPLQTINDRFV  324
            N+RP+Q ++ R V
Sbjct  254  NSRPVQDLHGRLV  266



>ref|XP_009134167.1| PREDICTED: alpha carbonic anhydrase 4-like [Brassica rapa]
Length=261

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 95/133 (71%), Gaps = 4/133 (3%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNGTRYD E H+VH S +G+ AV+AV+Y++G  PN  L+ +E+++K + +    +K I
Sbjct  126  HTVNGTRYDMELHMVHTSAEGQTAVIAVLYKLGR-PNEFLTTLENEIKTVGKE---EKEI  181

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP ++     ++YRY+GSLT PPCTEGV+WTV++ + +V+ +Q+A +R+A+ D  + 
Sbjct  182  GIVDPRIIGFHTDKFYRYVGSLTAPPCTEGVIWTVVKRVNTVSMEQLAALRDAVDDGFER  241

Query  362  NARPLQTINDRFV  324
            N+RP+Q  N R V
Sbjct  242  NSRPIQDTNGRSV  254



>gb|KEH42158.1| eukaryotic-type carbonic anhydrase [Medicago truncatula]
Length=279

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 98/139 (71%), Gaps = 6/139 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVH----VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +NG RYD E H+VH    V+   ++AV+ +MY+IG  P+ +LS +   +K + +   V
Sbjct  136  HTINGRRYDLELHMVHESAKVNGKSKLAVIGLMYKIGR-PDRLLSKLSKYIKTMMDNE-V  193

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            ++ IG  DP+ ++  G++YYRY+GSLT PPCTEGV+WT+ + IRSV++ Q+ L+R A+HD
Sbjct  194  ERSIGVFDPSEIKLGGKKYYRYIGSLTVPPCTEGVIWTINKKIRSVSRAQLELLREAVHD  253

Query  374  ESKTNARPLQTINDRFVKV  318
             ++ NARP+Q +N R +++
Sbjct  254  HAEKNARPVQLLNRREIQL  272



>emb|CDX79018.1| BnaA01g10850D [Brassica napus]
Length=261

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 95/133 (71%), Gaps = 4/133 (3%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNGTRYD E H+VH S +G+ AV+AV+Y++G  PN  L+ +E+++K + +    +K I
Sbjct  126  HTVNGTRYDMELHMVHTSAEGQTAVIAVLYKLGR-PNEFLTTLENEIKTVGKE---EKEI  181

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP ++     ++YRY+GSLT PPCTEGV+WTV++ + +V+ +Q+A +R+A+ D  + 
Sbjct  182  GIVDPRIIGFHTDKFYRYVGSLTAPPCTEGVIWTVVKRVNTVSMEQLAALRDAVDDGFER  241

Query  362  NARPLQTINDRFV  324
            N+RP+Q  N R V
Sbjct  242  NSRPIQDTNGRSV  254



>ref|XP_002445628.1| hypothetical protein SORBIDRAFT_07g022910 [Sorghum bicolor]
 gb|EES15123.1| hypothetical protein SORBIDRAFT_07g022910 [Sorghum bicolor]
Length=281

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 94/136 (69%), Gaps = 1/136 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVS-NDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG  546
            H V+G R+D E HLVH S +D + AV+A++Y++G   +  L  +E  ++++A+    ++ 
Sbjct  137  HTVDGHRHDMELHLVHESADDKKAAVIAILYEVGRHEDAFLRHLEPFIRRIADVRDREER  196

Query  545  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  366
            +G +DP   +     YYRYMGSLT PPCTEGV+WT+++ +RSV+K Q+ L+R A+HD+ +
Sbjct  197  VGVVDPRRARGTASVYYRYMGSLTAPPCTEGVIWTIVKRVRSVSKYQLELLREAVHDDME  256

Query  365  TNARPLQTINDRFVKV  318
             NARPLQ  N+R + +
Sbjct  257  DNARPLQEANNRRISI  272



>ref|XP_010696309.1| PREDICTED: alpha carbonic anhydrase 7-like [Beta vulgaris subsp. 
vulgaris]
Length=285

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 89/135 (66%), Gaps = 3/135 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RY  EAH VH S D ++AV+  +Y  G  P+P LS IED ++ ++       G+
Sbjct  134  HAINGRRYALEAHFVHQSLDNKVAVIGFLYHYG-NPDPFLSSIEDKIRSISNNASTDAGV  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              + P+ ++  G +YYRY GSLTTPPC EGV+WTV   + +V+ +QV L+RNA+ D S+ 
Sbjct  193  --ISPSQVRMEGSQYYRYSGSLTTPPCDEGVIWTVENMLGTVSIEQVQLLRNAVDDGSRE  250

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +N R+V +
Sbjct  251  NARPLQPVNRRWVHL  265



>gb|EEC83720.1| hypothetical protein OsI_29556 [Oryza sativa Indica Group]
Length=271

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 90/135 (67%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG RYD E HLVH   +    V+  +YQIG  P+P L ++E  ++++A+T    + I
Sbjct  130  HTVNGRRYDMELHLVHDDGNSNTVVIGNLYQIG-NPDPFLLMLEPFIRRIADTKDRSEPI  188

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP L ++    YYRYMGSLTTPPCTEGV+WTV +  ++V + Q+ L+R A+ D  + 
Sbjct  189  GVVDPQLAKSPDAVYYRYMGSLTTPPCTEGVIWTVFKRAQTVAQYQLDLLREAVADGYEN  248

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +N+R + +
Sbjct  249  NARPLQKVNNRNISI  263



>ref|XP_008462808.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=275

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 94/135 (70%), Gaps = 2/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  EAHLVH S  G IAV+ ++Y IG+ P+  LS +     +++ T    K +
Sbjct  133  HTLNGKRFALEAHLVHQSQTGNIAVIGILYNIGQ-PDYFLSTMRQHFVEISATQR-DKLL  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              ++P+LL+ R   YYRY+GSLT PPC++ V+WT++R +R+V  +QV L+R A+HD+S T
Sbjct  191  NMVNPSLLKMRSSLYYRYIGSLTVPPCSQNVLWTIVRKVRTVAPEQVNLLRVAVHDDSNT  250

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +N+R V++
Sbjct  251  NARPLQPLNNRNVQL  265



>ref|XP_007132283.1| hypothetical protein PHAVU_011G081900g [Phaseolus vulgaris]
 gb|ESW04277.1| hypothetical protein PHAVU_011G081900g [Phaseolus vulgaris]
Length=274

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 99/138 (72%), Gaps = 3/138 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H ++GTR D E H+VH +  G  AVL ++Y+ G   +P +SL+   LK +++  G ++ +
Sbjct  132  HAIDGTRLDLELHMVHQTPSGEYAVLGIIYRAGRE-DPFVSLLSKGLKAISDHTGAEEEV  190

Query  542  GYLDPNLLQ--ARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES  369
              +DP++++  +    YYRY GSLTTPPC+E V+WTV+R +RS++++Q+ L++ A+ D+S
Sbjct  191  AEVDPSMVKEGSSVSLYYRYTGSLTTPPCSENVIWTVLREVRSISQEQIKLLQEAVEDDS  250

Query  368  KTNARPLQTINDRFVKVD  315
            ++NARPLQ +N+R V+++
Sbjct  251  RSNARPLQELNNRVVQLN  268



>gb|AFK33933.1| unknown [Medicago truncatula]
Length=279

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 98/139 (71%), Gaps = 6/139 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVH----VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +NG RYD E H+VH    V+   ++AV+ +MY+IG  P+ +LS +   +K + +   V
Sbjct  136  HTINGRRYDLELHMVHESAKVNGKSKLAVIGLMYKIGR-PDRLLSKLSKYIKTMMDNE-V  193

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            ++ IG  DP+ ++  G++YYRY+GSLT PPCTEGV+WT+ + +RSV++ Q+ L+R A+HD
Sbjct  194  ERSIGVFDPSEIKLGGKKYYRYIGSLTVPPCTEGVIWTINKKVRSVSRAQLELLREAVHD  253

Query  374  ESKTNARPLQTINDRFVKV  318
             ++ NARP+Q +N R +++
Sbjct  254  HAEKNARPVQLLNRREIQL  272



>ref|XP_009137160.1| PREDICTED: alpha carbonic anhydrase 4-like [Brassica rapa]
Length=268

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 93/131 (71%), Gaps = 4/131 (3%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNGTRYD E H+VH S  GRIAV+ V+Y++G+ PN  L+ + D LK + +    +K +
Sbjct  133  HTVNGTRYDLELHMVHTSARGRIAVIGVLYKLGK-PNEFLTRLLDGLKTVGKE---EKDL  188

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++ + +++YRY+GSLT PPCTEGV W V++ + +++ +Q+A +RNA+ D  +T
Sbjct  189  GIVDPRTIRFQTKKFYRYIGSLTVPPCTEGVFWPVVKRVNTISVEQIAALRNAVDDGYET  248

Query  362  NARPLQTINDR  330
            N+RP+Q  N R
Sbjct  249  NSRPVQDTNGR  259



>ref|XP_010510673.1| PREDICTED: alpha carbonic anhydrase 2-like [Camelina sativa]
Length=276

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 90/135 (67%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH S +G +AV+ V+Y+IG  PN  L L+E  L  + +    ++ +
Sbjct  137  HTINGRRFALELHMVHESKNGSMAVVTVLYKIGR-PNSFLKLLEHKLVAITDQHDAERNV  195

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +DP+ ++   R YYRY+GSLTTPPCT+ + WT+++ +  V+K QV L+R A+HD+S +
Sbjct  196  IMIDPSKIKTESRNYYRYIGSLTTPPCTQNITWTILKKVXXVSKSQVNLLRVAVHDDSDS  255

Query  362  NARPLQTINDRFVKV  318
            NARP+Q  N R + +
Sbjct  256  NARPVQPTNKRVIHL  270



>ref|XP_008362138.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=279

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 96/139 (69%), Gaps = 6/139 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H VNG RYD E H+VH+S+D     +IAV+ V+Y+IG  P+  LS +   +K + +    
Sbjct  133  HSVNGRRYDMELHMVHLSSDPNVTNKIAVVGVLYKIGR-PDSFLSKLTGHVKSMMDQTE-  190

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            ++ IG +DP  ++ R + YYRYMGSLT PPCTEGV+WT+ + IR+V++ QV L R A+HD
Sbjct  191  ERNIGTIDPREIKIRKKNYYRYMGSLTVPPCTEGVIWTINKKIRTVSRDQVKLFRVAVHD  250

Query  374  ESKTNARPLQTINDRFVKV  318
             ++ NARP+Q +N R ++V
Sbjct  251  YAEMNARPVQPLNLREIQV  269



>gb|KFK43123.1| hypothetical protein AALP_AA1G083400 [Arabis alpina]
Length=275

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH S DGRI V+A  Y++G  P+P L  +E  LK++ +T   ++ +
Sbjct  135  HTINGKRFFLEKHMVHESKDGRITVVAFFYKLGR-PDPFLFSLERQLKRITDTHESEEYV  193

