BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF022P17

Length=694
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009803135.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    243   7e-73   Nicotiana sylvestris
ref|XP_009602562.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    242   2e-72   Nicotiana tomentosiformis
dbj|BAL14273.1|  FK506-binding protein                                  242   2e-72   Nicotiana tabacum [American tobacco]
gb|EYU39186.1|  hypothetical protein MIMGU_mgv1a003614mg                239   2e-71   Erythranthe guttata [common monkey flower]
emb|CBI41091.3|  unnamed protein product                                232   3e-71   Vitis vinifera
ref|XP_002268161.3|  PREDICTED: peptidyl-prolyl cis-trans isomera...    232   5e-71   Vitis vinifera
emb|CDP03935.1|  unnamed protein product                                236   4e-70   Coffea canephora [robusta coffee]
ref|XP_011089642.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    235   7e-70   Sesamum indicum [beniseed]
ref|XP_004242423.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    235   7e-70   
gb|KDP45275.1|  hypothetical protein JCGZ_15140                         234   1e-69   Jatropha curcas
gb|ACU23964.1|  unknown                                                 223   8e-69   Glycine max [soybeans]
ref|XP_002263566.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    231   2e-68   Vitis vinifera
ref|XP_002301809.1|  hypothetical protein POPTR_0002s24970g             231   3e-68   Populus trichocarpa [western balsam poplar]
ref|XP_010247135.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    230   5e-68   Nelumbo nucifera [Indian lotus]
ref|XP_007049646.1|  Rotamase FKBP 1 isoform 1                          230   7e-68   
ref|XP_009610546.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    230   8e-68   Nicotiana tomentosiformis
ref|XP_011024591.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    229   9e-68   Populus euphratica
ref|XP_004510236.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    230   9e-68   Cicer arietinum [garbanzo]
ref|XP_009787495.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    229   1e-67   Nicotiana sylvestris
ref|XP_006352668.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    229   1e-67   Solanum tuberosum [potatoes]
ref|XP_002535081.1|  peptidylprolyl isomerase, putative                 229   2e-67   Ricinus communis
ref|XP_011024590.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    229   2e-67   Populus euphratica
gb|KDO40265.1|  hypothetical protein CISIN_1g008113mg                   228   3e-67   Citrus sinensis [apfelsine]
ref|XP_006437245.1|  hypothetical protein CICLE_v10031088mg             228   3e-67   Citrus clementina [clementine]
ref|XP_010247134.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    228   4e-67   Nelumbo nucifera [Indian lotus]
gb|KJB08781.1|  hypothetical protein B456_001G103400                    228   4e-67   Gossypium raimondii
gb|KJB42565.1|  hypothetical protein B456_007G157600                    225   7e-67   Gossypium raimondii
ref|XP_010036767.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    227   9e-67   Eucalyptus grandis [rose gum]
gb|KCW48408.1|  hypothetical protein EUGRSUZ_K02110                     224   1e-66   Eucalyptus grandis [rose gum]
gb|KHG19334.1|  Peptidyl-prolyl cis-trans isomerase FKBP62 -like ...    226   3e-66   Gossypium arboreum [tree cotton]
gb|KJB42562.1|  hypothetical protein B456_007G157600                    225   4e-66   Gossypium raimondii
gb|KJB42563.1|  hypothetical protein B456_007G157600                    225   5e-66   Gossypium raimondii
gb|KHN44911.1|  Peptidyl-prolyl cis-trans isomerase FKBP62              225   5e-66   Glycine soja [wild soybean]
ref|XP_003520990.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    225   5e-66   Glycine max [soybeans]
ref|XP_003626943.1|  70 kDa peptidyl-prolyl isomerase                   225   5e-66   Medicago truncatula
ref|XP_008778813.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    223   6e-66   
ref|XP_008792944.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    225   6e-66   Phoenix dactylifera
ref|XP_010905156.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    224   8e-66   Elaeis guineensis
ref|XP_010036768.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    224   1e-65   Eucalyptus grandis [rose gum]
gb|AFK35673.1|  unknown                                                 224   1e-65   Medicago truncatula
gb|KJB42559.1|  hypothetical protein B456_007G157600                    224   2e-65   Gossypium raimondii
ref|XP_007200299.1|  hypothetical protein PRUPE_ppa003471mg             223   2e-65   Prunus persica
ref|XP_008794657.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    223   3e-65   Phoenix dactylifera
ref|XP_010647328.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    223   4e-65   
ref|XP_008778812.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    223   4e-65   Phoenix dactylifera
ref|XP_009372201.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    223   4e-65   Pyrus x bretschneideri [bai li]
ref|XP_004247044.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    222   4e-65   Solanum lycopersicum
ref|XP_008244682.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    222   7e-65   Prunus mume [ume]
ref|XP_009371084.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    212   1e-64   
ref|XP_002534361.1|  peptidylprolyl isomerase, putative                 222   1e-64   
gb|KDO40264.1|  hypothetical protein CISIN_1g008113mg                   221   2e-64   Citrus sinensis [apfelsine]
gb|EPS61356.1|  hypothetical protein M569_13437                         215   5e-64   Genlisea aurea
ref|XP_010905157.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    220   5e-64   
ref|XP_006840897.1|  hypothetical protein AMTR_s00087p00078190          220   6e-64   Amborella trichopoda
ref|XP_008372538.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    219   7e-64   Malus domestica [apple tree]
ref|XP_007134161.1|  hypothetical protein PHAVU_010G024500g             219   1e-63   Phaseolus vulgaris [French bean]
ref|XP_006363450.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    216   2e-63   Solanum tuberosum [potatoes]
ref|XP_010532918.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    216   8e-63   Tarenaya hassleriana [spider flower]
ref|XP_006363451.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    216   9e-63   Solanum tuberosum [potatoes]
ref|XP_009420312.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    216   1e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO40263.1|  hypothetical protein CISIN_1g008113mg                   216   1e-62   Citrus sinensis [apfelsine]
gb|KJB08784.1|  hypothetical protein B456_001G103400                    216   1e-62   Gossypium raimondii
ref|XP_007034164.1|  FKBP-type peptidyl-prolyl cis-trans isomeras...    216   1e-62   
gb|KGN57238.1|  hypothetical protein Csa_3G172920                       216   1e-62   Cucumis sativus [cucumbers]
gb|KHN25146.1|  Peptidyl-prolyl cis-trans isomerase FKBP62              213   2e-62   Glycine soja [wild soybean]
ref|XP_006418643.1|  hypothetical protein EUTSA_v10002468mg             215   2e-62   Eutrema salsugineum [saltwater cress]
ref|XP_008382577.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    215   2e-62   
ref|XP_006437244.1|  hypothetical protein CICLE_v10031088mg             215   3e-62   
ref|XP_009349114.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    215   3e-62   Pyrus x bretschneideri [bai li]
ref|XP_009371078.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    213   3e-62   
ref|XP_004160641.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    215   3e-62   
ref|XP_010926682.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    214   3e-62   Elaeis guineensis
ref|XP_004147650.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    215   4e-62   
ref|XP_008439052.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    215   4e-62   Cucumis melo [Oriental melon]
ref|XP_009385667.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    215   4e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010466944.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    214   6e-62   Camelina sativa [gold-of-pleasure]
ref|XP_004149324.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    214   8e-62   Cucumis sativus [cucumbers]
ref|XP_010488634.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    214   8e-62   Camelina sativa [gold-of-pleasure]
gb|KDO40262.1|  hypothetical protein CISIN_1g008113mg                   214   8e-62   Citrus sinensis [apfelsine]
ref|XP_008458076.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    213   9e-62   Cucumis melo [Oriental melon]
gb|KDO40266.1|  hypothetical protein CISIN_1g008113mg                   213   1e-61   Citrus sinensis [apfelsine]
ref|XP_010514063.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    213   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_007034162.1|  FKBP-type peptidyl-prolyl cis-trans isomeras...    214   2e-61   
ref|NP_001052535.1|  Os04g0352400                                       213   3e-61   
gb|AGT17361.1|  peptidylprolyl isomerase                                213   3e-61   Saccharum hybrid cultivar R570
ref|XP_010100792.1|  Peptidyl-prolyl cis-trans isomerase FKBP62         212   3e-61   
ref|NP_189160.3|  rotamase FKBP 1                                       211   6e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006652190.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    211   8e-61   
ref|XP_009406340.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    211   8e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009373610.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    211   9e-61   Pyrus x bretschneideri [bai li]
sp|Q43207.1|FKB70_WHEAT  RecName: Full=70 kDa peptidyl-prolyl iso...    211   9e-61   Triticum aestivum [Canadian hard winter wheat]
gb|AAB82061.1|  rof1                                                    211   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009410619.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    211   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010550903.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    211   1e-60   Tarenaya hassleriana [spider flower]
ref|XP_009136108.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    211   1e-60   Brassica rapa
ref|XP_008352304.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    211   1e-60   Malus domestica [apple tree]
dbj|BAB02082.1|  peptidylprolyl isomerase; FK506-binding protein        210   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010685108.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    209   3e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002883594.1|  peptidylprolyl isomerase                           209   3e-60   
ref|XP_002321107.2|  hypothetical protein POPTR_0014s14690g             210   3e-60   
emb|CDP15134.1|  unnamed protein product                                210   3e-60   Coffea canephora [robusta coffee]
emb|CDY52281.1|  BnaA03g57740D                                          209   5e-60   Brassica napus [oilseed rape]
gb|KEH20636.1|  peptidyl-prolyl cis-trans isomerase FKBP62-like p...    209   6e-60   Medicago truncatula
dbj|BAK01956.1|  predicted protein                                      209   6e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006358774.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    209   6e-60   Solanum tuberosum [potatoes]
gb|EMS57053.1|  70 kDa peptidyl-prolyl isomerase                        209   9e-60   Triticum urartu
ref|XP_004975324.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    209   1e-59   Setaria italica
ref|NP_001118695.1|  rotamase FKBP 1                                    208   1e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008222791.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    208   1e-59   Prunus mume [ume]
ref|NP_001149790.1|  LOC100283417                                       207   2e-59   Zea mays [maize]
emb|CDY15103.1|  BnaC03g44640D                                          207   2e-59   Brassica napus [oilseed rape]
ref|XP_011000006.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    208   2e-59   Populus euphratica
gb|AIU40165.1|  peptidyl-prolyl cis-trans isomerase                     204   2e-59   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004504386.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    207   2e-59   Cicer arietinum [garbanzo]
tpg|DAA48152.1|  TPA: hypothetical protein ZEAMMB73_593378              207   2e-59   
ref|XP_007222365.1|  hypothetical protein PRUPE_ppa003399mg             207   2e-59   Prunus persica
ref|NP_001062292.1|  Os08g0525600                                       207   3e-59   
ref|XP_006492988.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    207   3e-59   
gb|KDP32575.1|  hypothetical protein JCGZ_13125                         207   4e-59   Jatropha curcas
ref|XP_006659596.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    207   4e-59   Oryza brachyantha
ref|XP_007034163.1|  FKBP-type peptidyl-prolyl cis-trans isomeras...    207   4e-59   
dbj|BAK02378.1|  predicted protein                                      206   4e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN10949.1|  Peptidyl-prolyl cis-trans isomerase FKBP62              206   5e-59   Glycine soja [wild soybean]
ref|XP_004290160.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    206   7e-59   Fragaria vesca subsp. vesca
emb|CAA68913.1|  peptidylprolyl isomerase                               206   9e-59   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007153782.1|  hypothetical protein PHAVU_003G064500g             206   1e-58   Phaseolus vulgaris [French bean]
gb|EMT25795.1|  70 kDa peptidyl-prolyl isomerase                        206   1e-58   
ref|XP_003574798.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase        205   1e-58   Brachypodium distachyon [annual false brome]
gb|EYU40640.1|  hypothetical protein MIMGU_mgv1a003616mg                205   1e-58   Erythranthe guttata [common monkey flower]
ref|XP_004973965.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    205   1e-58   
ref|XP_003524915.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    205   1e-58   Glycine max [soybeans]
gb|KJB42564.1|  hypothetical protein B456_007G157600                    204   2e-58   Gossypium raimondii
ref|XP_008669632.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    205   3e-58   Zea mays [maize]
ref|XP_004504385.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    204   5e-58   
gb|KHN12365.1|  Peptidyl-prolyl cis-trans isomerase FKBP65              203   7e-58   Glycine soja [wild soybean]
gb|EEC83911.1|  hypothetical protein OsI_29964                          202   2e-57   Oryza sativa Indica Group [Indian rice]
ref|NP_199668.1|  peptidyl-prolyl cis-trans isomerase FKBP65            202   2e-57   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE99990.1|  peptidylprolyl isomerase                               202   2e-57   Arabidopsis thaliana [mouse-ear cress]
gb|EMT24309.1|  70 kDa peptidyl-prolyl isomerase                        202   3e-57   
ref|XP_010547132.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    202   3e-57   Tarenaya hassleriana [spider flower]
ref|XP_003579568.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    202   3e-57   Brachypodium distachyon [annual false brome]
gb|KJB08782.1|  hypothetical protein B456_001G103400                    201   3e-57   Gossypium raimondii
gb|ABK95085.1|  unknown                                                 202   4e-57   Populus trichocarpa [western balsam poplar]
ref|XP_004975323.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    204   4e-57   
ref|XP_006375512.1|  hypothetical protein POPTR_0014s14690g             202   5e-57   
ref|XP_003532733.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    201   5e-57   Glycine max [soybeans]
ref|XP_002436973.1|  hypothetical protein SORBIDRAFT_10g012970          201   6e-57   Sorghum bicolor [broomcorn]
ref|XP_004247908.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    201   6e-57   
gb|ABK24451.1|  unknown                                                 201   7e-57   Picea sitchensis
ref|XP_011000005.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    201   7e-57   Populus euphratica