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              + P  ++   + YYRY+GSLTTPPCTE V+WT+ + ++++T +Q+ L+R ++HD+S T
Sbjct  194  RVIHPRRVEFESKHYYRYIGSLTTPPCTENVIWTISKELKTMTLKQLNLLRVSVHDQSNT  253

Query  362  NARPLQTINDR  330
            NARPLQ  N+R
Sbjct  254  NARPLQRKNER  264



>ref|XP_010530484.1| PREDICTED: alpha carbonic anhydrase 7-like [Tarenaya hassleriana]
Length=206

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 94/131 (72%), Gaps = 2/131 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H + G RY  E HLVHVS + +IAVL ++Y+IG +P+  LS +  +++ + +    KK I
Sbjct  71   HTIKGKRYSMELHLVHVSKNYKIAVLGILYKIG-SPDSFLSKLTKNVETVGDNKQEKK-I  128

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++ +G++Y+RY+GSLT PPCT+GV+WT+ + +++V++ Q+  ++ A+HD +K 
Sbjct  129  GIMDPREIKIKGKKYFRYIGSLTIPPCTQGVIWTINKRVQTVSRHQLKTLKAAVHDSAKG  188

Query  362  NARPLQTINDR  330
            N+RPLQ +N R
Sbjct  189  NSRPLQPLNHR  199



>ref|XP_003535188.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=278

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 96/139 (69%), Gaps = 6/139 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVH----VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +NG RYD E H+VH    ++  G+IAV+ + Y+IG  P+ +L+ +   +K + +    
Sbjct  135  HTINGRRYDLELHMVHESKRINGKGKIAVVGLFYKIGR-PDSVLNKLSKFIKTMVDEE-E  192

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            +K IG  DP+ ++  G++YYRYMGSLT PPC EGV+WT+ + IR+V++ QV L+R A+HD
Sbjct  193  EKNIGVFDPSKIKLGGKKYYRYMGSLTVPPCIEGVIWTINKKIRTVSRAQVNLLREAVHD  252

Query  374  ESKTNARPLQTINDRFVKV  318
             ++ NARP+Q +N R +++
Sbjct  253  HAEKNARPIQPLNRRGIQL  271



>ref|XP_011018803.1| PREDICTED: alpha carbonic anhydrase 7-like [Populus euphratica]
Length=277

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 93/131 (71%), Gaps = 2/131 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RYD E H++H + + +IAV+  +Y+IG+ P+  LS + +D+  + +    ++ I
Sbjct  135  HTINGRRYDMELHMIHTTPEQKIAVVGYLYKIGK-PDAFLSKLLNDIVSMTDQKS-ERNI  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++  G++YYRYMGSLTTPPC +GV+WT+ + IR+++K QV  +R A+HD ++ 
Sbjct  193  GIVDPREIKFGGKKYYRYMGSLTTPPCKQGVIWTINKKIRTISKDQVRALRVAVHDYAEK  252

Query  362  NARPLQTINDR  330
            NARPLQ +N R
Sbjct  253  NARPLQPLNQR  263



>ref|XP_004160914.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
 gb|KGN64829.1| hypothetical protein Csa_1G120450 [Cucumis sativus]
Length=275

 Score =   131 bits (330),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  EAHLVH S  G+IAV+ ++Y IG+ P+  LS +   L +++ T    + +
Sbjct  133  HTINGRRFALEAHLVHQSQTGKIAVIGILYNIGQ-PDYFLSTMRPHLIEISGTQR-DRLL  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              ++P+LL+ R   YYRY+GSLT PPC++ V+WT++R +R+V  +QV L+R A+HD+S T
Sbjct  191  NVVNPSLLRMRSSLYYRYIGSLTVPPCSQNVLWTLVRKVRTVAPEQVNLLRVAVHDDSNT  250

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +N+R V++
Sbjct  251  NARPLQPLNNRNVQL  265



>gb|EMT00558.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Aegilops tauschii]
Length=284

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 92/135 (68%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG RYD E H+VH S  G+ AV+ V+Y+IG   + +L  +E  L+ +A+    ++ +
Sbjct  142  HSVNGRRYDMELHMVHQSAQGKAAVIGVLYEIG-ARDALLHKLEPYLEMIAKQRDRQEKV  200

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +D    + R   YYRY+GSLTTPPCT+GV+WT+++ +R+V+K Q+ L+R A+HDE + 
Sbjct  201  GVVDARGARGRASVYYRYVGSLTTPPCTQGVIWTIVKRVRTVSKHQLELLREAVHDEMEK  260

Query  362  NARPLQTINDRFVKV  318
            NARP Q +N R + +
Sbjct  261  NARPRQELNSRDISM  275



>ref|XP_010696308.1| PREDICTED: alpha carbonic anhydrase 7-like [Beta vulgaris subsp. 
vulgaris]
Length=289

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 91/137 (66%), Gaps = 3/137 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RY  EAHL H S D ++AV+  +YQ G +P+P LS IED ++ +A      + +
Sbjct  134  HTINGKRYALEAHLTHESVDNKVAVIGFLYQYG-SPDPFLSSIEDKIRSIANNASAHQDV  192

Query  542  --GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES  369
              G + P+ ++  G +YY Y+GSLTTP C EGV+W V   + +V+K+QV L+R+A+ D S
Sbjct  193  MAGRISPSQVRMEGFQYYSYIGSLTTPACDEGVIWIVENKLGTVSKEQVKLLRDAVDDGS  252

Query  368  KTNARPLQTINDRFVKV  318
            +TNARPLQ +N R V +
Sbjct  253  RTNARPLQPVNGRCVNL  269



>ref|XP_011094588.1| PREDICTED: alpha carbonic anhydrase 7-like [Sesamum indicum]
Length=279

 Score =   131 bits (329),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 91/139 (65%), Gaps = 5/139 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H  NG RY  E HLVH + D     +IAV+ V Y+ G+ P+P LS +  ++  +A     
Sbjct  133  HTYNGKRYALELHLVHKATDPVVENKIAVIGVFYKTGQ-PDPFLSKLTTNITSMARKKDD  191

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            ++ +G +DP  +Q   RRYYRYMGSLT PPCTEGV+WT+ + +++V+ +QV L+R  +HD
Sbjct  192  QRSLGPVDPKEVQICSRRYYRYMGSLTVPPCTEGVIWTINKKVKTVSMEQVKLLRKVVHD  251

Query  374  ESKTNARPLQTINDRFVKV  318
             ++ NARPLQ +N R + +
Sbjct  252  YAEHNARPLQPLNSRRISL  270



>emb|CAM59682.1| a-type carbonic anhydrase [Lotus japonicus]
Length=269

 Score =   130 bits (328),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG+++D E H VH ++ G  AV+ + Y IG+ P+P+LS + D++K   +   +  GI
Sbjct  132  HTLNGSKFDMEMHAVHENSKGERAVIGIWYTIGQ-PDPLLSKLLDNIKLSGDNKDIDLGI  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              L+P L++   R+YYRY+GSLTTPPC+EGV+WT+++ +R+V+++Q+  ++ A+HD  + 
Sbjct  191  --LNPGLIKFGSRKYYRYVGSLTTPPCSEGVIWTIVKKVRTVSREQLKALKEAVHDGFEI  248

Query  362  NARPLQTINDRFV  324
            NARP Q +N R V
Sbjct  249  NARPTQELNGRKV  261



>ref|XP_006304810.1| hypothetical protein CARUB_v10012428mg [Capsella rubella]
 gb|EOA37708.1| hypothetical protein CARUB_v10012428mg [Capsella rubella]
Length=274

 Score =   130 bits (328),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 89/135 (66%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH S DGR AV+A +Y++G  P+  L  +E  L ++ +    ++ +
Sbjct  134  HTINGKRFVLEEHMVHQSKDGRNAVVAFLYKLGR-PDYFLLSLESHLMRITDAHESEESV  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G + P       R YYRY+GSLTTPPC+E V+WT+ + IR+VT +Q+ ++R  +HD+S T
Sbjct  193  GMIHPRTFDFESRHYYRYLGSLTTPPCSENVLWTISKEIRTVTLKQLIMLRVTVHDQSNT  252

Query  362  NARPLQTINDRFVKV  318
            NARPLQ  N+R VK 
Sbjct  253  NARPLQRNNNRPVKF  267



>ref|XP_003574630.1| PREDICTED: alpha carbonic anhydrase 7-like [Brachypodium distachyon]
Length=276

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 88/135 (65%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RYD E H+VH S   + AV+ V YQ+G   +  L  +E  L+ +A+    ++ +
Sbjct  134  HSLNGRRYDMEMHMVHESAQNKAAVIGVFYQVG-AHDAFLHKLEPYLEMIADKKDREEKV  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP   + R   YYRYMGSLTTPPC EGV+WT+++ +R+V+  Q+ L+R A+HD+ + 
Sbjct  193  GLIDPRGARGRASVYYRYMGSLTTPPCAEGVIWTIVKRVRTVSSAQLELLREAVHDDMEK  252

Query  362  NARPLQTINDRFVKV  318
            NARP Q  N+R + +
Sbjct  253  NARPRQETNNRVISM  267



>dbj|BAD09858.1| putative dioscorin class A precursor [Oryza sativa Japonica Group]
Length=275

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 92/139 (66%), Gaps = 5/139 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG RYD E HLVH   +   AV+  +YQIG  P+P L ++E  ++++A+T    + I
Sbjct  130  HTVNGRRYDMELHLVHDDGNSNTAVIGNLYQIG-NPDPFLLMLEPFIRRIADTKDKSEPI  188

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTI----RSVTKQQVALIRNAIHD  375
            G +DP L ++    YYRYMGSLTTPPCTEGV+WTV + +    ++V + Q+ L+R A+ D
Sbjct  189  GVVDPQLAKSPDAVYYRYMGSLTTPPCTEGVIWTVFKRVFLLAQTVAQYQLDLLREAVAD  248

Query  374  ESKTNARPLQTINDRFVKV  318
              + NARPLQ +N+R + +
Sbjct  249  GYENNARPLQKVNNRNISI  267



>emb|CDX95097.1| BnaC05g05740D [Brassica napus]
Length=274

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 89/135 (66%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH S DGR AV+A +Y +G  P+  L  +E  LK++ +    +  +
Sbjct  134  HTINGKRFVLEEHMVHQSKDGRFAVVAFLYSLGR-PDSFLLSLERQLKRITDAHESEDFV  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +DP  +  + + YYRY+GSLTTPPC+E V W++ R +R+VT +Q+ L+R ++HD+S T
Sbjct  193  SLIDPRAVNFKTKFYYRYLGSLTTPPCSENVTWSISREMRTVTLEQLNLLRVSVHDQSNT  252

Query  362  NARPLQTINDRFVKV  318
            NARPLQ  N R VK 
Sbjct  253  NARPLQRQNGRPVKF  267



>ref|XP_009148063.1| PREDICTED: alpha carbonic anhydrase 5 [Brassica rapa]
 ref|XP_009148064.1| PREDICTED: alpha carbonic anhydrase 5 [Brassica rapa]
Length=274

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 90/135 (67%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H++H S DGR+AV+A +Y +G  P+  L  +E  LK++ +    +  +
Sbjct  134  HTINGKRFVLEQHMLHQSKDGRLAVVAFLYSLGR-PDSFLLSLEKQLKRITDAHESEDFV  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +DP  +  + + YYRY+GSLTTPPC+E V W++ R +R+VT +Q+ L+R ++HD+S T
Sbjct  193  SLIDPRAVNFKTKFYYRYLGSLTTPPCSENVTWSISREMRTVTLKQLNLLRVSVHDQSNT  252

Query  362  NARPLQTINDRFVKV  318
            NARPLQ  N R VK 
Sbjct  253  NARPLQRQNGRPVKF  267



>gb|KFK28694.1| hypothetical protein AALP_AA7G034200 [Arabis alpina]
Length=269

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 99/134 (74%), Gaps = 5/134 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNGTRYD E H+VH S+ G++AV+ V++++G+ PN  L+ + + +K + +    +  I
Sbjct  133  HTVNGTRYDMELHMVHQSDRGKLAVIGVLFKLGQ-PNKFLTKLLNGIKAIGKE---EINI  188

Query  542  GYLDP-NLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  366
            G ++P ++++ + R++YRY+GSLT PPCTEGV+WTV++ + +++ +Q+A +RNA+HD  +
Sbjct  189  GIVNPHDIIRFQTRKFYRYIGSLTVPPCTEGVIWTVVKRVNTISAEQIAALRNAVHDGFE  248

Query  365  TNARPLQTINDRFV  324
            TN+RP+Q  + R V
Sbjct  249  TNSRPVQNTHSRTV  262



>dbj|BAK01826.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=275

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 90/135 (67%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RYD E H+ H S  G+ AV+ V YQ+G+  +  L  +E  L+ +A+    ++ +
Sbjct  133  HSLNGRRYDMELHMFHESAQGKAAVIGVFYQVGDH-DAFLHKLEPYLEMIADRKDREEKM  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP   + +   YYRY+GSLTTPPC EGV+WT+++ +R+V++ Q+ L+R A+HD+ + 
Sbjct  192  GMMDPRGARGKASVYYRYVGSLTTPPCAEGVIWTIVKRVRTVSRHQLELLREAVHDDMEK  251

Query  362  NARPLQTINDRFVKV  318
            NARP Q +N R + +
Sbjct  252  NARPRQEVNSRDISM  266



>ref|XP_009795833.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional monodehydroascorbate 
reductase and carbonic anhydrase nectarin-3-like, partial 
[Nicotiana sylvestris]
Length=226

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG R++ E+HLVH SN+G+ AV+ ++Y+IG  P+P LS+IE+DLK  A+  G+++  
Sbjct  129  HTVNGERFNLESHLVHESNNGKFAVIGIIYEIGLWPDPFLSMIENDLKVPADKKGIERAT  188

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIR  432
            G +DPN ++  G++Y+RY+GSLTTPPCTEGVVWT+ R
Sbjct  189  GTIDPNQIKLDGKQYFRYIGSLTTPPCTEGVVWTIDR  225



>ref|XP_004139442.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
 ref|XP_004170043.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
 gb|KGN64831.1| hypothetical protein Csa_1G120470 [Cucumis sativus]
Length=276

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG ++  EAHLVH S++G IAV+ ++Y IG + +  LS I++ L++++ET    + +
Sbjct  133  HTINGEKFALEAHLVHQSHNGNIAVIGILYDIGHS-DYFLSTIKEHLEEISETNEYIE-L  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +DP+L++ +   YY+Y GSLT PPCT+ V+W +++ +RSV   Q+ L+R A+HD+S T
Sbjct  191  NDIDPSLVEMKSSIYYQYYGSLTVPPCTQNVLWIIVKKVRSVASYQLELLRVAVHDDSNT  250

Query  362  NARPLQTINDRFVKV  318
            NARP+Q +N+R +++
Sbjct  251  NARPVQPLNNRIIQL  265



>ref|XP_008462491.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=276

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 96/137 (70%), Gaps = 6/137 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +NG RYD E H+VH S+D     +IAV+  +Y IG+ P+P ++ +  ++  + +    
Sbjct  131  HSINGRRYDLELHMVHQSSDPTVKNKIAVVGQLYTIGQ-PDPFITQLSREILGMVDRKHE  189

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            KK +G ++P  ++  GR+YYRY+GSLT PPCTEGV+WT+ + IR+V+++QV L+R A+HD
Sbjct  190  KK-VGVMNPADIKFGGRKYYRYLGSLTVPPCTEGVIWTMNKKIRTVSREQVRLLREAVHD  248

Query  374  ESKTNARPLQTINDRFV  324
             ++ NARPLQ +N R +
Sbjct  249  YAEFNARPLQPLNSREI  265



>ref|XP_010475597.1| PREDICTED: alpha carbonic anhydrase 5-like [Camelina sativa]
Length=281

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 86/131 (66%), Gaps = 1/131 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH S DGRIAV+A  Y++G  P+  L  +E  L ++ +T   ++ +
Sbjct  134  HTINGKRFILEEHMVHQSKDGRIAVVAFFYKLGR-PDFFLLSLERYLMRITDTHEAEEFV  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G + P       R YYRY+GSLTTPPC+E V WT+ + +R+V+ +Q+ L+R  +HD+S T
Sbjct  193  GMIHPRTFDFESRHYYRYLGSLTTPPCSENVTWTISKEMRTVSLKQLILLRVTVHDQSNT  252

Query  362  NARPLQTINDR  330
            NARPLQ  N R
Sbjct  253  NARPLQRKNQR  263



>ref|XP_002892432.1| carbonate dehydratase/ zinc ion binding protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH68691.1| carbonate dehydratase/ zinc ion binding protein [Arabidopsis 
lyrata subsp. lyrata]
Length=277

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 90/135 (67%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH S DGR AV+A  Y++G+ P+  L  +E  L+K+ +T   ++ +
Sbjct  134  HTLNGKRFVLEEHMVHQSKDGRNAVVAFFYKLGK-PDYFLLTLERYLRKITDTHESEEYV  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G + P       R YYRY GSLTTPPC+E V+WT+ + +R+VT +Q+ ++R  +HD+S T
Sbjct  193  GMIHPRTFDFESRHYYRYTGSLTTPPCSENVIWTISKEMRTVTLKQLIMLRVTVHDQSNT  252

Query  362  NARPLQTINDRFVKV  318
            NARPLQ  N+R V +
Sbjct  253  NARPLQRENERPVAL  267



>dbj|BAK02152.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02420.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=276

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 90/135 (67%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RYD E H+ H S  G+ AV+ V YQ+G+  +  L  +E  L+ +A+    ++ +
Sbjct  134  HSLNGRRYDMELHMFHESARGKAAVIGVFYQVGDH-DAFLHKLEPYLEMIADRKDREEKM  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP   + +   YYRY+GSLTTPPC EGV+WT+++ +R+V++ Q+ L+R A+HD+ + 
Sbjct  193  GMMDPRGARGKASVYYRYVGSLTTPPCAEGVIWTIVKRVRTVSRHQLELLREAVHDDMEK  252

Query  362  NARPLQTINDRFVKV  318
            NARP Q +N R + +
Sbjct  253  NARPRQEVNSRDISM  267



>ref|XP_004143278.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
 gb|KGN48196.1| hypothetical protein Csa_6G446560 [Cucumis sativus]
Length=276

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 95/135 (70%), Gaps = 6/135 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H VNG RYD E H+VH S+D     +IAV+  +Y IG+ P+P ++ +  ++  + +    
Sbjct  131  HSVNGRRYDLELHMVHQSSDPTVKNKIAVVGQLYTIGQ-PDPFITQLSREILGMVDRKHE  189

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            KK +G ++P  ++  G++YYRY+GSLT PPCTEGV+WT+ + IR+V+++QV L+R A+HD
Sbjct  190  KK-VGVMNPADIKFGGKKYYRYLGSLTVPPCTEGVIWTMNKKIRTVSREQVRLLREAVHD  248

Query  374  ESKTNARPLQTINDR  330
             ++ NARPLQ +N R
Sbjct  249  YAEFNARPLQPLNSR  263



>ref|XP_008464600.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional monodehydroascorbate 
reductase and carbonic anhydrase nectarin-3-like [Cucumis 
melo]
Length=278

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 91/135 (67%), Gaps = 3/135 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H  NG RYD E H+VH SN    AV+A++Y+ G  P+  LS +   +K + +    +K I
Sbjct  142  HSFNGKRYDLEMHIVHTSNHNETAVVAILYKFGR-PDRFLSRLFHHIKSIGKKE--EKEI  198

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G ++P  ++  GR+YYRY+GSLT PPCTEGV+WT+ + +R+V+++QV  ++ AIHD  K 
Sbjct  199  GMVNPGDIKFGGRKYYRYIGSLTVPPCTEGVIWTIQKKVRTVSREQVRALKTAIHDGLKK  258

Query  362  NARPLQTINDRFVKV  318
            NARP+Q ++ R ++ 
Sbjct  259  NARPIQALDGRRIQF  273



>ref|XP_010267256.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
Length=282

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 98/139 (71%), Gaps = 6/139 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +NG R+D E H+VHV++D     +IAV+ ++Y+IG  P+  LS +   +  +A++ G 
Sbjct  134  HTINGRRFDLELHMVHVTSDTKAVNKIAVIGILYKIGR-PDDFLSELMKGIWSIADSKG-  191

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            +  +G +DP  ++   R+YYRYMGSLT PPCT+GV+WT+ + +R+VT+ QV  +R A+HD
Sbjct  192  EVNVGVVDPRHIKIGSRKYYRYMGSLTVPPCTQGVIWTINKKVRTVTRGQVKALRVAVHD  251

Query  374  ESKTNARPLQTINDRFVKV  318
             ++ N+RPLQ +N+R +++
Sbjct  252  YAEENSRPLQLLNNRNIQL  270



>gb|KDP29186.1| hypothetical protein JCGZ_16575 [Jatropha curcas]
Length=139

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 90/132 (68%), Gaps = 6/132 (5%)
 Frame = -1

Query  701  YDXEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYL  534
            YD E H+VH+SND      I V+  +Y+IG  P+  LS +  D+K + +    ++  G +
Sbjct  6    YDMELHMVHLSNDPNVKNNITVIGQLYKIGH-PDAFLSKLLRDIKGMTDHKQ-ERSKGMI  63

Query  533  DPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNAR  354
            DPN ++  G++YYRY+GSLT PPCTEGV+WT+ + IR+V+K QV  +R A+HD ++ NAR
Sbjct  64   DPNDIKMNGKKYYRYLGSLTVPPCTEGVIWTINKKIRTVSKDQVKALREAVHDYAEKNAR  123