ref|XP_003552100.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   1e-56   Glycine max [soybeans]
ref|XP_007140683.1|  hypothetical protein PHAVU_008G133100g             199   2e-56   Phaseolus vulgaris [French bean]
gb|AFK48238.1|  unknown                                                 199   2e-56   Lotus japonicus
tpg|DAA48154.1|  TPA: hypothetical protein ZEAMMB73_593378              191   3e-56   
ref|XP_003547780.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   3e-56   Glycine max [soybeans]
ref|XP_002865651.1|  hypothetical protein ARALYDRAFT_494919             198   5e-56   
ref|XP_006395163.1|  hypothetical protein EUTSA_v10003906mg             198   6e-56   Eutrema salsugineum [saltwater cress]
ref|XP_004296967.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   2e-55   Fragaria vesca subsp. vesca
ref|XP_010023594.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   3e-55   Eucalyptus grandis [rose gum]
ref|XP_002453845.1|  hypothetical protein SORBIDRAFT_04g019590          196   1e-54   Sorghum bicolor [broomcorn]
ref|XP_004952509.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    196   1e-54   Setaria italica
gb|KEH22557.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           194   2e-54   Medicago truncatula
ref|XP_004492269.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    193   3e-54   Cicer arietinum [garbanzo]
gb|KHF97531.1|  Peptidyl-prolyl cis-trans isomerase FKBP65 -like ...    194   3e-54   Gossypium arboreum [tree cotton]
ref|XP_007034165.1|  FKBP-type peptidyl-prolyl cis-trans isomeras...    193   4e-54   
ref|XP_010023593.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    194   4e-54   Eucalyptus grandis [rose gum]
gb|KJB37904.1|  hypothetical protein B456_006G225400                    193   4e-54   Gossypium raimondii
gb|KHN03897.1|  Peptidyl-prolyl cis-trans isomerase FKBP62              181   4e-54   Glycine soja [wild soybean]
gb|KJB37901.1|  hypothetical protein B456_006G225400                    193   5e-54   Gossypium raimondii
ref|XP_011084142.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    193   1e-53   Sesamum indicum [beniseed]
gb|AFW71473.2|  peptidyl-prolyl isomerase                               192   2e-53   
ref|XP_002977259.1|  hypothetical protein SELMODRAFT_443450             191   3e-53   Selaginella moellendorffii
emb|CDX86295.1|  BnaA06g30120D                                          191   4e-53   
ref|NP_001151484.1|  LOC100285117                                       192   4e-53   Zea mays [maize]
gb|ACN30883.1|  unknown                                                 192   5e-53   Zea mays [maize]
ref|XP_009151655.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   1e-52   Brassica rapa
gb|KJB37905.1|  hypothetical protein B456_006G225400                    189   2e-52   Gossypium raimondii
gb|EMT19050.1|  70 kDa peptidyl-prolyl isomerase                        189   4e-52   
gb|KJB28026.1|  hypothetical protein B456_005G022600                    187   4e-52   Gossypium raimondii
ref|XP_002992143.1|  hypothetical protein SELMODRAFT_134839             186   3e-51   
ref|XP_001769063.1|  predicted protein                                  184   1e-50   
gb|EEC73201.1|  hypothetical protein OsI_07270                          184   1e-50   Oryza sativa Indica Group [Indian rice]
ref|XP_006280236.1|  hypothetical protein CARUB_v10026151mg             183   2e-50   Capsella rubella
gb|EEE57017.1|  hypothetical protein OsJ_06790                          183   4e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003574982.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    183   6e-50   Brachypodium distachyon [annual false brome]
ref|NP_001046873.1|  Os02g0491400                                       183   7e-50   
ref|XP_010442282.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    182   8e-50   
ref|XP_010493687.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    182   8e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010482107.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    182   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006647293.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    180   2e-49   
emb|CDX85348.1|  BnaC07g26590D                                          179   9e-49   
gb|KHG01160.1|  Peptidyl-prolyl cis-trans isomerase FKBP65 -like ...    176   1e-47   Gossypium arboreum [tree cotton]
gb|KJB71963.1|  hypothetical protein B456_011G150600                    176   1e-47   Gossypium raimondii
ref|XP_002988507.1|  hypothetical protein SELMODRAFT_183937             175   2e-47   
ref|XP_002979133.1|  hypothetical protein SELMODRAFT_110584             175   2e-47   
gb|KJB71964.1|  hypothetical protein B456_011G150600                    174   5e-47   Gossypium raimondii
gb|EMS49100.1|  70 kDa peptidyl-prolyl isomerase                        171   8e-46   Triticum urartu
dbj|BAJ95453.1|  predicted protein                                      169   4e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFK48961.1|  unknown                                                 159   6e-42   Medicago truncatula
gb|ACJ85592.1|  unknown                                                 159   8e-42   Medicago truncatula
gb|KDO57440.1|  hypothetical protein CISIN_1g028428mg                   150   1e-41   Citrus sinensis [apfelsine]
gb|KDO57438.1|  hypothetical protein CISIN_1g028428mg                   151   2e-41   Citrus sinensis [apfelsine]
ref|XP_006857116.1|  hypothetical protein AMTR_s00065p00132670          157   9e-41   
ref|XP_009613900.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    149   1e-40   Nicotiana tomentosiformis
ref|XP_003544491.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    155   4e-40   Glycine max [soybeans]
ref|XP_010552023.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    153   1e-39   Tarenaya hassleriana [spider flower]
ref|XP_006430496.1|  hypothetical protein CICLE_v10011447mg             153   2e-39   
ref|XP_006482027.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    152   5e-39   Citrus sinensis [apfelsine]
gb|KJB58679.1|  hypothetical protein B456_009G2211002                   145   6e-39   Gossypium raimondii
ref|XP_010653645.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    150   9e-39   Vitis vinifera
ref|XP_007018460.1|  FKBP-type peptidyl-prolyl cis-trans isomeras...    151   1e-38   
ref|XP_009613899.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    148   1e-38   Nicotiana tomentosiformis
ref|XP_009764363.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    147   2e-38   Nicotiana sylvestris
ref|XP_006433656.1|  hypothetical protein CICLE_v10003372mg             149   4e-38   Citrus clementina [clementine]
ref|XP_010273186.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    148   4e-38   Nelumbo nucifera [Indian lotus]
ref|XP_006472323.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    149   4e-38   Citrus sinensis [apfelsine]
ref|XP_010244430.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    149   5e-38   Nelumbo nucifera [Indian lotus]
gb|KEH40013.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           146   5e-38   Medicago truncatula
gb|KEH40012.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           146   9e-38   Medicago truncatula
ref|XP_002510075.1|  peptidylprolyl isomerase, putative                 148   1e-37   Ricinus communis
ref|XP_009613898.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    147   1e-37   Nicotiana tomentosiformis
ref|XP_010273182.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    148   1e-37   Nelumbo nucifera [Indian lotus]
gb|KEH40011.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           146   1e-37   Medicago truncatula
ref|XP_009613897.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    147   2e-37   Nicotiana tomentosiformis
gb|KEH40010.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           146   2e-37   Medicago truncatula
ref|XP_009764362.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    147   2e-37   Nicotiana sylvestris
ref|XP_009764360.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    147   2e-37   Nicotiana sylvestris
gb|KEH40009.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           147   2e-37   Medicago truncatula
gb|AES59301.2|  FKBP-type peptidyl-prolyl cis-trans isomerase           147   3e-37   Medicago truncatula
gb|KEH40014.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           147   3e-37   Medicago truncatula
ref|XP_010553661.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase ...    144   3e-37   Tarenaya hassleriana [spider flower]
ref|XP_003589050.1|  70 kDa peptidyl-prolyl isomerase                   147   3e-37   
ref|XP_007162035.1|  hypothetical protein PHAVU_001G118200g             146   5e-37   Phaseolus vulgaris [French bean]
gb|KHN36977.1|  Peptidyl-prolyl cis-trans isomerase FKBP62              146   5e-37   Glycine soja [wild soybean]
ref|XP_011013751.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    140   5e-37   Populus euphratica
ref|XP_003550301.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    146   6e-37   Glycine max [soybeans]
ref|XP_007221858.1|  hypothetical protein PRUPE_ppa019344mg             145   7e-37   Prunus persica
ref|XP_008220384.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    145   1e-36   Prunus mume [ume]
ref|XP_010553659.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase ...    144   2e-36   Tarenaya hassleriana [spider flower]
gb|KHG02788.1|  Peptidyl-prolyl cis-trans isomerase FKBP65 -like ...    144   2e-36   Gossypium arboreum [tree cotton]
ref|XP_006380967.1|  hypothetical protein POPTR_0006s03190g             144   2e-36   
ref|XP_009360953.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    144   3e-36   Pyrus x bretschneideri [bai li]
ref|XP_010061642.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    144   4e-36   Eucalyptus grandis [rose gum]
ref|XP_010096077.1|  Peptidyl-prolyl cis-trans isomerase FKBP65         143   6e-36   Morus notabilis
gb|KDO52833.1|  hypothetical protein CISIN_1g036950mg                   142   7e-36   Citrus sinensis [apfelsine]
gb|KDP41599.1|  hypothetical protein JCGZ_16006                         142   1e-35   Jatropha curcas
ref|XP_011040722.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    141   2e-35   Populus euphratica
ref|XP_011040721.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    141   2e-35   Populus euphratica
ref|XP_010090815.1|  Peptidyl-prolyl cis-trans isomerase FKBP65         141   2e-35   Morus notabilis
ref|XP_004493326.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    141   3e-35   Cicer arietinum [garbanzo]
ref|XP_008393705.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    141   3e-35   
ref|XP_002302401.1|  peptidyl-prolyl cis-trans isomerase FKBP-typ...    140   4e-35   
ref|XP_010936157.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    141   4e-35   Elaeis guineensis
ref|XP_011017099.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    140   5e-35   Populus euphratica
ref|XP_011013750.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    140   5e-35   Populus euphratica
ref|XP_009412296.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    140   6e-35   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP01264.1|  unnamed protein product                                140   7e-35   Coffea canephora [robusta coffee]
gb|KDO81465.1|  hypothetical protein CISIN_1g0137551mg                  134   8e-35   Citrus sinensis [apfelsine]
gb|KDO81464.1|  hypothetical protein CISIN_1g0137551mg                  134   1e-34   Citrus sinensis [apfelsine]
ref|XP_006576767.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    139   1e-34   Glycine max [soybeans]
ref|XP_003520475.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    139   1e-34   Glycine max [soybeans]
ref|XP_002863790.1|  hypothetical protein ARALYDRAFT_917529             137   1e-34   
ref|XP_009596525.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    138   3e-34   Nicotiana tomentosiformis
ref|XP_002526205.1|  peptidylprolyl isomerase, putative                 138   3e-34   
ref|XP_010673091.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    137   4e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002283423.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase        138   4e-34   Vitis vinifera
ref|XP_006356849.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    137   5e-34   Solanum tuberosum [potatoes]
ref|XP_007160928.1|  hypothetical protein PHAVU_001G029000g             137   8e-34   Phaseolus vulgaris [French bean]
ref|XP_010320295.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    135   1e-33   Solanum lycopersicum
ref|XP_010249734.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   1e-33   Nelumbo nucifera [Indian lotus]
ref|XP_004981889.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   2e-33   Setaria italica
ref|XP_009764949.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    135   2e-33   Nicotiana sylvestris
ref|XP_009596524.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    135   2e-33   Nicotiana tomentosiformis
gb|EYU20825.1|  hypothetical protein MIMGU_mgv1a004220mg                135   4e-33   Erythranthe guttata [common monkey flower]
ref|XP_008790247.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    135   4e-33   Phoenix dactylifera
ref|XP_001771977.1|  predicted protein                                  135   4e-33   
ref|XP_010327743.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    134   6e-33   
ref|XP_010327744.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    134   7e-33   Solanum lycopersicum
ref|XP_004238080.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   9e-33   Solanum lycopersicum
gb|KCW44143.1|  hypothetical protein EUGRSUZ_L02444                     130   1e-32   
emb|CDY00831.1|  BnaCnng00310D                                          127   1e-32   
ref|XP_009764945.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    133   2e-32   
ref|XP_011079092.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    132   3e-32   
ref|XP_010041714.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    130   4e-32   
gb|KCW44141.1|  hypothetical protein EUGRSUZ_L02444                     130   4e-32   
ref|NP_176141.1|  tetratricopeptide repeat 6                            125   6e-32   
ref|XP_002982601.1|  hypothetical protein SELMODRAFT_445274             132   7e-32   
ref|XP_002993334.1|  hypothetical protein SELMODRAFT_449100             131   8e-32   
ref|XP_002888213.1|  hypothetical protein ARALYDRAFT_338459             131   1e-31   
ref|XP_010038854.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    130   1e-31   
ref|XP_006302078.1|  hypothetical protein CARUB_v10020064mg             129   4e-31   
ref|XP_011074340.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    128   2e-30   
gb|KDO40268.1|  hypothetical protein CISIN_1g008113mg                   126   4e-30   
gb|KDO36019.1|  hypothetical protein CISIN_1g046569mg                   121   5e-30   
tpg|DAA48153.1|  TPA: hypothetical protein ZEAMMB73_593378              124   1e-29   
gb|KDO40267.1|  hypothetical protein CISIN_1g008113mg                   124   2e-29   
ref|XP_006364803.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   2e-29   
ref|XP_007049647.1|  Rotamase FKBP 1 isoform 2                          123   5e-29   
ref|XP_010513402.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    123   8e-29   
ref|XP_006297572.1|  hypothetical protein CARUB_v10013595mg             122   9e-29   
ref|XP_010111217.1|  Peptidyl-prolyl cis-trans isomerase FKBP65         122   1e-28   
ref|XP_011074339.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    122   2e-28   
ref|XP_010936158.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   2e-28   
gb|KDP24694.1|  hypothetical protein JCGZ_26469                         117   5e-27   
ref|XP_009764944.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    115   5e-26   
ref|XP_009764943.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    112   4e-25   
ref|XP_009764942.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    112   4e-25   
gb|AEM36346.1|  At1g58450                                               106   6e-25   
ref|XP_005845726.1|  hypothetical protein CHLNCDRAFT_36304              112   8e-25   