Query  353  PLQTINDRFVKV  318
            P+Q IN R +K+
Sbjct  124  PVQPINKREIKL  135



>gb|KDP26093.1| hypothetical protein JCGZ_21126 [Jatropha curcas]
Length=269

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 93/133 (70%), Gaps = 3/133 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H  NG+RY+ E HLVH S++G+IAV+ ++Y+ G   +P LS +   +K+  E   +  GI
Sbjct  128  HTFNGSRYELEIHLVHESSEGKIAVIGIVYKYGRH-DPFLSKLFQHIKRTVEKEEIDLGI  186

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              ++P  ++   R+YYRY GSLTTPPCTEGV+WT+++ +R+V+++QV  +R+A+HD  + 
Sbjct  187  --VNPGNIRFGSRKYYRYNGSLTTPPCTEGVIWTIVKKVRTVSREQVKALRDAVHDGFEA  244

Query  362  NARPLQTINDRFV  324
            NARP Q ++ R V
Sbjct  245  NARPSQPLDGRPV  257



>ref|XP_010036662.1| PREDICTED: alpha carbonic anhydrase 4-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW48290.1| hypothetical protein EUGRSUZ_K02021 [Eucalyptus grandis]
Length=277

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 94/133 (71%), Gaps = 4/133 (3%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H  NG++YD E H+VH+S+ G IAV+ ++Y+ G  P+P L+ + + +K + +     + +
Sbjct  137  HTFNGSKYDLELHVVHLSSHGEIAVIGIVYKYGR-PDPFLTKLLEHIKVVRKE---DRDL  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G ++P +++   R+Y+RY+GSLT PPCTEGVVWT+IR +R+V+++QV  +R A+HD  + 
Sbjct  193  GVINPGIIKFGSRKYFRYIGSLTVPPCTEGVVWTIIRKVRTVSREQVEALREAVHDGYEA  252

Query  362  NARPLQTINDRFV  324
            NARP Q ++ R V
Sbjct  253  NARPTQRLDRRAV  265



>gb|AFK49331.1| unknown [Lotus japonicus]
Length=238

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 93/133 (70%), Gaps = 3/133 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG+++D E H VH ++ G  AV+ + Y IG+ P+P+LS + D++K   +   +  GI
Sbjct  101  HTLNGSKFDMEMHAVHENSKGERAVIGIWYTIGQ-PDPLLSKLLDNIKLSGDNKDIDLGI  159

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              L+P L++   R+YYRY+GSLTTPPC+EGV+WT+++ + +V+++Q+  ++ A+HD  + 
Sbjct  160  --LNPGLVKFGSRKYYRYVGSLTTPPCSEGVIWTIVKKVWTVSREQLKALKEAVHDGFEI  217

Query  362  NARPLQTINDRFV  324
            NARP Q +N R V
Sbjct  218  NARPTQELNGRKV  230



>ref|XP_006582742.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=244

 Score =   128 bits (321),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 91/128 (71%), Gaps = 2/128 (2%)
 Frame = -1

Query  692  EAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQ-  516
            E H+VH +  G+ AV+ ++Y+ G  P+P LSL+ + L  ++ + G ++ +  +DP L++ 
Sbjct  111  ELHMVHETPSGQTAVIGILYKAGRRPDPFLSLLTNHLMVISNSTGAEREVDVMDPRLVKI  170

Query  515  -ARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTI  339
                  YYRY+GSLTTPPCTE + WT+++ ++SV+K+Q+ L+R+A+HD+   NARPLQ I
Sbjct  171  GTSTTLYYRYIGSLTTPPCTEDIAWTMLKEVKSVSKEQIRLLRDAVHDDFDANARPLQPI  230

Query  338  NDRFVKVD  315
            N+R V+++
Sbjct  231  NNRLVQLN  238



>ref|XP_006339092.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=269

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 90/133 (68%), Gaps = 3/133 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDG--RIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK  549
            H VNG RYD E H+VH++ +   +I V+ V+Y+IG+ P+  LS +  ++  + +     K
Sbjct  127  HTVNGRRYDMEMHMVHLNENATNKIVVIGVLYKIGK-PDRFLSKLIRNISSMIDKKDEVK  185

Query  548  GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES  369
              G +DP  ++   R+YYRYMGSLT PPCTEGV+WT+ + +R+V++ QV ++R A+HD +
Sbjct  186  NAGMIDPREIKIGSRKYYRYMGSLTVPPCTEGVIWTIKKKVRTVSRAQVKMLREAVHDYA  245

Query  368  KTNARPLQTINDR  330
            + N RPLQ+ N R
Sbjct  246  ERNGRPLQSKNKR  258



>ref|XP_004515925.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cicer arietinum]
Length=279

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 96/139 (69%), Gaps = 6/139 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVH----VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +NG RYD E H+VH    ++   +IAV+ ++Y+IG  P+P+L+ +   +K + +    
Sbjct  136  HTINGRRYDMELHMVHESPKINGKSKIAVIGLLYKIGR-PDPVLTKLSKYIKSMIDNEA-  193

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            ++ IG +DP+ ++   ++YYRY GSLT PPCTEGV+WT+ + IR V++ Q+ L+R A+HD
Sbjct  194  ERSIGVIDPSDIKFGSKKYYRYRGSLTVPPCTEGVIWTINKKIRRVSRDQMELLREAVHD  253

Query  374  ESKTNARPLQTINDRFVKV  318
             ++ NARP+Q +N R +++
Sbjct  254  HAEKNARPVQFLNRREIQL  272



>ref|XP_010241820.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
Length=282

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 96/139 (69%), Gaps = 6/139 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDG----RIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +NG R+D E H+VHVS D     +IAV+ ++Y+IG  P+  LS ++  +  +A++   
Sbjct  134  HTLNGKRFDLELHMVHVSPDNTTANQIAVIGILYKIGR-PDDFLSELKKGIWSIADSKN-  191

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            + G+G +DP  ++   R+YYRYMGSLT PPCT+GV+WT+   +R+V+K QV  +R+A+HD
Sbjct  192  EVGVGVVDPRHIKIGSRKYYRYMGSLTVPPCTQGVIWTINTKVRTVSKGQVKALRDAVHD  251

Query  374  ESKTNARPLQTINDRFVKV  318
             ++ NARPLQ +N R + +
Sbjct  252  YAEQNARPLQPLNKREIHL  270



>ref|XP_008462817.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=275

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 91/135 (67%), Gaps = 2/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  EAHLVH S  G IAV+ ++Y IG+ P+  LS +      ++ T    K +
Sbjct  133  HTINGRRFALEAHLVHQSQTGNIAVIGILYNIGQ-PDYFLSTMRQHFIDISTTQR-DKLL  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              ++P+ L+ R   YYRY+GSLT PPC++ V+WT++R +R+V   QV L+R A+HD+S T
Sbjct  191  NVVNPSRLRMRSSLYYRYIGSLTVPPCSQNVLWTIVRKVRTVAPDQVNLLRVAVHDDSNT  250

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +N+R V++
Sbjct  251  NARPLQPLNNRNVQL  265



>gb|KCW47832.1| hypothetical protein EUGRSUZ_K01571 [Eucalyptus grandis]
Length=289

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 92/133 (69%), Gaps = 4/133 (3%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H  NG+RYD E H+VH+S+ G IAV+ ++Y+ G  P+P L+ + + +  + +       +
Sbjct  149  HTFNGSRYDLELHMVHLSSHGEIAVIGIVYKYGR-PDPFLTKLLEHITVVGKE---DTDL  204

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G ++P +++   R+Y+RY+GSLT PPCTEGVVWT++R +R+V+++QV  +R A+HD  + 
Sbjct  205  GVINPGIIKFGSRKYFRYIGSLTVPPCTEGVVWTIVRKVRTVSRKQVEALREAVHDGYEA  264

Query  362  NARPLQTINDRFV  324
            NARP Q ++ R V
Sbjct  265  NARPTQQLDGRAV  277



>ref|XP_009767316.1| PREDICTED: alpha carbonic anhydrase 7-like [Nicotiana sylvestris]
Length=280

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 94/140 (67%), Gaps = 6/140 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSN----DGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +NG RY  E H+VH SN      +I V AV+Y+ G+ P+P L  +   +  + +  G 
Sbjct  137  HTINGRRYPLEMHMVHQSNVEKVKNKIIVNAVLYKFGK-PDPFLFSLRRHISSMIDQEGK  195

Query  554  KKGIGYLDPN-LLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  378
            ++ +G +DPN ++ +  +RYYRYMGSLTTPPCTEGV W V + +++V++ QV L+R A+H
Sbjct  196  ERKLGKIDPNYIISSPSKRYYRYMGSLTTPPCTEGVTWIVNKKVQTVSRGQVMLLRKAVH  255

Query  377  DESKTNARPLQTINDRFVKV  318
            D ++ NARP+Q  N+R +++
Sbjct  256  DSAEKNARPVQPHNEREIRL  275



>ref|XP_002528758.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF33670.1| carbonic anhydrase, putative [Ricinus communis]
Length=275

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 95/142 (67%), Gaps = 10/142 (7%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG-  546
            H+++G +Y  E H+VH   DG  +V+A++YQ GE  +P L+ IE  L +LAE   VKKG 
Sbjct  131  HMIDGIQYPLELHMVHQLGDGSYSVIAILYQYGEA-DPYLAQIEKSLDQLAEE--VKKGG  187

Query  545  ------IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNA  384
                  +G ++P +L+   RR++RY+GSLTTPPCTE V+W +I T+R+V+K QV  ++  
Sbjct  188  KEAQVPLGIINPKILKRSSRRFFRYVGSLTTPPCTEDVIWNIIPTVRTVSKNQVRALKAP  247

Query  383  IHDESKTNARPLQTINDRFVKV  318
            ++   K N RPLQ++N R V++
Sbjct  248  LNQAYKNNCRPLQSLNGRKVEI  269



>ref|XP_010036307.1| PREDICTED: alpha carbonic anhydrase 4-like [Eucalyptus grandis]
 gb|KCW47833.1| hypothetical protein EUGRSUZ_K01571 [Eucalyptus grandis]
Length=299

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 92/133 (69%), Gaps = 4/133 (3%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H  NG+RYD E H+VH+S+ G IAV+ ++Y+ G  P+P L+ + + +  + +       +
Sbjct  159  HTFNGSRYDLELHMVHLSSHGEIAVIGIVYKYGR-PDPFLTKLLEHITVVGKE---DTDL  214

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G ++P +++   R+Y+RY+GSLT PPCTEGVVWT++R +R+V+++QV  +R A+HD  + 
Sbjct  215  GVINPGIIKFGSRKYFRYIGSLTVPPCTEGVVWTIVRKVRTVSRKQVEALREAVHDGYEA  274

Query  362  NARPLQTINDRFV  324
            NARP Q ++ R V
Sbjct  275  NARPTQQLDGRAV  287



>ref|XP_006381381.1| hypothetical protein POPTR_0006s12380g [Populus trichocarpa]
 gb|ERP59178.1| hypothetical protein POPTR_0006s12380g [Populus trichocarpa]
Length=277

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 92/131 (70%), Gaps = 2/131 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG  YD E H++H + + +IAV+  +Y+ G+ P+  LS + +D+  + +   +++ I
Sbjct  135  HTINGRSYDMELHMLHTTPEQKIAVIGYLYKTGK-PDAFLSKLLNDIVSMTDQK-MERNI  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++  G++YYRYMGSLTTPPC +GV+WT+ + IR+++K QV  +R A+HD ++ 
Sbjct  193  GIVDPREIKFGGKKYYRYMGSLTTPPCKQGVIWTINKKIRTISKDQVRALRVAVHDYAEK  252

Query  362  NARPLQTINDR  330
            NARPLQ +N R
Sbjct  253  NARPLQPLNQR  263



>emb|CAO98737.1| dioscorin 4 precursor [Dioscorea japonica]
Length=268

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+D EA LVH S D + AV++++++ G   +P LS +ED +K+ + +   +   
Sbjct  124  HEMNGERFDLEAQLVHESQDQKRAVVSILFRFGRA-DPFLSDLEDFIKQFSNSQKNEINA  182

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DPN LQ     YYRYMGS T PPCTEG+ WTV+R + +V+ +QV L++ A+++ +  
Sbjct  183  GVVDPNQLQIDDSAYYRYMGSFTAPPCTEGISWTVMRKVATVSPRQVLLLKQAVNENAIN  242

Query  362  NARPLQTINDRFV  324
            NARPLQ  N R V
Sbjct  243  NARPLQPTNFRSV  255



>emb|CDX76404.1| BnaA08g09960D [Brassica napus]
Length=268

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 95/133 (71%), Gaps = 4/133 (3%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNGTRYD E H+VH S  G+ AV+ V+Y++G+ PN  L+ + D +K + +    ++ +
Sbjct  133  HTVNGTRYDMELHMVHTSAGGKTAVIGVLYKLGK-PNEFLTRLLDGIKTVGKE---ERDL  188

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G ++P  ++ + +++YRY+GSLT PPCTEGV+WTV++ + +++ +Q+A +R+A+ D  +T
Sbjct  189  GIVEPRTIRFQTKKFYRYIGSLTVPPCTEGVIWTVVKRVNTISMEQIAALRSAVDDGYET  248

Query  362  NARPLQTINDRFV  324
            N+RP+Q  N R V
Sbjct  249  NSRPVQERNGRSV  261



>emb|CDY27409.1| BnaC03g64490D [Brassica napus]
Length=268

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 94/133 (71%), Gaps = 4/133 (3%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNGTRYD E H+VH S  G+  V+ V+Y++G+ PN  L+ + D +K + +    ++ +
Sbjct  133  HTVNGTRYDMELHMVHTSAGGKTVVIGVLYKLGK-PNEFLTRLLDGIKTVGKE---ERDL  188

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++ + +++YRY+GSLT PPCTEGV+WTV++ + +++ +Q+A +R+A+ D  +T
Sbjct  189  GIVDPRTIRFQTKKFYRYIGSLTVPPCTEGVIWTVVKRVNTISMEQIAALRSAVDDGYET  248

Query  362  NARPLQTINDRFV  324
            N+RP+Q  N R V
Sbjct  249  NSRPVQERNGRSV  261



>ref|XP_008351630.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=280

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 92/133 (69%), Gaps = 4/133 (3%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H  NG+RY  E H+VHVS+ G+IAV+ ++Y+ G  P+P LS +   +K + +    +  I
Sbjct  140  HTFNGSRYALEFHIVHVSSTGKIAVIGIVYKYGR-PDPFLSKLFHHIKSVGKE---EVDI  195

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G ++P  ++   R+YYRY+GSLT PPCTEGV+WT+++ +R+V+++QV  +R A+HD  + 
Sbjct  196  GIINPGDIKFGSRKYYRYIGSLTVPPCTEGVIWTIVKKVRTVSREQVRALREAVHDGYEA  255

Query  362  NARPLQTINDRFV  324
            NARP Q ++ R V
Sbjct  256  NARPTQELDGRPV  268



>ref|XP_006292541.1| hypothetical protein CARUB_v10018775mg [Capsella rubella]
 gb|EOA25439.1| hypothetical protein CARUB_v10018775mg [Capsella rubella]
Length=268

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 93/134 (69%), Gaps = 6/134 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK-G  546
            H VNGTRYD E H+VH S  GR AV+ V+Y++G+ PN  L+ + + +K +    G K+  
Sbjct  133  HTVNGTRYDLELHMVHTSAGGRTAVIGVLYKLGK-PNEFLAKLLNGIKSV----GTKEID  187

Query  545  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  366
            +G +DP  ++ + R++YRY+GSLT PPCTEGV+WTV++ + +++ +Q+  +R A+HD  +
Sbjct  188  LGVIDPREIRFQTRKFYRYIGSLTVPPCTEGVLWTVVKRVNTISMEQITALREAVHDGFE  247

Query  365  TNARPLQTINDRFV  324
            TN+RP+Q    R V
Sbjct  248  TNSRPVQESKGRTV  261



>ref|XP_004249474.1| PREDICTED: alpha carbonic anhydrase 7-like [Solanum lycopersicum]
Length=269

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 89/133 (67%), Gaps = 3/133 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDG--RIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK  549
            H VNG RYD E H+VH++ +   +I V+ V+Y+IG+ P+  LS +  ++  + +     K
Sbjct  127  HTVNGRRYDMEMHMVHLNENATNKIVVIGVLYKIGK-PDRFLSKLIRNISSMIDKKDEVK  185

Query  548  GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES  369
              G +DP  ++   R+YYRYMGSLT PPCTEGV+WT+ + +R+V++ QV ++R A+HD +
Sbjct  186  NAGMIDPREIKIGSRKYYRYMGSLTVPPCTEGVIWTIKKKVRTVSRAQVKMLREAVHDYA  245

Query  368  KTNARPLQTINDR  330
            + N RPLQ  N R
Sbjct  246  EKNGRPLQPKNKR  258



>gb|ACT36291.1| dioscorin precursor [Dioscorea japonica]
Length=268

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+D EA LVH S D + AV++++++ G   +P LS +ED +K+ + +   +   
Sbjct  124  HEMNGERFDLEAQLVHESQDQKRAVVSILFRFGRA-DPFLSDLEDFIKQFSNSQKNEINA  182

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DPN LQ     YYRYMGS T PPCTEG+ WTV+R + +V+ +QV L++ A+++ +  
Sbjct  183  GVVDPNQLQIDDSAYYRYMGSFTAPPCTEGISWTVMRKVATVSPRQVLLLKQAVNENAIN  242

Query  362  NARPLQTINDRFV  324
            NARPLQ  N R V
Sbjct  243  NARPLQPTNFRSV  255



>ref|XP_010098809.1| hypothetical protein L484_022574 [Morus notabilis]
 gb|EXB75897.1| hypothetical protein L484_022574 [Morus notabilis]
Length=243

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 96/140 (69%), Gaps = 8/140 (6%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG-  558
            H +NG R D E H+VH S D     RIAV+A++Y+ G+ P+  LS    D+  + +T   
Sbjct  95   HSINGRRLDLELHIVHSSPDVKIERRIAVIAMLYKFGK-PDRFLSKFTKDMVSITDTKQE  153

Query  557  VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  378
            V KG+  +DP  L+  G +YYRY+GSLT PPCTEGV+WT+ + I +V+++QV+L+R A+H
Sbjct  154  VHKGV--IDPRELKMGGLKYYRYIGSLTIPPCTEGVIWTMNKRISTVSREQVSLLREAVH  211

Query  377  DESKTNARPLQTINDRFVKV  318
            D ++ NARPLQ +N+R + +
Sbjct  212  DHAEMNARPLQPLNERDIHI  231



>gb|ACT36289.1| dioscorin precursor [Dioscorea japonica]
Length=268

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+D EA LVH S D + AV++++++ G   +P LS +ED +K+ + +   +   
Sbjct  124  HEMNGERFDLEAQLVHESQDQKRAVVSILFRFGRA-DPFLSDLEDFIKQFSNSQKNEINA  182

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DPN LQ     YYRYMGS T PPCTEG+ WTV+R + +V+ +QV L++ A+++ +  
Sbjct  183  GVVDPNQLQIDDSAYYRYMGSFTAPPCTEGISWTVMRKVATVSPRQVLLLKQAVNENAIN  242

Query  362  NARPLQTINDRFV  324
            NARPLQ  N R V
Sbjct  243  NARPLQPTNFRSV  255



>ref|XP_006413835.1| hypothetical protein EUTSA_v10027157mg [Eutrema salsugineum]
 gb|ESQ55288.1| hypothetical protein EUTSA_v10027157mg [Eutrema salsugineum]
Length=268

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 96/133 (72%), Gaps = 4/133 (3%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNGTRYD E H+VH S  G+ AV+ V+Y++G+ PN  L+ + + +K + +    +K +
Sbjct  132  HTVNGTRYDMELHMVHTSARGQTAVIGVLYRLGK-PNEFLTRLLNGIKTVEKE---EKSL  187

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++ + +++YRY+GSLT PPCTEGV+WT+++ + +++++Q+A +RNA+ D  +T
Sbjct  188  GIVDPRSIRFQTKKFYRYIGSLTVPPCTEGVIWTIVKKVNTISQEQIAALRNAVDDGYET  247

Query  362  NARPLQTINDRFV  324
            N+RP+Q  + R +
Sbjct  248  NSRPVQDPHGRSI  260



>ref|XP_006660200.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Oryza brachyantha]
Length=303

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 89/135 (66%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H  +G RYD E HLVH   +  IAV+ + Y IG   +P+L  +E  ++K+A+     + +
Sbjct  165  HTADGRRYDMELHLVHDDGNDNIAVIGIFYVIGNA-DPLLRQLEPAIRKIADRKDQSEPV  223

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              +DP L +++G  YYRYMGSLTTPPCTEGV+WTV +  R+V K Q+ L+R A+ D  + 
Sbjct  224  ESVDPRLAKSQGAVYYRYMGSLTTPPCTEGVIWTVFQRPRTVAKYQLDLLREAVADGYEN  283

Query  362  NARPLQTINDRFVKV  318
            NARP+Q +N+R + +
Sbjct  284  NARPIQKLNNREISI  298



>emb|CAO98738.1| dioscorin 5 precursor [Dioscorea japonica]
Length=271

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+D EA LVH S D + AV++++++ G   +P LS +ED +K+ + +   +   
Sbjct  127  HEMNGERFDLEAQLVHESQDQKRAVVSILFRFGRA-DPFLSDLEDFIKQFSNSQKNEINA  185