ref|XP_006392291.1|  hypothetical protein EUTSA_v10024088mg             110   2e-24   
ref|XP_007440166.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    109   2e-24   
gb|EPQ14397.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               108   3e-24   
ref|XP_008141950.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   4e-24   
ref|XP_005877096.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   5e-24   
ref|XP_006096160.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   6e-24   
ref|XP_005334048.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   8e-24   
gb|EOB07103.1|  FK506-binding protein 4                                 107   1e-23   
ref|XP_001694809.1|  peptidyl-prolyl cis-trans isomerase, FKBP-type     108   1e-23   
ref|XP_005365346.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    107   1e-23   
ref|XP_006763604.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    107   2e-23   
gb|KFP49126.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               105   2e-23   
ref|XP_009560748.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    106   3e-23   
ref|XP_005011717.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    106   3e-23   
ref|XP_005365347.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    106   3e-23   
pdb|1QZ2|A  Chain A, Crystal Structure Of Fkbp52 C-Terminal Domai...    105   3e-23   
ref|XP_003081909.1|  rof1 (ISS)                                         105   4e-23   
gb|KFO77342.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               105   4e-23   
gb|AAM95632.1|  FK506 binding protein 4                                 105   4e-23   
ref|XP_004879626.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    105   5e-23   
ref|XP_005610895.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   5e-23   
gb|EHA99829.1|  FK506-binding protein 4                                 105   5e-23   
ref|XP_009422901.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   5e-23   
ref|NP_001178792.1|  peptidyl-prolyl cis-trans isomerase FKBP4          105   5e-23   
ref|XP_009703270.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   5e-23   
gb|EFB25203.1|  hypothetical protein PANDA_002014                       105   6e-23   
ref|XP_006069092.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   6e-23   
ref|XP_002914155.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   6e-23   
ref|XP_009680598.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   6e-23   
dbj|BAG36639.1|  unnamed protein product                                105   6e-23   
ref|XP_006987917.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   6e-23   
ref|XP_004869380.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   7e-23   
ref|XP_508927.3|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...    105   7e-23   
ref|XP_003820401.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   7e-23   
ref|NP_002005.1|  peptidyl-prolyl cis-trans isomerase FKBP4             105   7e-23   
ref|XP_007092905.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    105   7e-23   
gb|AAX41123.1|  FK506 binding protein 4 59kDa                           105   7e-23   
ref|XP_004692603.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   7e-23   
gb|AAX29352.1|  FK506 binding protein 4                                 105   7e-23   
ref|XP_001366229.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   8e-23   
ref|XP_002822814.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   8e-23   
gb|KGL87283.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               105   8e-23   
ref|XP_005387173.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   8e-23   
ref|XP_008703128.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   9e-23   
ref|XP_011282040.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   9e-23   
gb|KFW78621.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               104   1e-22   
ref|XP_009892410.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   1e-22   
ref|XP_005531080.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   1e-22   
ref|XP_009990165.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   1e-22   
ref|XP_008919368.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   1e-22   
ref|XP_006035185.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   1e-22   
ref|XP_534923.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...    105   1e-22   
ref|XP_008109533.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   1e-22   
ref|XP_006265443.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   1e-22   
gb|KFV06541.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               104   1e-22   
ref|XP_005234451.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   1e-22   
ref|XP_005084139.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   1e-22   
ref|XP_010609847.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   1e-22   
ref|XP_004610652.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   1e-22   
gb|KFO92954.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               103   1e-22   
ref|XP_004778376.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   1e-22   
ref|XP_004668755.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   1e-22   
gb|KFO20215.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               105   1e-22   
gb|KGL77142.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               104   1e-22   
gb|KFP59742.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               104   1e-22   
gb|EGV98481.1|  FK506-binding protein 4                                 104   2e-22   
ref|XP_010139640.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   2e-22   
ref|XP_001420445.1|  peptidyl-prolyl cis-trans isomerase, FKBP-type     105   2e-22   
ref|XP_010212783.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   2e-22   
ref|XP_010304529.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   2e-22   
ref|XP_010843315.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   2e-22   
ref|NP_001006250.1|  peptidyl-prolyl cis-trans isomerase FKBP4          104   2e-22   
ref|XP_010171761.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   2e-22   
gb|KFO05587.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               103   2e-22   
gb|KFQ25177.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               103   2e-22   
emb|CEF99577.1|  Peptidyl-prolyl cis-trans isomerase,FKBP-type,do...    105   2e-22   
ref|XP_006035184.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   2e-22   
ref|XP_005150294.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   2e-22   
gb|KFQ78136.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               103   2e-22   
ref|XP_005681093.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   2e-22   
ref|XP_009964273.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   2e-22   
ref|XP_009464457.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   2e-22   
ref|XP_009081721.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   2e-22   
ref|XP_007644424.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   2e-22   
ref|XP_008933605.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   2e-22   
gb|KFZ45558.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               103   2e-22   
ref|XP_009936154.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   2e-22   
gb|KFP72921.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               103   2e-22   
gb|KFQ97847.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               103   2e-22   
ref|XP_004438822.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   3e-22   
ref|XP_004412005.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   3e-22   
gb|KFP34719.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               102   3e-22   
gb|KFR13332.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               103   3e-22   
ref|XP_004093054.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    105   3e-22   
ref|NP_001029494.1|  peptidyl-prolyl cis-trans isomerase FKBP4          103   3e-22   
gb|KFZ50188.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               103   3e-22   
ref|XP_004778377.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   3e-22   
ref|NP_001182266.1|  peptidyl-prolyl cis-trans isomerase FKBP4          103   3e-22   
ref|XP_010189777.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   3e-22   
tpg|DAA29159.1|  TPA: peptidyl-prolyl cis-trans isomerase FKBP4         103   3e-22   
gb|ELR47986.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               103   3e-22   
ref|XP_005907269.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   3e-22   
ref|XP_009916054.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   3e-22   
ref|XP_006035186.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   3e-22   
gb|KFP94050.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               103   3e-22   
pdb|1P5Q|A  Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain      102   3e-22   
gb|KFQ25475.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               103   4e-22   
ref|XP_006265444.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   4e-22   
pir||S14538  transition protein - mouse                                 103   4e-22
gb|AAH03447.1|  FK506 binding protein 4                                 103   4e-22   
ref|XP_004052566.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   4e-22   
gb|KFQ42493.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               102   4e-22   
ref|XP_010573701.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   4e-22   
gb|KFV51946.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               103   4e-22   
ref|XP_010117852.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   4e-22   
ref|XP_007627247.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   4e-22   
gb|KFV90459.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               103   4e-22   
ref|XP_003202649.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   4e-22   
ref|XP_009807990.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   4e-22   
gb|KFV85108.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               102   5e-22   
gb|KFV49772.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               102   5e-22   
ref|XP_009571977.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   5e-22   
ref|XP_010012633.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   5e-22   
ref|XP_006210886.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   5e-22   
ref|XP_005955715.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   5e-22   
emb|CAC39452.1|  immunophilin FKBP-52                                   102   6e-22   
ref|XP_011397815.1|  Peptidyl-prolyl cis-trans isomerase FKBP62         103   6e-22   
ref|XP_006751438.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   7e-22   
gb|KFV00236.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               102   7e-22   
ref|XP_010002427.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   7e-22   
ref|XP_010078563.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   7e-22   
ref|XP_004007647.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   8e-22   
ref|NP_034349.1|  peptidyl-prolyl cis-trans isomerase FKBP4             102   8e-22   
gb|EDK99886.1|  FK506 binding protein 4, isoform CRA_a                  102   9e-22   
ref|XP_004456251.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   1e-21   
ref|XP_009865281.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   1e-21   
gb|EMC82566.1|  FK506-binding protein 4                                 102   1e-21   
ref|XP_009946194.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    101   1e-21   
gb|KFU94539.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               101   1e-21   
gb|KFP75101.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               101   1e-21   
gb|KFQ08028.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               101   1e-21   
ref|XP_009328147.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    101   1e-21   
gb|KFW71250.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               101   1e-21   
ref|XP_005509839.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    101   1e-21   
emb|CAA34914.1|  unknown protein                                        102   2e-21   
gb|KFQ71375.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               100   2e-21   
gb|KFM02789.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               100   2e-21   
gb|KFQ53636.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               100   2e-21   
dbj|BAE35690.1|  unnamed protein product                                101   2e-21   
ref|XP_010280642.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   2e-21   
ref|XP_009485459.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   2e-21   
gb|ETE59333.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               100   2e-21   
gb|KFW73921.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               100   2e-21   
ref|XP_009289200.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   2e-21   
ref|XP_002947775.1|  hypothetical protein VOLCADRAFT_103560             102   2e-21   
ref|XP_010994731.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    101   3e-21   
ref|XP_010144910.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   3e-21   
ref|XP_010962797.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    101   3e-21   
gb|KFV91238.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               100   3e-21   
ref|XP_009640029.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   3e-21   
ref|XP_007526327.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    101   3e-21   
gb|KFP29961.1|  Peptidyl-prolyl cis-trans isomerase FKBP4             99.8    3e-21   
gb|KFP18432.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               100   3e-21   
gb|KFP08072.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               100   3e-21   
ref|XP_010195865.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.4    3e-21   
ref|XP_009513298.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   3e-21   
ref|XP_009916053.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   4e-21   
ref|XP_010573703.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   5e-21   
ref|XP_008501444.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    5e-21   
ref|XP_009894963.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   6e-21   
gb|KFV64423.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               100   6e-21   
ref|XP_004279047.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   7e-21   
ref|XP_004314450.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   7e-21   
ref|XP_006179007.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    101   7e-21   
ref|XP_006923924.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   7e-21   
ref|XP_002499621.1|  fkbp-type peptidyl-prolyl cis-trans isomerase      100   8e-21   
ref|XP_003796486.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    8e-21   
gb|ETO17560.1|  hypothetical protein RFI_19758                        98.6    9e-21   
ref|XP_004314451.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.0    1e-20   
ref|XP_006862759.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    1e-20   
ref|XP_006862758.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    1e-20   
ref|XP_011366147.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    1e-20   
ref|XP_007170298.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.4    1e-20   
gb|ELK02594.1|  FK506-binding protein 4                               99.8    1e-20   
ref|XP_007117127.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.0    1e-20   
ref|XP_006004522.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    2e-20   
ref|XP_004710535.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    2e-20   
ref|XP_004381245.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.0    2e-20   
ref|XP_007469524.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.4    6e-20   
gb|AAT08754.1|  peptidylprolyl isomerase                              92.0    7e-20   
ref|XP_007469523.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.4    7e-20   