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DPN LQ     YYRYMGS T PPCTEG+ WTV+R + +V+ +QV L++ A+++ +  
Sbjct  186  GVVDPNQLQIDDSAYYRYMGSFTAPPCTEGISWTVMRKVATVSPRQVLLLKQAVNENAIN  245

Query  362  NARPLQTINDRFV  324
            NARPLQ  N R V
Sbjct  246  NARPLQPTNFRSV  258



>ref|XP_002268233.1| PREDICTED: alpha carbonic anhydrase 7 [Vitis vinifera]
 emb|CBI30161.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 94/135 (70%), Gaps = 2/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RYD E H+VHVS D  IAV+ ++Y+ G+ P+  LS +  ++  +A+    +K +
Sbjct  134  HSINGRRYDLELHMVHVSPDNNIAVVGLIYKTGQ-PDKFLSKMMSNITSMADKMEQRK-M  191

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G + P  ++  GR+YY+YMGSLT PPCTEGV W + + IR+V+++QV  +R A+HD ++ 
Sbjct  192  GVIHPGDIKMGGRKYYKYMGSLTVPPCTEGVTWIINKKIRTVSREQVKQLRLAVHDYAEM  251

Query  362  NARPLQTINDRFVKV  318
            NARP+Q +N R V++
Sbjct  252  NARPVQPLNLREVQL  266



>dbj|BAK03530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=285

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 89/135 (66%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG RY  E H+VH+S   + AV+ ++Y+IG   +  L  +E  L ++A+    ++ +
Sbjct  136  HRVNGRRYSLELHMVHLSAQNKTAVIGLLYKIGRRDH-FLHKLEPYLMRMADMKEKEEKV  194

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP   +  G  YYRYMGSLTTPPC EGV+WTVI+ + +V+  Q+ L+ +A+HD  + 
Sbjct  195  GLVDPGEARGDGEAYYRYMGSLTTPPCDEGVIWTVIKRVATVSTDQLKLLTDAVHDGFEM  254

Query  362  NARPLQTINDRFVKV  318
            NARPLQ +NDR ++ 
Sbjct  255  NARPLQKVNDRDIRF  269



>ref|XP_002529417.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF32943.1| carbonic anhydrase, putative [Ricinus communis]
Length=253

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 88/132 (67%), Gaps = 2/132 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH S DG+IAV+A +Y IG  P+  LS + D ++K+A + G +  +
Sbjct  110  HTINGRRFALEMHMVHESKDGKIAVIAFLYTIGR-PDFFLSHLTDHIRKVAGSEGKETMV  168

Query  542  GYLDPNLLQARG-RRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  366
            G +DP   + +    YYRYMGSLTTPPC E VVWTV++ +R+V+ QQV+L++ A+  E  
Sbjct  169  GTVDPEDFKIQNIMYYYRYMGSLTTPPCHESVVWTVLKKVRTVSIQQVSLLQEAVDGEPG  228

Query  365  TNARPLQTINDR  330
             NARP Q  N R
Sbjct  229  WNARPTQQTNGR  240



>gb|EYU38572.1| hypothetical protein MIMGU_mgv1a011717mg [Erythranthe guttata]
Length=272

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 92/137 (67%), Gaps = 5/137 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +NG RYD E HLVH++ D     RI V  ++Y+IG+ P+  LS +  ++  + +    
Sbjct  126  HTINGRRYDMELHLVHLNTDPNVKNRITVTGILYEIGK-PDKFLSKLMKNISSMIDKKDE  184

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            +  +G +DP+ ++ R + +YRYMGSLT PPCT+GV+WT+ + +++V++ Q+ L+R A+HD
Sbjct  185  EITVGKIDPDKIKLRSKMFYRYMGSLTVPPCTQGVIWTINKKVKTVSRDQIKLLREAVHD  244

Query  374  ESKTNARPLQTINDRFV  324
             ++ NARPLQ  N R V
Sbjct  245  YAEENARPLQPKNRRDV  261



>ref|XP_009407045.1| PREDICTED: alpha carbonic anhydrase 7-like [Musa acuminata subsp. 
malaccensis]
Length=269

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 92/134 (69%), Gaps = 2/134 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +N  R+  E H+VH S D + AV+  +Y+ G  P+P +  +E  ++K+ +    ++ +
Sbjct  127  HSINRRRFSLEMHMVHQSADNKTAVVGFLYKTG-PPDPFIHKLERSIEKVKDKQDKEEEL  185

Query  542  GYLDPNLLQAR-GRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  366
            G +DP+    R G+RYYRYMGSLTTPPC+EGV+WT++R +++V+K+Q+ L+R A+ D+ +
Sbjct  186  GAVDPSHASRRMGQRYYRYMGSLTTPPCSEGVIWTILRKVKTVSKKQLRLLRRAVDDDYE  245

Query  365  TNARPLQTINDRFV  324
             N+RP Q IN R +
Sbjct  246  NNSRPRQPINGRLI  259



>ref|XP_008387558.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=299

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 90/136 (66%), Gaps = 4/136 (3%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSND-GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG  546
            H VNG RYD E H+VH S D   IAV+A +Y++G+ PN  LS I  D+  +  T   +K 
Sbjct  139  HTVNGARYDLELHMVHQSADQNNIAVVAFLYEVGQ-PNAFLSKINQDISFVTSTK--EKK  195

Query  545  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  366
            +G +DP  ++    R+YRYMGSLTTPPCTEGV+WTV   +  V+++Q+ L++ A++D + 
Sbjct  196  LGVIDPREIKWDSSRFYRYMGSLTTPPCTEGVIWTVNEKVDIVSREQLDLLKEAVYDYAA  255

Query  365  TNARPLQTINDRFVKV  318
             NARPLQ    R +K+
Sbjct  256  ANARPLQRDEGRDIKL  271



>emb|CDX76409.1| BnaA08g09910D [Brassica napus]
Length=263

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 94/133 (71%), Gaps = 4/133 (3%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNGTRYD E H+VH S  G+ AV+ V+Y++ + PN  L+ + D +K + +    ++ +
Sbjct  128  HTVNGTRYDMELHMVHTSAGGKTAVIGVLYKL-DKPNEFLTRLLDGIKTVGKE---ERDL  183

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++ + +++YRY+GSLT PPCTEGV+WTV++ + +++ +Q+A +R+A+ D  +T
Sbjct  184  GIVDPRTIRFQTKKFYRYIGSLTVPPCTEGVIWTVVKRVNTISMEQIAALRSAVDDGYET  243

Query  362  NARPLQTINDRFV  324
            N+RP+Q  N R V
Sbjct  244  NSRPVQERNGRSV  256



>ref|XP_010322405.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X2 [Solanum lycopersicum]
Length=255

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 92/136 (68%), Gaps = 18/136 (13%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H ++G RYD EAHLVH+S+DG+IAV+A++Y+IG  P+ +L+++E DL  +A+  G +K +
Sbjct  128  HSIDGKRYDMEAHLVHMSSDGKIAVIAILYEIGLLPDDLLTILEGDLIAVADKKGAEKPM  187

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DPN+++     YYRY+GSLTTPPCT+GVVWT+                       ++
Sbjct  188  GIIDPNIIKLDVNIYYRYIGSLTTPPCTQGVVWTIDGK------------------GFES  229

Query  362  NARPLQTINDRFVKVD  315
            NARP+Q +N+R +K++
Sbjct  230  NARPVQPLNERSIKLN  245



>ref|XP_008227274.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Prunus mume]
Length=282

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 93/139 (67%), Gaps = 6/139 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +NG R   E H+VH+S D     +IAV+ V+Y+IG   N  LS +  D+K + +    
Sbjct  136  HSINGRRNAMELHMVHLSLDPNVTNKIAVVGVLYKIGRA-NSFLSKLTRDVKSMTDQKE-  193

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            K+ +G +DP  ++  G+ YYRYMGSLT PPCTEGV+WT+ + IR+V++ QV L R A+HD
Sbjct  194  KRNMGMIDPRKIKIGGKNYYRYMGSLTVPPCTEGVIWTIDKKIRTVSRDQVKLFRFAVHD  253

Query  374  ESKTNARPLQTINDRFVKV  318
             ++ NARP+Q +N R ++V
Sbjct  254  YAEMNARPVQPLNLREIQV  272



>emb|CAO98739.1| dioscorin 6 precursor [Dioscorea japonica]
Length=268

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+D EA LVH S D + AV++++++ G   +P LS +ED +K+ + +   +   
Sbjct  124  HEMNGERFDLEAQLVHESQDQKRAVVSILFRFGRA-DPFLSDLEDFIKQFSSSQKNEINA  182

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DPN LQ     YYRYMGS T PPCTEG+ WTV+R + +V+ +QV +++ A+++ +  
Sbjct  183  GIVDPNQLQIDDSAYYRYMGSFTAPPCTEGISWTVMRKVATVSPRQVLMLKQAVNENAIN  242

Query  362  NARPLQTINDRFV  324
            NARPLQ  N R V
Sbjct  243  NARPLQPTNFRSV  255



>ref|XP_010050537.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW89340.1| hypothetical protein EUGRSUZ_A01633 [Eucalyptus grandis]
Length=283

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 94/137 (69%), Gaps = 6/137 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +NG RY+ E H+VHV+ D     +IAV+ ++Y+ G+ PN  LS +  +++ + +  G 
Sbjct  137  HTINGRRYELELHMVHVTTDPDVKNKIAVVGLLYKTGQ-PNAFLSKLMGNVRSMVDKKGE  195

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            +K +G +DP  ++  G+ Y RYMGSLT PPCTEGV+WT+ + I +V+K Q+ L+R A+HD
Sbjct  196  RK-MGAIDPREIKMGGKSYLRYMGSLTVPPCTEGVIWTINKKIGTVSKDQIKLLREAVHD  254

Query  374  ESKTNARPLQTINDRFV  324
             ++ N+RP+Q +N R +
Sbjct  255  YAEKNSRPVQPLNRREI  271



>gb|KHN43087.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=131

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 89/125 (71%), Gaps = 2/125 (2%)
 Frame = -1

Query  683  LVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQ--AR  510
            +VH +  G+ AV+ ++Y+ G  P+P LSL+ + L  ++ + G ++ +  +DP L++    
Sbjct  1    MVHETPSGQTAVIGILYKAGRRPDPFLSLLTNHLMVISNSTGAEREVDVMDPRLVKIGTS  60

Query  509  GRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDR  330
               YYRY+GSLTTPPCTE + WT+++ ++SV+K+Q+ L+R+A+HD+   NARPLQ IN+R
Sbjct  61   TTLYYRYIGSLTTPPCTEDIAWTMLKEVKSVSKEQIRLLRDAVHDDFDANARPLQPINNR  120

Query  329  FVKVD  315
             V+++
Sbjct  121  LVQLN  125



>dbj|BAJ99342.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=285

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 87/131 (66%), Gaps = 1/131 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG RY+ E H+VH+S + + AV+   Y+IG   +  L  +E  L+++A T   +  +
Sbjct  136  HGVNGHRYNMELHMVHLSAENKAAVIGRFYKIGRR-DHFLHQLEPYLRRMASTNDKEDKV  194

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP + +  G  YYRYMGSLTTP C EGV+WTV++ + +V+  QV L+++A+HD    
Sbjct  195  GVVDPWVARGDGEAYYRYMGSLTTPKCDEGVIWTVVKRVATVSSDQVKLLKDAVHDGFDM  254

Query  362  NARPLQTINDR  330
            NARPLQ +NDR
Sbjct  255  NARPLQKVNDR  265



>ref|XP_010434249.1| PREDICTED: alpha carbonic anhydrase 4-like [Camelina sativa]
Length=267

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 92/133 (69%), Gaps = 4/133 (3%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNGTRYD E H+VH S  GR AV+ V+Y++G+ PN  L+ + + +K + +    +  +
Sbjct  132  HTVNGTRYDLELHMVHTSAGGRTAVIGVLYKLGK-PNEFLTKLLNGIKAVGQK---EVDL  187

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++ + R+++RY+GSLT PPCTEGV+WTV++ + +++ +Q+  +R A+HD  +T
Sbjct  188  GVIDPREIRFQTRKFFRYIGSLTVPPCTEGVLWTVVKRVNTISMEQITALREAVHDGFET  247

Query  362  NARPLQTINDRFV  324
            N+RP+Q    R V
Sbjct  248  NSRPVQESKGRSV  260



>emb|CBI33385.3| unnamed protein product [Vitis vinifera]
Length=271

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 88/131 (67%), Gaps = 3/131 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNGT +  E HLVH S  G+IAV+   +++G  P+P L+ + D +  +    G +K I
Sbjct  129  HTVNGTSFQMELHLVHKSARGKIAVIGKTFKLG-PPDPFLAKMIDHVTGIPA--GEEKDI  185

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +D N ++  GR+YYRY+GSLTTPPCTEGV+WT+ + + +V+K+QV  +R  +HD  + 
Sbjct  186  GIVDANDIKHWGRKYYRYIGSLTTPPCTEGVIWTISKKVNTVSKEQVESLRRVVHDGHEG  245

Query  362  NARPLQTINDR  330
            NARP Q +N R
Sbjct  246  NARPAQRLNGR  256



>ref|XP_008364026.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=246

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 92/133 (69%), Gaps = 3/133 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H  NG+RY  E H+VH+S+ G+IAV+ ++Y+ G  P+P+LS +   +K +     V   I
Sbjct  105  HTFNGSRYALEFHVVHLSSTGKIAVIGIVYKYGR-PDPLLSKLFHHIKSVGIEEEVD--I  161

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G ++P  ++   R+YYRY+GSLT PPCTEGV+WT+++ +R+V+++QV  +R A+HD  + 
Sbjct  162  GIINPGDIKFGSRKYYRYIGSLTVPPCTEGVIWTIVKKVRTVSREQVHALREAVHDGFEM  221

Query  362  NARPLQTINDRFV  324
            NARP Q ++ R V
Sbjct  222  NARPTQELDGRPV  234



>ref|XP_002278815.1| PREDICTED: alpha carbonic anhydrase 4-like [Vitis vinifera]
Length=279

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 89/133 (67%), Gaps = 3/133 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNGT +  E HLVH S  G+IAV+   +++G  P+P L+ + D +  +    G +K I
Sbjct  137  HTVNGTSFQMELHLVHKSARGKIAVIGKTFKLG-PPDPFLAKMIDHVTGIPA--GEEKDI  193

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +D N ++  GR+YYRY+GSLTTPPCTEGV+WT+ + + +V+K+QV  +R  +HD  + 
Sbjct  194  GIVDANDIKHWGRKYYRYIGSLTTPPCTEGVIWTISKKVNTVSKEQVESLRRVVHDGHEG  253

Query  362  NARPLQTINDRFV  324
            NARP Q +N R V
Sbjct  254  NARPAQRLNGRPV  266



>ref|XP_008227264.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Prunus mume]
Length=282

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 90/139 (65%), Gaps = 6/139 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +N   YD E H++H+S D     +IAV+AV+Y+IG   N  LS +   +K + +    
Sbjct  135  HSINNRSYDMELHMIHISPDLNVTNKIAVIAVLYKIGRA-NSFLSTLTRHVKSMIDE-NH  192

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            +  IG  DP  ++  G+ YYRYMGSLT PPCTEGV+WT+ + IR+V++ QV L R A+HD
Sbjct  193  EISIGMTDPRKIKIGGKNYYRYMGSLTVPPCTEGVIWTITKKIRTVSRDQVKLFREAVHD  252

Query  374  ESKTNARPLQTINDRFVKV  318
             ++ NARP+Q +N R + V
Sbjct  253  YAEVNARPVQPLNLREIHV  271



>ref|XP_003520661.2| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=276

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 95/139 (68%), Gaps = 6/139 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSN--DG--RIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +NG RYD E H+VHVS   DG  + AV+ ++Y+ G +P+P+LS +   + ++ E    
Sbjct  129  HTINGRRYDLELHMVHVSPQPDGTNKTAVVGILYKYG-SPDPLLSKLGKYITEIPEE-DE  186

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            +K +G +DP+ +    + YYRYMGSLT PPCTEG++WTV + +R+V++ QV L+++ +H 
Sbjct  187  EKSVGVIDPSKIMKGSKMYYRYMGSLTVPPCTEGIIWTVDKKVRTVSRGQVKLVKDTLHG  246

Query  374  ESKTNARPLQTINDRFVKV  318
              K NARPLQ++N R +K 
Sbjct  247  YVKKNARPLQSLNQREIKF  265



>gb|ACT36293.1| dioscorin precursor [Dioscorea japonica]
Length=268

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+D EA LVH S D + AV++++++ G   +P LS +ED +++ + +   +   
Sbjct  124  HEMNGERFDLEAQLVHESQDQKRAVVSILFRFGRA-DPFLSDLEDFIRQFSSSQKNEINA  182

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DPN LQ     YYRYMGS T PPCTEG+ WTV+R + +V+ +QV L++ A+++ +  
Sbjct  183  GVVDPNQLQIDDSAYYRYMGSFTAPPCTEGISWTVMRKVATVSPRQVLLLKQAVNENAIN  242

Query  362  NARPLQTINDRFV  324
            NARPLQ  N R V
Sbjct  243  NARPLQPTNFRSV  255



>ref|XP_010458030.1| PREDICTED: alpha carbonic anhydrase 5 [Camelina sativa]
Length=274

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 85/131 (65%), Gaps = 1/131 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH S DGR AV+A  Y++G  P+  L  +E  L ++ +T   ++ +
Sbjct  134  HTINGKRFILEEHMVHQSKDGRNAVVAFFYKLGR-PDFFLLSLERYLMRITDTHEAEESV  192

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G + P       + YYRY+GSLTTPPC+E V WT+ + +R+VT +Q+ ++R  +HD+S T
Sbjct  193  GMIHPRTFDFESKHYYRYLGSLTTPPCSENVTWTISKEMRTVTLKQLIMLRVTVHDQSNT  252

Query  362  NARPLQTINDR  330
            NARPLQ  N R
Sbjct  253  NARPLQRQNQR  263



>ref|XP_009768444.1| PREDICTED: alpha carbonic anhydrase 7-like [Nicotiana sylvestris]
Length=124

 Score =   122 bits (306),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -1

Query  608  ILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRT  429
            +L  IEDDLK LA T GV++ IG +DP  ++   R+YYRY+GSLT PPCT+ VVWT++R 
Sbjct  20   LLLHIEDDLKALAHTKGVERNIGVIDPKQVKLGSRKYYRYIGSLTVPPCTQDVVWTIVRK  79

Query  428  IRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  318
            +R+VT++Q+ LIR A+HDES+TN+RP+Q  N R +++
Sbjct  80   VRTVTREQMKLIREAVHDESETNSRPVQAANKRPIRL  116



>gb|ACT36292.1| dioscorin precursor [Dioscorea japonica]
Length=271

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+D EA LVH S D + AV++++++ G   +P LS +ED +K+ + +   +   
Sbjct  127  HEMNGERFDLEAQLVHESQDQKRAVVSILFRFGRA-DPFLSDLEDFIKQFSSSQKNEINA  185

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DPN LQ     YYRYMGS T PPCTEG+ WTV+R + +V+ +QV L++ A+++ +  
Sbjct  186  GVVDPNQLQIDDSAYYRYMGSFTAPPCTEGISWTVMRKVATVSPRQVLLLKQAVNENAIN  245

Query  362  NARPLQTINDRFV  324
            NARP+Q  N R V
Sbjct  246  NARPVQPTNFRSV  258



>dbj|BAD18021.1| tuber storage protein [Dioscorea polystachya]
Length=268

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+D EA LVH S D + AV+++++  G   +P LS +ED +K+ + +   +   
Sbjct  124  HEMNGERFDLEAQLVHESQDQKRAVVSILFIFGRA-DPFLSDLEDFIKQFSSSQKNEINA  182

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DPN LQ     YYRYMGS T PPCTEG+ WTV+R + +V+ +QV L++ A+++ +  
Sbjct  183  GVVDPNQLQIDDSAYYRYMGSFTAPPCTEGISWTVMRKVATVSPRQVLLLKQAVNENAIN  242

Query  362  NARPLQTINDRFV  324
            NARPLQ  N R V
Sbjct  243  NARPLQPTNFRSV  255



>gb|EMT14740.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Aegilops tauschii]
Length=285

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 89/131 (68%), Gaps = 1/131 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG RY  E H+VH+S + + AV+ ++Y IG +P+  L  +E  L+++A+    ++ +
Sbjct  136  HRLNGRRYSLELHMVHLSAENKAAVIGLLYDIG-SPDDFLHKLEPYLRRMADMKEKEEKV  194

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP + +  G  YYRYMGSLTTP C EGV+WTVI+ + +V+  Q+ L+ +A+HD  + 
Sbjct  195  GVVDPWVARGDGEAYYRYMGSLTTPACDEGVIWTVIKRVATVSSDQLKLLTDAVHDGFEM  254

Query  362  NARPLQTINDR  330
            NARPLQ +N R
Sbjct  255  NARPLQKVNGR  265



>ref|XP_007213463.1| hypothetical protein PRUPE_ppa024299mg [Prunus persica]
 gb|EMJ14662.1| hypothetical protein PRUPE_ppa024299mg [Prunus persica]
Length=282

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 90/139 (65%), Gaps = 6/139 (4%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  555
            H +N   YD E H++H+S D     +IAV+AV+Y+IG   N  LS +   +K + +    
Sbjct  135  HSINNRSYDMELHMIHISPDLNVTNKIAVIAVLYKIGRA-NSFLSTLTRHVKSMIDE-NH  192