>ref|XP_009803135.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Nicotiana 
sylvestris]
Length=573

 Score =   243 bits (620),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 169/183 (92%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGN LFKAGKY RASKRYEK AKFIEYDTSFSEEEKKQSKALKIS
Sbjct  391  MNTQEKIEAAGKKKEEGNALFKAGKYTRASKRYEKAAKFIEYDTSFSEEEKKQSKALKIS  450

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY++ AD DLAEFDIKKAL
Sbjct  451  CNLNNAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYMNMADLDLAEFDIKKAL  510

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDPDNR+VKLEYK  K+KVKE+NKKDAKFYGNMFAKL+K E  +S+KSA +E E  +ID
Sbjct  511  EIDPDNRDVKLEYKALKDKVKEFNKKDAKFYGNMFAKLNKLETANSSKSASKEPEPMSID  570

Query  158  SKA  150
            SKA
Sbjct  571  SKA  573



>ref|XP_009602562.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Nicotiana 
tomentosiformis]
Length=573

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 169/183 (92%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT EKIEAAGKKKEEGN LFKAGKY RASKRYEK AKFIEYDTSFSEEEKKQSKALKIS
Sbjct  391  MNTPEKIEAAGKKKEEGNALFKAGKYTRASKRYEKAAKFIEYDTSFSEEEKKQSKALKIS  450

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY++ AD DLAEFDIKKAL
Sbjct  451  CNLNNAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYMNMADLDLAEFDIKKAL  510

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDP+NR+VKLEYK  K+KVKE+NKKDAKFYGNMFAKL+K E  +S+KSAP+E E  +ID
Sbjct  511  EIDPNNRDVKLEYKALKDKVKEFNKKDAKFYGNMFAKLNKLETANSSKSAPKEPEPMSID  570

Query  158  SKA  150
            SKA
Sbjct  571  SKA  573



>dbj|BAL14273.1| FK506-binding protein [Nicotiana tabacum]
Length=573

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 169/183 (92%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT EKIEAAGKKKEEGN LFKAGKY RASKRYEK AKFIEYDTSFSEEEKKQSKALKIS
Sbjct  391  MNTPEKIEAAGKKKEEGNALFKAGKYTRASKRYEKAAKFIEYDTSFSEEEKKQSKALKIS  450

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY++ AD DLAEFDIKKAL
Sbjct  451  CNLNNAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYMNMADLDLAEFDIKKAL  510

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDP+NR+VKLEYK  K+KVKE+NKKDAKFYGNMFAKL+K E  +S+KSAP+E E  +ID
Sbjct  511  EIDPNNRDVKLEYKALKDKVKEFNKKDAKFYGNMFAKLNKLETANSSKSAPKEPEPMSID  570

Query  158  SKA  150
            SKA
Sbjct  571  SKA  573



>gb|EYU39186.1| hypothetical protein MIMGU_mgv1a003614mg [Erythranthe guttata]
Length=574

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 166/183 (91%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKEEGN LFKAGKY RASKRYEK AKFIEYDTSFSEEEKKQSK LK++
Sbjct  392  MNTEEKIEAAGKKKEEGNALFKAGKYLRASKRYEKAAKFIEYDTSFSEEEKKQSKVLKVT  451

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLK+YK+AEKLCTKVLELE TNVKALYRRAQAY++ AD DLAEFDIKKAL
Sbjct  452  CNLNNAACKLKLKEYKQAEKLCTKVLELEGTNVKALYRRAQAYMNMADLDLAEFDIKKAL  511

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDPDNR+VKLEYKV KEKVKE NKKDAKFYGNMFAKL+K + F SN + P+E E  +ID
Sbjct  512  EIDPDNRDVKLEYKVLKEKVKEINKKDAKFYGNMFAKLTKLQTFDSNNATPKEVEPMSID  571

Query  158  SKA  150
            SKA
Sbjct  572  SKA  574



>emb|CBI41091.3| unnamed protein product [Vitis vinifera]
Length=342

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 167/183 (91%), Gaps = 3/183 (2%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKEEGNVLFKAGKYARASKRYEK AK+IEYD+SF EEEKKQ+K LK++
Sbjct  161  MNTEEKIEAAGKKKEEGNVLFKAGKYARASKRYEKAAKYIEYDSSFGEEEKKQAKTLKVT  220

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYKEAEKLCTKVL+++S NVKALYRRAQAYIH AD DLAEFDIKKAL
Sbjct  221  CNLNNAACKLKLKDYKEAEKLCTKVLDIQSKNVKALYRRAQAYIHLADLDLAEFDIKKAL  280

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDPDNR+VKLEY+  KEK+KEYNKK+AKFYGNMFA+++K E   +NK A +EAE  +ID
Sbjct  281  EIDPDNRDVKLEYRTLKEKMKEYNKKEAKFYGNMFARMNKLEALETNK-ATKEAEPMSID  339

Query  158  SKA  150
            SKA
Sbjct  340  SKA  342



>ref|XP_002268161.3| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62, partial 
[Vitis vinifera]
Length=348

 Score =   232 bits (592),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 167/183 (91%), Gaps = 3/183 (2%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKEEGNVLFKAGKYARASKRYEK AK+IEYD+SF EEEKKQ+K LK++
Sbjct  167  MNTEEKIEAAGKKKEEGNVLFKAGKYARASKRYEKAAKYIEYDSSFGEEEKKQAKTLKVT  226

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYKEAEKLCTKVL+++S NVKALYRRAQAYIH AD DLAEFDIKKAL
Sbjct  227  CNLNNAACKLKLKDYKEAEKLCTKVLDIQSKNVKALYRRAQAYIHLADLDLAEFDIKKAL  286

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDPDNR+VKLEY+  KEK+KEYNKK+AKFYGNMFA+++K E   +NK A +EAE  +ID
Sbjct  287  EIDPDNRDVKLEYRTLKEKMKEYNKKEAKFYGNMFARMNKLEALETNK-ATKEAEPMSID  345

Query  158  SKA  150
            SKA
Sbjct  346  SKA  348



>emb|CDP03935.1| unnamed protein product [Coffea canephora]
Length=575

 Score =   236 bits (602),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 168/183 (92%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGN LFKAGKYARASKRYEK AK+IEYDT+FSEEEKKQSK LKIS
Sbjct  393  MNTQEKIEAAGKKKEEGNALFKAGKYARASKRYEKAAKYIEYDTTFSEEEKKQSKVLKIS  452

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLC+KVLELES+NVKALYRR QAY++ AD DLAE DIKKAL
Sbjct  453  CNLNNAACKLKLKDYKQAEKLCSKVLELESSNVKALYRRGQAYMNLADLDLAELDIKKAL  512

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDP+NR+VKLEYKV KEKVKEYNKKDAKFYGNMFAKL+K E    NK+AP++AE  +ID
Sbjct  513  EIDPNNRDVKLEYKVLKEKVKEYNKKDAKFYGNMFAKLNKLESVDLNKTAPKDAEPISID  572

Query  158  SKA  150
            S+A
Sbjct  573  SQA  575



>ref|XP_011089642.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Sesamum 
indicum]
Length=573

 Score =   235 bits (600),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 151/166 (91%), Gaps = 2/166 (1%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NVLFKAGKY RASKRYEK AK+IEYDTSFSEEEKKQSKALK++CNLN+AACKLKLKDYK+
Sbjct  408  NVLFKAGKYVRASKRYEKAAKYIEYDTSFSEEEKKQSKALKVTCNLNDAACKLKLKDYKQ  467

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLELESTNVKALYRRAQAY++ AD DLAEFDIKKALE+DPDNREVKL YK  K
Sbjct  468  AEKLCTKVLELESTNVKALYRRAQAYMNMADLDLAEFDIKKALELDPDNREVKLVYKALK  527

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQE--AEAIDSKA  150
            EKVKEYNKKDAKFYGNMFAKL+K +PF SN +A +E    +I+SKA
Sbjct  528  EKVKEYNKKDAKFYGNMFAKLNKLQPFDSNNTARKEDGPMSIESKA  573



>ref|XP_004242423.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Solanum 
lycopersicum]
Length=574

 Score =   235 bits (600),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 150/166 (90%), Gaps = 2/166 (1%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFKAGKYARASKRYEK AKFIEYDT+FSEEEKKQSKALKI+CNLNNAACKLKLKDYK+
Sbjct  409  NALFKAGKYARASKRYEKAAKFIEYDTNFSEEEKKQSKALKITCNLNNAACKLKLKDYKQ  468

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLEL+S NVKALYRRAQAY++ AD DLAEFDIKKALEIDPDNR+VKLEYK  K
Sbjct  469  AEKLCTKVLELDSANVKALYRRAQAYMNMADLDLAEFDIKKALEIDPDNRDVKLEYKALK  528

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AIDSKA  150
            EKVKE NKKDAKFYGNMFAKL+K +  +S  SAP+E E  +IDSKA
Sbjct  529  EKVKEINKKDAKFYGNMFAKLNKQDSSNSANSAPKEPEPMSIDSKA  574



>gb|KDP45275.1| hypothetical protein JCGZ_15140 [Jatropha curcas]
Length=572

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGNVLFKAGKY RASKRYEK  K+IEYD+SFSEEEKKQ+KALK++
Sbjct  391  MNTQEKIEAAGKKKEEGNVLFKAGKYVRASKRYEKAVKYIEYDSSFSEEEKKQAKALKVA  450

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYKEAEKLCTKVLELES NVKALYRRAQAYI  AD DLAEFDIKKAL
Sbjct  451  CNLNNAACKLKLKDYKEAEKLCTKVLELESRNVKALYRRAQAYIQLADLDLAEFDIKKAL  510

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDSK  153
            EIDPDNR+VKLEYK  KEK++EYNKK+AKFYGNMFAK++K  P  SNKS  +E++    K
Sbjct  511  EIDPDNRDVKLEYKTLKEKMREYNKKEAKFYGNMFAKMNKLGPLDSNKSESEESQPTREK  570

Query  152  A  150
             
Sbjct  571  T  571



>gb|ACU23964.1| unknown [Glycine max]
Length=235

 Score =   223 bits (567),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 146/166 (88%), Gaps = 2/166 (1%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFKAGKYARASKRYEK  KFIEYDT+FSEEEKK SKALK++CNLNNAACKLKLKDYK+
Sbjct  70   NALFKAGKYARASKRYEKAVKFIEYDTAFSEEEKKSSKALKVACNLNNAACKLKLKDYKQ  129

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVL+LESTNVKALYRRAQAYI  AD DLAEFDIKKALEIDP+NR+VKLEYK  K
Sbjct  130  AEKLCTKVLDLESTNVKALYRRAQAYIQLADLDLAEFDIKKALEIDPNNRDVKLEYKTLK  189

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA--IDSKA  150
            EK+KEYNKK+AKFYG+MF KL K +   SNK A ++A+   IDSKA
Sbjct  190  EKMKEYNKKEAKFYGDMFNKLHKLDSLDSNKPASKDAQPMNIDSKA  235



>ref|XP_002263566.2| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 isoform 
X1 [Vitis vinifera]
 emb|CBI29552.3| unnamed protein product [Vitis vinifera]
Length=571

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 167/183 (91%), Gaps = 3/183 (2%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKEEGNVLFKAGKYARASKRYEK AK+IEYD+SF EEEKKQ+K LK++
Sbjct  390  MNTEEKIEAAGKKKEEGNVLFKAGKYARASKRYEKAAKYIEYDSSFGEEEKKQAKTLKVT  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYKEAEKLCTKVL+++S NVKALYRRAQAYIH AD DLAEFDIKKAL
Sbjct  450  CNLNNAACKLKLKDYKEAEKLCTKVLDIQSKNVKALYRRAQAYIHLADLDLAEFDIKKAL  509

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDPDNR+VKLEY+  KEK+KEYNKK+AKFYGNMFA+++K E   +NK A +EAE  +ID
Sbjct  510  EIDPDNRDVKLEYRTLKEKMKEYNKKEAKFYGNMFARMNKLEALETNK-ATKEAEPMSID  568

Query  158  SKA  150
            SKA
Sbjct  569  SKA  571



>ref|XP_002301809.1| hypothetical protein POPTR_0002s24970g [Populus trichocarpa]
 gb|EEE81082.1| hypothetical protein POPTR_0002s24970g [Populus trichocarpa]
Length=575

 Score =   231 bits (589),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 165/183 (90%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT EKIEAAGKKKEEGNVLFKAGKYA+ASKRYEK  K+IEYD+SFSEEEKKQ+KALK++
Sbjct  393  MNTDEKIEAAGKKKEEGNVLFKAGKYAKASKRYEKAVKYIEYDSSFSEEEKKQAKALKVA  452

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVLELES NVKALYRRAQAYI  AD DLAEFDIKKAL
Sbjct  453  CNLNNAACKLKLKDYKQAEKLCTKVLELESRNVKALYRRAQAYIQLADLDLAEFDIKKAL  512

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDPDNR+VKLE+K  KEK+KEYNKK+AKFYGNMFAK+SK     SNK+  +EAE  ++D
Sbjct  513  EIDPDNRDVKLEHKTLKEKMKEYNKKEAKFYGNMFAKMSKVGSLESNKAEAKEAEPMSVD  572

Query  158  SKA  150
            S+A
Sbjct  573  SEA  575



>ref|XP_010247135.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Nelumbo nucifera]
Length=571

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 164/183 (90%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAG KKEEGNVLFKAGKYARASKRYEK AKFIEYD++F EEEKKQ+K LKI+
Sbjct  389  MNTEEKIEAAGNKKEEGNVLFKAGKYARASKRYEKAAKFIEYDSTFGEEEKKQAKVLKIT  448

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVLEL+  NVKALYRRAQAYI  AD DLAEFDIKKAL
Sbjct  449  CNLNNAACKLKLKDYKQAEKLCTKVLELDGGNVKALYRRAQAYIQLADLDLAEFDIKKAL  508

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EI+P+NR+VKLEYKV KEKVKEYNKKDAKFYGNMFA++SK E   +N +A QE E  +ID
Sbjct  509  EIEPNNRDVKLEYKVLKEKVKEYNKKDAKFYGNMFARMSKLEQLEANGAAKQEPEPMSID  568

Query  158  SKA  150
            SKA
Sbjct  569  SKA  571



>ref|XP_007049646.1| Rotamase FKBP 1 isoform 1 [Theobroma cacao]
 gb|EOX93803.1| Rotamase FKBP 1 isoform 1 [Theobroma cacao]
Length=573

 Score =   230 bits (586),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 165/183 (90%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            +NTQEKIEAAGKKKEEGNVLFKAGKY RASKRYEK  K IEYD+SFSEEEKKQ+K LK++
Sbjct  391  INTQEKIEAAGKKKEEGNVLFKAGKYVRASKRYEKALKCIEYDSSFSEEEKKQAKVLKVA  450

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVLELES NVKALYRRAQAYIH AD DLAEFDIKKAL
Sbjct  451  CNLNNAACKLKLKDYKQAEKLCTKVLELESANVKALYRRAQAYIHLADLDLAEFDIKKAL  510

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            E+DPDNREVKLEYKV KEK+KEYNKK++KFYGNMFAK+ K E   S+KSA +E E  ++D
Sbjct  511  ELDPDNREVKLEYKVLKEKMKEYNKKESKFYGNMFAKMKKMESIDSSKSAAKEPEPMSVD  570

Query  158  SKA  150
            SKA
Sbjct  571  SKA  573



>ref|XP_009610546.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Nicotiana 
tomentosiformis]
Length=565