Query  554  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  375
            +  IG  DP  ++  G+ YYRYMGSLT PPCTEGV+WT+ + IR+V++ QV L R A+HD
Sbjct  193  EISIGMTDPRKIRIGGKNYYRYMGSLTVPPCTEGVIWTITKKIRTVSRDQVKLFREAVHD  252

Query  374  ESKTNARPLQTINDRFVKV  318
             ++ NARP+Q +N R + V
Sbjct  253  YAEVNARPVQPLNLREIHV  271



>emb|CDX84811.1| BnaA03g14190D [Brassica napus]
Length=242

 Score =   125 bits (314),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 91/135 (67%), Gaps = 4/135 (3%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+  E H+VH S +G +AV+ V+Y+IG  P+  LSL+E+ L  + +    +  I
Sbjct  106  HTINGRRFALELHMVHESINGSMAVVTVLYKIGR-PDSFLSLLENKLCAITDHNEAEINI  164

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++   R+YYRY+GSLT PPCT+ V+WTVI+ +R+V++ QV L+R A  D   T
Sbjct  165  GMIDPKDIKFGSRKYYRYIGSLTIPPCTQNVIWTVIKKVRTVSRNQVKLLRVAYSD---T  221

Query  362  NARPLQTINDRFVKV  318
            NARP+Q  N R VK+
Sbjct  222  NARPVQPTNMRTVKL  236



>ref|XP_009775004.1| PREDICTED: alpha carbonic anhydrase 7-like [Nicotiana sylvestris]
Length=272

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 90/133 (68%), Gaps = 3/133 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDG--RIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK  549
            H VNG RY  E H+VH++ +   +IAV+ V+Y+ G+ P+  LS +  ++  + +     K
Sbjct  130  HTVNGRRYAMEMHMVHLNENATNKIAVIGVLYKFGK-PDKFLSRLIRNISSMIDKKDEVK  188

Query  548  GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES  369
              G ++P  ++   RRYYRY+GSLT PPCTEGV+W++ + +R++++ QV L+R A+HD +
Sbjct  189  NAGMINPREIKIGSRRYYRYLGSLTVPPCTEGVIWSIKKKVRTISRDQVKLLREAVHDYA  248

Query  368  KTNARPLQTINDR  330
             +NARP+Q +N R
Sbjct  249  ASNARPMQPLNKR  261



>ref|XP_008360674.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=280

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 92/133 (69%), Gaps = 3/133 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H  NG+RY  E H+VH+S+ G+IAV+ ++Y+ G  P+P+LS +   +K +     V   I
Sbjct  139  HTFNGSRYALEFHVVHLSSTGKIAVIGIVYKYGR-PDPLLSKLFHHIKSVGIEEEVD--I  195

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G ++P  ++   R+YYRY+GSLT PPCTEGV+WT+++ +R+V+++QV  +R A+HD  + 
Sbjct  196  GIINPGDIKFGSRKYYRYIGSLTVPPCTEGVIWTIVKKVRTVSREQVHALREAVHDGFEM  255

Query  362  NARPLQTINDRFV  324
            NARP Q ++ R V
Sbjct  256  NARPTQELDGRPV  268



>gb|KJB35974.1| hypothetical protein B456_006G135100 [Gossypium raimondii]
Length=279

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 89/131 (68%), Gaps = 3/131 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H  NGTRY+ E HLVH+S    IAV+A++Y+ G  P+P L+ +   +K +      +K +
Sbjct  138  HTFNGTRYELELHLVHISAHRGIAVIAIVYKYGR-PDPFLTRLFHHIKTINGKE--EKHL  194

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G ++P  ++   R+Y+RYMGSLT PPCTEGVVWTVI  +R+V++ QV  +R+A+HD  + 
Sbjct  195  GMVNPGDIKFGSRKYFRYMGSLTVPPCTEGVVWTVINKVRTVSRDQVKALRDAVHDGFEA  254

Query  362  NARPLQTINDR  330
            NARP Q ++ R
Sbjct  255  NARPTQPLDGR  265



>ref|XP_011048097.1| PREDICTED: alpha carbonic anhydrase 4-like [Populus euphratica]
Length=285

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 91/133 (68%), Gaps = 3/133 (2%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H  NG+RYD E HLVH S+ G +AV A++Y+ G  P+  LS +   + +L     +  GI
Sbjct  144  HTFNGSRYDLELHLVHYSSQGGVAVSAIVYKYGR-PDRFLSRLFHHITRLDPEEEIDAGI  202

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
              ++P  ++   R+YYRY+GSLT+PPCTEGV+WT+++ +R+V+++QV  +R+A+HD  + 
Sbjct  203  --VNPGDIKFGSRKYYRYIGSLTSPPCTEGVIWTIVKKVRTVSREQVKALRDAVHDGFEA  260

Query  362  NARPLQTINDRFV  324
            NARP Q+ + R V
Sbjct  261  NARPTQSSDGRAV  273



>ref|XP_010904591.1| PREDICTED: alpha carbonic anhydrase 7-like [Elaeis guineensis]
Length=294

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 88/133 (66%), Gaps = 4/133 (3%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H   G RY  E H+VHVS+DG IAV+ +MYQ G  P+P LS ++  L+ L  T   +  +
Sbjct  152  HKFFGERYPLELHMVHVSSDGSIAVIGIMYQFG-CPDPFLSELKKYLEYLIMTQNDEVVV  210

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            GYL P  ++ +G  YYRY GSLTTPPCTE V W ++  +R+V++ Q+ L+R A+HD  K 
Sbjct  211  GYLSPPPIK-KGASYYRYSGSLTTPPCTENVTWILLHEVRTVSEGQLRLLRTAVHD--KD  267

Query  362  NARPLQTINDRFV  324
            NARP+Q IN R V
Sbjct  268  NARPIQPINGRKV  280



>ref|XP_003553396.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=275

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 91/135 (67%), Gaps = 8/135 (6%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NGT++D E H VH S+ G  AV+ ++Y+IG +P+P  S + +D+K       V K I
Sbjct  135  HTLNGTKFDLELHAVHKSSKGEFAVIGILYKIG-SPDPFFSKLLNDIKS-----SVDKDI  188

Query  542  --GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES  369
              G ++P  ++ + R YYRY+GSLTTPPCTEGVVWT+++ +R+V+ +Q++ ++ A+H   
Sbjct  189  DVGVINPREIKFKSRPYYRYVGSLTTPPCTEGVVWTIVKKVRTVSSEQLSALKGAVHHGY  248

Query  368  KTNARPLQTINDRFV  324
            + NARP Q +  R V
Sbjct  249  EENARPTQELGGRQV  263



>ref|XP_008241447.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Prunus mume]
Length=274

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 91/132 (69%), Gaps = 4/132 (3%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSND-GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG  546
            H +NG RYD E H++H S D    AV+A++++IG +PNP+LS + + L+ +  T   +  
Sbjct  130  HSINGIRYDLELHMLHQSPDPNNKAVVALLFKIG-SPNPLLSKVHNGLESMIFTKETQ--  186

Query  545  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  366
            +   DP+ ++    ++YRY+GSLTTPPCTEGV+WTV   + +V+K+Q+ L++ A+HD +K
Sbjct  187  LELTDPSEIKWSSLKFYRYIGSLTTPPCTEGVIWTVNEMVNTVSKEQLELLKQAVHDYAK  246

Query  365  TNARPLQTINDR  330
             NARP Q  NDR
Sbjct  247  MNARPSQPFNDR  258



>gb|EMT11024.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Aegilops tauschii]
Length=285

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 89/131 (68%), Gaps = 1/131 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNG RY+ E H+VH+S + + AV+ ++Y+IG   +  L  +E  L+++A+T   ++ +
Sbjct  136  HRVNGRRYNLELHMVHLSAENKTAVIGILYKIGRRDH-FLHELESYLRRIADTKEKEEMV  194

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP   +  G  YYRYMGSLTTP C EGV+WTVI+ + +V+  Q+ L+ +A+HD  + 
Sbjct  195  GVVDPWEARGDGEAYYRYMGSLTTPACDEGVIWTVIKRVATVSSHQLKLLTDAVHDGFEM  254

Query  362  NARPLQTINDR  330
            NARPLQ +N R
Sbjct  255  NARPLQKVNGR  265



>ref|XP_006489872.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Citrus sinensis]
Length=273

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 90/131 (69%), Gaps = 4/131 (3%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG+ Y+ E HLVH+S+DG++AV  ++Y+ G  P+P LS +   +K L +    +K +
Sbjct  135  HTINGSSYEMELHLVHLSSDGKLAVTGIVYEYGR-PDPFLSKLLHHIKSLGKE---EKEV  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G ++P  ++   R+YYRY+GSLT PPCTEGV+WT+ + +R+V+++QV  ++  +HD  + 
Sbjct  191  GIVNPGDIKFGSRKYYRYIGSLTVPPCTEGVIWTIGKKVRTVSREQVRALKEEVHDGYEK  250

Query  362  NARPLQTINDR  330
            NARP   +N R
Sbjct  251  NARPTNELNGR  261



>ref|NP_193831.1| alpha carbonic anhydrase 4 [Arabidopsis thaliana]
 sp|F4JIK2.1|ATCA4_ARATH RecName: Full=Alpha carbonic anhydrase 4; Short=AtaCA4; Short=AtalphaCA4; 
AltName: Full=Alpha carbonate dehydratase 4; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE84385.1| alpha carbonic anhydrase 4 [Arabidopsis thaliana]
Length=267

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 90/133 (68%), Gaps = 4/133 (3%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H VNGTRYD E H+VH S  GR AV+ V+Y++GE PN  L+ + + +K +      +  +
Sbjct  132  HTVNGTRYDLELHMVHTSARGRTAVIGVLYKLGE-PNEFLTKLLNGIKAVGNK---EINL  187

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DP  ++ + R++YRY+GSLT PPCTEGV+WTV++ + +++ +Q+  +R A+ D  +T
Sbjct  188  GMIDPREIRFQTRKFYRYIGSLTVPPCTEGVIWTVVKRVNTISMEQITALRQAVDDGFET  247

Query  362  NARPLQTINDRFV  324
            N+RP+Q    R V
Sbjct  248  NSRPVQDSKGRSV  260



>gb|ACT36290.1| dioscorin precursor [Dioscorea japonica]
Length=276

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  722  HVVNGTRYDXEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  543
            H +NG R+D EA LVH S D + AV++++++ G   +P LS +ED +K+ + +   +   
Sbjct  132  HEMNGERFDLEAQLVHESQDQKRAVVSILFRFGRA-DPFLSDLEDFIKQFSNSQKNEINA  190

Query  542  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  363
            G +DPN LQ     Y+RYMGS T PPCTEG+ WTV R + +V+ +QV L++ A+++ +  
Sbjct  191  GVVDPNQLQIDDSAYFRYMGSFTAPPCTEGISWTVTRKVATVSPRQVLLLKQAVNENAIN  250

Query  362  NARPLQTINDRFV  324
            NARPLQ  N R V
Sbjct  251  NARPLQPTNFRSV  263



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273595176425