 Score =   230 bits (586),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 166/183 (91%), Gaps = 3/183 (2%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT EKIEAAGKKKEEGN LFKAGKYARASKRYEK AKFIEYDT+FSEEEKKQSKALKI+
Sbjct  384  MNTPEKIEAAGKKKEEGNALFKAGKYARASKRYEKAAKFIEYDTNFSEEEKKQSKALKIT  443

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVLE ESTNVKALYRRAQ+YI+  DFDLAEFDIKKAL
Sbjct  444  CNLNNAACKLKLKDYKQAEKLCTKVLETESTNVKALYRRAQSYINMVDFDLAEFDIKKAL  503

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDP NR+VKLEYK  KEKVKEYNKKDAKFYGNMFAKL+K +  +SN SA +E +  +ID
Sbjct  504  EIDPANRDVKLEYKALKEKVKEYNKKDAKFYGNMFAKLNKLD-VNSNNSASKEPQPMSID  562

Query  158  SKA  150
            SKA
Sbjct  563  SKA  565



>ref|XP_011024591.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Populus euphratica]
Length=526

 Score =   229 bits (583),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 165/183 (90%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT EKIEAAGKKKEEGN+LFKAGKYA+ASKRYEK  K+IEYD+SFSEEEKKQ+KALK++
Sbjct  344  MNTDEKIEAAGKKKEEGNLLFKAGKYAKASKRYEKAVKYIEYDSSFSEEEKKQAKALKVA  403

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVLELES NVKALYRRAQAYI  AD DLAEFDIKKAL
Sbjct  404  CNLNNAACKLKLKDYKQAEKLCTKVLELESRNVKALYRRAQAYIQLADLDLAEFDIKKAL  463

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDPDNR+VKLE+K  KEK+KEYNKK+AKFYGNMFAK+SK     SNK+  +EAE  ++D
Sbjct  464  EIDPDNRDVKLEHKALKEKMKEYNKKEAKFYGNMFAKMSKLGSLESNKAEAKEAEPMSVD  523

Query  158  SKA  150
            S+A
Sbjct  524  SEA  526



>ref|XP_004510236.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cicer 
arietinum]
Length=577

 Score =   230 bits (586),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 166/183 (91%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKEEGN LFK GKYARASKRYEK  K+IEYDTSFSEE+KK +KALK++
Sbjct  395  MNTEEKIEAAGKKKEEGNALFKTGKYARASKRYEKAVKYIEYDTSFSEEQKKSAKALKVA  454

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYK+AEKLCTKVLELEST+VKALYRRAQAYI  AD DLAEFDIKKAL
Sbjct  455  CNLNDAACKLKLKDYKQAEKLCTKVLELESTSVKALYRRAQAYIQLADLDLAEFDIKKAL  514

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDPDNR+VKLEYKV KEK+KE NKKDAKFYGNMF+K+ K +   ++KSAP++AE  +ID
Sbjct  515  EIDPDNRDVKLEYKVLKEKMKEINKKDAKFYGNMFSKMKKLDSLDNSKSAPKDAEPMSID  574

Query  158  SKA  150
            SKA
Sbjct  575  SKA  577



>ref|XP_009787495.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Nicotiana 
sylvestris]
Length=570

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 166/183 (91%), Gaps = 3/183 (2%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT EKIEAAGKKKEEGN LFKAGKYARASKRYEK AKFIEYDT+FSEEEKKQSKALKI+
Sbjct  389  MNTPEKIEAAGKKKEEGNALFKAGKYARASKRYEKAAKFIEYDTNFSEEEKKQSKALKIT  448

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVLE ESTNVKALYRRAQAYI+  DFDLAEFDIKKAL
Sbjct  449  CNLNNAACKLKLKDYKQAEKLCTKVLETESTNVKALYRRAQAYINMVDFDLAEFDIKKAL  508

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDP NR+VKLEYK  KEKVKEYNKKDAKFYGN+FAKL+K +  +SN SA +E +  +ID
Sbjct  509  EIDPANRDVKLEYKALKEKVKEYNKKDAKFYGNIFAKLNKLD-VNSNNSASKEPQPMSID  567

Query  158  SKA  150
            SKA
Sbjct  568  SKA  570



>ref|XP_006352668.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Solanum 
tuberosum]
Length=574

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 165/183 (90%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT EKIEAAGKKKEEGN LFKAGKYARASKRYEK AKFIEYDTSFSEEEKKQSKALKI+
Sbjct  392  MNTPEKIEAAGKKKEEGNALFKAGKYARASKRYEKAAKFIEYDTSFSEEEKKQSKALKIT  451

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVLEL+S NVKALYRRAQAY++ AD DLAEFDIKKAL
Sbjct  452  CNLNNAACKLKLKDYKQAEKLCTKVLELDSANVKALYRRAQAYMNMADLDLAEFDIKKAL  511

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDPDNR+VKLEYK  KEKVKE NKKDAKFYGNMFAKL+K +  +S  SA +E E  +ID
Sbjct  512  EIDPDNRDVKLEYKALKEKVKEINKKDAKFYGNMFAKLNKQDAANSANSAAKEPEPMSID  571

Query  158  SKA  150
            SKA
Sbjct  572  SKA  574



>ref|XP_002535081.1| peptidylprolyl isomerase, putative [Ricinus communis]
 gb|EEF27302.1| peptidylprolyl isomerase, putative [Ricinus communis]
Length=574

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 162/183 (89%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGN+LFKAGKYARASKRYEK  K IEYD+SFSEEEKKQ+KALK++
Sbjct  392  MNTQEKIEAAGKKKEEGNILFKAGKYARASKRYEKAVKHIEYDSSFSEEEKKQAKALKVA  451

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKL+LK+YKEAEKLCTKVL+LES NVKALYRRAQAYI  AD DLAEFDIKKAL
Sbjct  452  CNLNNAACKLRLKEYKEAEKLCTKVLDLESRNVKALYRRAQAYIQLADLDLAEFDIKKAL  511

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EI+PDNR+VKLEY+  K+K++E NKK+AKFYGNMFAK++K  P  SN S   EA   +ID
Sbjct  512  EIEPDNRDVKLEYRTLKDKMRELNKKEAKFYGNMFAKMNKLGPLDSNNSKSNEAGQMSID  571

Query  158  SKA  150
            SKA
Sbjct  572  SKA  574



>ref|XP_011024590.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Populus euphratica]
Length=575

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 165/183 (90%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT EKIEAAGKKKEEGN+LFKAGKYA+ASKRYEK  K+IEYD+SFSEEEKKQ+KALK++
Sbjct  393  MNTDEKIEAAGKKKEEGNLLFKAGKYAKASKRYEKAVKYIEYDSSFSEEEKKQAKALKVA  452

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVLELES NVKALYRRAQAYI  AD DLAEFDIKKAL
Sbjct  453  CNLNNAACKLKLKDYKQAEKLCTKVLELESRNVKALYRRAQAYIQLADLDLAEFDIKKAL  512

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDPDNR+VKLE+K  KEK+KEYNKK+AKFYGNMFAK+SK     SNK+  +EAE  ++D
Sbjct  513  EIDPDNRDVKLEHKALKEKMKEYNKKEAKFYGNMFAKMSKLGSLESNKAEAKEAEPMSVD  572

Query  158  SKA  150
            S+A
Sbjct  573  SEA  575



>gb|KDO40265.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=572

 Score =   228 bits (582),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 164/183 (90%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKE+GN LFKAGKYARASKRYEK  K+IEYDTSF +EEKKQ+KALK++
Sbjct  390  MNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDTSFGDEEKKQAKALKVA  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYI  AD DLAEFDIKKAL
Sbjct  450  CNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKAL  509

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDPDNR+VKLEYK  KEK+KEYNKK+AKFYGNMFAK+S      SNK+ P+EAE  ++D
Sbjct  510  EIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMSMFGSAESNKAEPKEAEPMSVD  569

Query  158  SKA  150
            SKA
Sbjct  570  SKA  572



>ref|XP_006437245.1| hypothetical protein CICLE_v10031088mg [Citrus clementina]
 ref|XP_006484806.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Citrus 
sinensis]
 gb|ESR50485.1| hypothetical protein CICLE_v10031088mg [Citrus clementina]
Length=572

 Score =   228 bits (582),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 164/183 (90%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKE+GN LFKAGKYARASKRYEK  K+IEYDTSF +EEKKQ+KALK++
Sbjct  390  MNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDTSFGDEEKKQAKALKVA  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYI  AD DLAEFDIKKAL
Sbjct  450  CNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKAL  509

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDPDNR+VKLEYK  KEK+KEYNKK+AKFYGNMFAK+S      SNK+ P+EAE  ++D
Sbjct  510  EIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMSMFGSAESNKAEPKEAEPMSVD  569

Query  158  SKA  150
            SKA
Sbjct  570  SKA  572



>ref|XP_010247134.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Nelumbo nucifera]
Length=572

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 164/184 (89%), Gaps = 3/184 (2%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAG KKEEGNVLFKAGKYARASKRYEK AKFIEYD++F EEEKKQ+K LKI+
Sbjct  389  MNTEEKIEAAGNKKEEGNVLFKAGKYARASKRYEKAAKFIEYDSTFGEEEKKQAKVLKIT  448

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVLEL+  NVKALYRRAQAYI  AD DLAEFDIKKAL
Sbjct  449  CNLNNAACKLKLKDYKQAEKLCTKVLELDGGNVKALYRRAQAYIQLADLDLAEFDIKKAL  508

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAP-QEAE--AI  162
            EI+P+NR+VKLEYKV KEKVKEYNKKDAKFYGNMFA++SK E   +NK A  QE E  +I
Sbjct  509  EIEPNNRDVKLEYKVLKEKVKEYNKKDAKFYGNMFARMSKLEQLEANKGAAKQEPEPMSI  568

Query  161  DSKA  150
            DSKA
Sbjct  569  DSKA  572



>gb|KJB08781.1| hypothetical protein B456_001G103400 [Gossypium raimondii]
 gb|KJB08783.1| hypothetical protein B456_001G103400 [Gossypium raimondii]
Length=572

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 166/183 (91%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            +NTQEKIEAAGKKKEEGNVLFKAGKY RASKRYEK  K+I+YDTSFSEEEKKQSKALK++
Sbjct  390  LNTQEKIEAAGKKKEEGNVLFKAGKYVRASKRYEKAVKYIDYDTSFSEEEKKQSKALKVA  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYK+AEKLCTKVLELES NVKALYRRAQAYI+ AD DLAE DIKKAL
Sbjct  450  CNLNDAACKLKLKDYKQAEKLCTKVLELESANVKALYRRAQAYINLADLDLAELDIKKAL  509

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            E+DPDNREVKLEYK  KEK+KEYNKK+AKFYGNMFAK++K +   S+KSA +E E  +ID
Sbjct  510  ELDPDNREVKLEYKALKEKIKEYNKKEAKFYGNMFAKMNKMDSGDSSKSAAKEPEPMSID  569

Query  158  SKA  150
            SKA
Sbjct  570  SKA  572



>gb|KJB42565.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=478

 Score =   225 bits (573),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 164/183 (90%), Gaps = 10/183 (5%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT EKIEAAGKKKEEGNVLFK+GKYARASKRYEK  K+I+YD+SFSEEEKKQ+KALK++
Sbjct  304  MNTPEKIEAAGKKKEEGNVLFKSGKYARASKRYEKAVKYIDYDSSFSEEEKKQAKALKVA  363

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKD+K+AEKLCTKVLE+ES+NVKALYRRAQAYIH AD DLAEFD+KKAL
Sbjct  364  CNLNNAACKLKLKDFKQAEKLCTKVLEIESSNVKALYRRAQAYIHLADLDLAEFDVKKAL  423

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDPDNRE+K+EYK+ KEK+KEYNKK+AKFYGNMFAK+        NK+AP+E     ID
Sbjct  424  EIDPDNREIKMEYKLLKEKMKEYNKKEAKFYGNMFAKM--------NKTAPKEPAPMTID  475

Query  158  SKA  150
            SKA
Sbjct  476  SKA  478



>ref|XP_010036767.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW48407.1| hypothetical protein EUGRSUZ_K02110 [Eucalyptus grandis]
Length=576

 Score =   227 bits (579),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 165/183 (90%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKEEGNV+FKAGKYA+ASKRYEK  K+IEYDTSFSE+EKKQ+KALK++
Sbjct  394  MNTEEKIEAAGKKKEEGNVIFKAGKYAKASKRYEKAVKYIEYDTSFSEDEKKQAKALKVA  453

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDY +AEKLCTKVLEL+S NVKALYRRAQAYI  +D DLAEFDIKKAL
Sbjct  454  CNLNDAACKLKLKDYNQAEKLCTKVLELDSRNVKALYRRAQAYIELSDLDLAEFDIKKAL  513

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDP NR+VKLEYKV KEKVKE+NKKDAKFYGNMFAK+SK EP    K+A +E E  +ID
Sbjct  514  EIDPHNRDVKLEYKVLKEKVKEFNKKDAKFYGNMFAKMSKLEPVEMQKTAAKEPEPMSID  573

Query  158  SKA  150
            SKA
Sbjct  574  SKA  576



>gb|KCW48408.1| hypothetical protein EUGRSUZ_K02110 [Eucalyptus grandis]
Length=468

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKEEGNV+FKAGKYA+ASKRYEK  K+IEYDTSFSE+EKKQ+KALK++
Sbjct  288  MNTEEKIEAAGKKKEEGNVIFKAGKYAKASKRYEKAVKYIEYDTSFSEDEKKQAKALKVA  347

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDY +AEKLCTKVLEL+S NVKALYRRAQAYI  +D DLAEFDIKKAL
Sbjct  348  CNLNDAACKLKLKDYNQAEKLCTKVLELDSRNVKALYRRAQAYIELSDLDLAEFDIKKAL  407

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDSK  153
            EIDP NR+VKLEYKV KEKVKE+NKKDAKFYGNMFAK+SK EP     +   E  +IDSK
Sbjct  408  EIDPHNRDVKLEYKVLKEKVKEFNKKDAKFYGNMFAKMSKLEPVEKTAAKEPEPMSIDSK  467

Query  152  A  150
            A
Sbjct  468  A  468



>gb|KHG19334.1| Peptidyl-prolyl cis-trans isomerase FKBP62 -like protein [Gossypium 
arboreum]
Length=564

 Score =   226 bits (575),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 164/183 (90%), Gaps = 10/183 (5%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT EKIEAAGKKKEEGNVLFK+GKYARASKRYEK  K+I+YD+SFSEEEKKQ+KALK++
Sbjct  390  MNTPEKIEAAGKKKEEGNVLFKSGKYARASKRYEKAVKYIDYDSSFSEEEKKQAKALKVA  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AE+LCTKVLE+ES+NVKALYRRAQAYIH AD DLAEFD+KKAL
Sbjct  450  CNLNNAACKLKLKDYKQAEELCTKVLEIESSNVKALYRRAQAYIHLADLDLAEFDVKKAL  509

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDPDNRE+K+EYKV KEK+KEYNKK+AKFYGNMFAK+        NK+AP+E     ID
Sbjct  510  EIDPDNREIKMEYKVLKEKMKEYNKKEAKFYGNMFAKM--------NKTAPKEPAPMTID  561

Query  158  SKA  150
            SKA
Sbjct  562  SKA  564



>gb|KJB42562.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=563

 Score =   225 bits (574),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 164/183 (90%), Gaps = 10/183 (5%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT EKIEAAGKKKEEGNVLFK+GKYARASKRYEK  K+I+YD+SFSEEEKKQ+KALK++
Sbjct  389  MNTPEKIEAAGKKKEEGNVLFKSGKYARASKRYEKAVKYIDYDSSFSEEEKKQAKALKVA  448

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKD+K+AEKLCTKVLE+ES+NVKALYRRAQAYIH AD DLAEFD+KKAL
Sbjct  449  CNLNNAACKLKLKDFKQAEKLCTKVLEIESSNVKALYRRAQAYIHLADLDLAEFDVKKAL  508

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDPDNRE+K+EYK+ KEK+KEYNKK+AKFYGNMFAK+        NK+AP+E     ID
Sbjct  509  EIDPDNREIKMEYKLLKEKMKEYNKKEAKFYGNMFAKM--------NKTAPKEPAPMTID  560

Query  158  SKA  150
            SKA
Sbjct  561  SKA  563



>gb|KJB42563.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=564

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 164/183 (90%), Gaps = 10/183 (5%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT EKIEAAGKKKEEGNVLFK+GKYARASKRYEK  K+I+YD+SFSEEEKKQ+KALK++
Sbjct  390  MNTPEKIEAAGKKKEEGNVLFKSGKYARASKRYEKAVKYIDYDSSFSEEEKKQAKALKVA  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKD+K+AEKLCTKVLE+ES+NVKALYRRAQAYIH AD DLAEFD+KKAL
Sbjct  450  CNLNNAACKLKLKDFKQAEKLCTKVLEIESSNVKALYRRAQAYIHLADLDLAEFDVKKAL  509

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDPDNRE+K+EYK+ KEK+KEYNKK+AKFYGNMFAK+        NK+AP+E     ID
Sbjct  510  EIDPDNREIKMEYKLLKEKMKEYNKKEAKFYGNMFAKM--------NKTAPKEPAPMTID  561

Query  158  SKA  150
            SKA
Sbjct  562  SKA  564



>gb|KHN44911.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Glycine soja]
Length=582

 Score =   225 bits (574),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 146/166 (88%), Gaps = 2/166 (1%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFKAGKYARASKRYEK  KFIEYDT+FSEEEKK SKALK++CNLNNAACKLKLKDYK+
Sbjct  417  NALFKAGKYARASKRYEKAVKFIEYDTAFSEEEKKSSKALKVACNLNNAACKLKLKDYKQ  476

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVL+LESTNVKALYRRAQAYI  AD DLAEFDIKKALEIDP+NR+VKLEYK  K
Sbjct  477  AEKLCTKVLDLESTNVKALYRRAQAYIQLADLDLAEFDIKKALEIDPNNRDVKLEYKTLK  536

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA--IDSKA  150
            EK+KEYNKK+AKFYGNMF KL K +   SNK A ++A+   IDSKA
Sbjct  537  EKMKEYNKKEAKFYGNMFNKLHKLDSLDSNKPASKDAQPMNIDSKA  582



>ref|XP_003520990.2| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Glycine 
max]
Length=582

 Score =   225 bits (574),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 146/166 (88%), Gaps = 2/166 (1%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFKAGKYARASKRYEK  KFIEYDT+FSEEEKK SKALK++CNLNNAACKLKLKDYK+
Sbjct  417  NALFKAGKYARASKRYEKAVKFIEYDTAFSEEEKKSSKALKVACNLNNAACKLKLKDYKQ  476

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVL+LESTNVKALYRRAQAYI  AD DLAEFDIKKALEIDP+NR+VKLEYK  K
Sbjct  477  AEKLCTKVLDLESTNVKALYRRAQAYIQLADLDLAEFDIKKALEIDPNNRDVKLEYKTLK  536

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA--IDSKA  150
            EK+KEYNKK+AKFYGNMF KL K +   SNK A ++A+   IDSKA
Sbjct  537  EKMKEYNKKEAKFYGNMFNKLHKLDSLDSNKPASKDAQPMNIDSKA  582



>ref|XP_003626943.1| 70 kDa peptidyl-prolyl isomerase [Medicago truncatula]
 gb|AET01419.1| peptidyl-prolyl cis-trans isomerase FKBP62-like protein [Medicago 
truncatula]
Length=575

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 147/166 (89%), Gaps = 2/166 (1%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK GKYA+ASKRYEK  KFIEYDTS+++E+KK +KALKI+CNLN+AACKLKLKDYK+
Sbjct  410  NALFKTGKYAKASKRYEKAVKFIEYDTSYTDEQKKSAKALKIACNLNDAACKLKLKDYKQ  469

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLE ESTNVKALYRRAQAYI  ADFDLAEFDIKKALEIDP+NR+VKLEYK  K
Sbjct  470  AEKLCTKVLEFESTNVKALYRRAQAYIQLADFDLAEFDIKKALEIDPNNRDVKLEYKTLK  529

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AIDSKA  150
            EKVKE NKKDAKFYGNMF+K++K +    NKSAP++ E  +IDSKA
Sbjct  530  EKVKEINKKDAKFYGNMFSKMTKLDSLDINKSAPKDVEPMSIDSKA  575



>ref|XP_008778813.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Phoenix 
dactylifera]
 ref|XP_008779083.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Phoenix 
dactylifera]
Length=473

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 145/170 (85%), Gaps = 6/170 (4%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK GKYARASK+YEK AKF+EYD+SFSEEEKKQS+ALK++CNLNNAACKLKLKD+K+
Sbjct  304  NALFKLGKYARASKKYEKAAKFVEYDSSFSEEEKKQSRALKVTCNLNNAACKLKLKDFKQ  363

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLE+ES NVKALYRRAQAYI  AD DLAE DIKKALEIDPDNR+VKLEYK  K
Sbjct  364  AEKLCTKVLEIESKNVKALYRRAQAYIQLADLDLAEVDIKKALEIDPDNRDVKLEYKTLK  423

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSA----PQEAE--AIDSKA  150
            EKVKE+NKKDAKFYGNMFAK  K E   SNKS     P+EAE   IDS A
Sbjct  424  EKVKEFNKKDAKFYGNMFAKWRKLEHMESNKSGNQAMPEEAEPMTIDSAA  473



>ref|XP_008792944.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Phoenix dactylifera]
Length=574

 Score =   225 bits (573),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 146/167 (87%), Gaps = 3/167 (2%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK GKY RASKRYEKGAKFIEYD+SFS+EEKKQSK LKI+CNLNNAACKLKLKDYK+
Sbjct  408  NALFKVGKYVRASKRYEKGAKFIEYDSSFSDEEKKQSKVLKITCNLNNAACKLKLKDYKQ  467

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLEL+S NVKALYRRAQAYI  AD DLAE DIKKALEIDPDNR+VKLEYK  K
Sbjct  468  AEKLCTKVLELDSRNVKALYRRAQAYIQLADLDLAEVDIKKALEIDPDNRDVKLEYKTLK  527

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQ-EAE--AIDSKA  150
            EKV+EYNKKDAKFYGNMFAK+SK E   +NKSA + EAE  +ID  A
Sbjct  528  EKVREYNKKDAKFYGNMFAKMSKLEHAEANKSASKPEAEPMSIDGAA  574



>ref|XP_010905156.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Elaeis 
guineensis]
Length=574

 Score =   224 bits (572),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 144/167 (86%), Gaps = 3/167 (2%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK GKY RASKRYEKGAKFIEYD+SFS+EEKKQSK LKI+CNLNNAACKLKLKDYK+
Sbjct  408  NALFKVGKYERASKRYEKGAKFIEYDSSFSDEEKKQSKVLKITCNLNNAACKLKLKDYKQ  467

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLEL+  NVKALYRRAQAYI  AD DLAE DIKKALEIDPDNR+VKLEY+  K
Sbjct  468  AEKLCTKVLELDGRNVKALYRRAQAYIQLADLDLAEVDIKKALEIDPDNRDVKLEYRTLK  527

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQ---EAEAIDSKA  150
            EKVKEYNKKDAKFYGNMFAK+SK E   ++K AP+   E  ++DS A
Sbjct  528  EKVKEYNKKDAKFYGNMFAKMSKLENVEAHKDAPKPETEPMSVDSAA  574



>ref|XP_010036768.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW48406.1| hypothetical protein EUGRSUZ_K02110 [Eucalyptus grandis]
Length=574

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKEEGNV+FKAGKYA+ASKRYEK  K+IEYDTSFSE+EKKQ+KALK++
Sbjct  394  MNTEEKIEAAGKKKEEGNVIFKAGKYAKASKRYEKAVKYIEYDTSFSEDEKKQAKALKVA  453

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDY +AEKLCTKVLEL+S NVKALYRRAQAYI  +D DLAEFDIKKAL
Sbjct  454  CNLNDAACKLKLKDYNQAEKLCTKVLELDSRNVKALYRRAQAYIELSDLDLAEFDIKKAL  513

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDSK  153
            EIDP NR+VKLEYKV KEKVKE+NKKDAKFYGNMFAK+SK EP     +   E  +IDSK
Sbjct  514  EIDPHNRDVKLEYKVLKEKVKEFNKKDAKFYGNMFAKMSKLEPVEKTAAKEPEPMSIDSK  573

Query  152  A  150
            A
Sbjct  574  A  574



>gb|AFK35673.1| unknown [Medicago truncatula]
Length=575

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 147/166 (89%), Gaps = 2/166 (1%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK GKYA+ASKRYEK  KFIEYDTS+++E+KK +KALKI+CNLN+AACKLKLKDYK+
Sbjct  410  NALFKTGKYAKASKRYEKAVKFIEYDTSYTDEQKKSAKALKIACNLNDAACKLKLKDYKQ  469

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLE ESTNVKALYRRAQAYI  ADFDLAEFDIKKALEIDP+NR+VKLEYK  K
Sbjct  470  AEKLCTKVLEFESTNVKALYRRAQAYIQLADFDLAEFDIKKALEIDPNNRDVKLEYKTLK  529

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AIDSKA  150
            EKVKE NKKDAKFYGNMF+K++K +    NKSAP++ E  +IDSKA
Sbjct  530  EKVKEINKKDAKFYGNMFSKMTKLDFLDINKSAPKDVEPMSIDSKA  575



>gb|KJB42559.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=589

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 164/183 (90%), Gaps = 10/183 (5%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT EKIEAAGKKKEEGNVLFK+GKYARASKRYEK  K+I+YD+SFSEEEKKQ+KALK++
Sbjct  415  MNTPEKIEAAGKKKEEGNVLFKSGKYARASKRYEKAVKYIDYDSSFSEEEKKQAKALKVA  474

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKD+K+AEKLCTKVLE+ES+NVKALYRRAQAYIH AD DLAEFD+KKAL
Sbjct  475  CNLNNAACKLKLKDFKQAEKLCTKVLEIESSNVKALYRRAQAYIHLADLDLAEFDVKKAL  534

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDPDNRE+K+EYK+ KEK+KEYNKK+AKFYGNMFAK+        NK+AP+E     ID
Sbjct  535  EIDPDNREIKMEYKLLKEKMKEYNKKEAKFYGNMFAKM--------NKTAPKEPAPMTID  586

Query  158  SKA  150
            SKA
Sbjct  587  SKA  589



>ref|XP_007200299.1| hypothetical protein PRUPE_ppa003471mg [Prunus persica]
 gb|EMJ01498.1| hypothetical protein PRUPE_ppa003471mg [Prunus persica]
Length=572

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 164/183 (90%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKEEGN LFKAGKYARASKRYEK  K+I+YDTSFSEE+KKQSK LK++
Sbjct  390  MNTEEKIEAAGKKKEEGNALFKAGKYARASKRYEKAVKYIDYDTSFSEEDKKQSKVLKVA  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLC+KVLE+E  NVKALYRRAQAYI  AD DLAE DIKKAL
Sbjct  450  CNLNNAACKLKLKDYKQAEKLCSKVLEIEGRNVKALYRRAQAYIQLADLDLAELDIKKAL  509

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDP+NR+VKLEYK  KEK+KE+NKK+AKFYGNMFAKL+K +   SNK+A ++AE  ++D
Sbjct  510  EIDPNNRDVKLEYKTLKEKMKEFNKKEAKFYGNMFAKLTKSDSPDSNKTAAKDAEPMSVD  569

Query  158  SKA  150
            SKA
Sbjct  570  SKA  572



>ref|XP_008794657.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Phoenix dactylifera]
Length=573

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 146/166 (88%), Gaps = 2/166 (1%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFKAGKYARASKRYEKGAKFIEYD+SFS+EEK+QSK LKI+CNLN+AACKLKLKDYK+
Sbjct  408  NALFKAGKYARASKRYEKGAKFIEYDSSFSDEEKQQSKVLKITCNLNDAACKLKLKDYKQ  467

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLEL+S NVKALYRRAQAYI  AD DLAE DIKKALEIDPDNR+VKLEY+  K
Sbjct  468  AEKLCTKVLELDSRNVKALYRRAQAYIQLADLDLAELDIKKALEIDPDNRDVKLEYRTLK  527

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AIDSKA  150
            EKVKEYNKKDAKFYGNMFAK+SK E   ++ ++  E E  +IDS A
Sbjct  528  EKVKEYNKKDAKFYGNMFAKMSKLENMEAHAASKPETERMSIDSAA  573



>ref|XP_010647328.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 isoform 
X2 [Vitis vinifera]
Length=595

 Score =   223 bits (569),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKEEGNVLFKAGKYARASKRYEK AK+IEYD+SF EEEKKQ+K LK++
Sbjct  390  MNTEEKIEAAGKKKEEGNVLFKAGKYARASKRYEKAAKYIEYDSSFGEEEKKQAKTLKVT  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYKEAEKLCTKVL+++S NVKALYRRAQAYIH AD DLAEFDIKKAL
Sbjct  450  CNLNNAACKLKLKDYKEAEKLCTKVLDIQSKNVKALYRRAQAYIHLADLDLAEFDIKKAL  509

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKS  186
            EIDPDNR+VKLEY+  KEK+KEYNKK+AKFYGNMFA+++K E   +N++
Sbjct  510  EIDPDNRDVKLEYRTLKEKMKEYNKKEAKFYGNMFARMNKLEALETNRN  558



>ref|XP_008778812.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008779082.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Phoenix 
dactylifera]
Length=578

 Score =   223 bits (568),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 145/170 (85%), Gaps = 6/170 (4%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK GKYARASK+YEK AKF+EYD+SFSEEEKKQS+ALK++CNLNNAACKLKLKD+K+
Sbjct  409  NALFKLGKYARASKKYEKAAKFVEYDSSFSEEEKKQSRALKVTCNLNNAACKLKLKDFKQ  468

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLE+ES NVKALYRRAQAYI  AD DLAE DIKKALEIDPDNR+VKLEYK  K
Sbjct  469  AEKLCTKVLEIESKNVKALYRRAQAYIQLADLDLAEVDIKKALEIDPDNRDVKLEYKTLK  528

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSA----PQEAE--AIDSKA  150
            EKVKE+NKKDAKFYGNMFAK  K E   SNKS     P+EAE   IDS A
Sbjct  529  EKVKEFNKKDAKFYGNMFAKWRKLEHMESNKSGNQAMPEEAEPMTIDSAA  578



>ref|XP_009372201.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Pyrus 
x bretschneideri]
Length=572

 Score =   223 bits (567),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 162/183 (89%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKEEGN LFKAGKYARASKRYEK  K+I+YDTSF EEEKKQ+K LK++
Sbjct  390  MNTEEKIEAAGKKKEEGNALFKAGKYARASKRYEKAVKYIDYDTSFGEEEKKQAKVLKVA  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYK+AEKLCTKVLELE  NVKALYRRAQAYI  AD DLAE DIKKAL
Sbjct  450  CNLNDAACKLKLKDYKQAEKLCTKVLELEGRNVKALYRRAQAYIQLADLDLAELDIKKAL  509

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDP+NR+VKLEYK  KEK+KEYNKK+AKFYGNMFAKL+K +   SNK A ++AE  ++D
Sbjct  510  EIDPNNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKLTKSDSPDSNKEAAKDAEPMSVD  569

Query  158  SKA  150
            SKA
Sbjct  570  SKA  572



>ref|XP_004247044.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Solanum 
lycopersicum]
Length=557

 Score =   222 bits (566),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEA GKKKEEGN LFKAGKYARASKRYEK AKFIEYDT FSEEEKKQ+KALKIS
Sbjct  392  MNTQEKIEATGKKKEEGNALFKAGKYARASKRYEKAAKFIEYDTDFSEEEKKQAKALKIS  451

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYK+AEKLCTKVLE ESTNVKALYRRAQAY++ AD DLAEFDIKKAL
Sbjct  452  CNLNDAACKLKLKDYKQAEKLCTKVLETESTNVKALYRRAQAYMNMADLDLAEFDIKKAL  511

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK  213
            EIDP+NR+VKLEYK  KEKVKE+NKKDAKFYGNMFAKL+K
Sbjct  512  EIDPNNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNK  551



>ref|XP_008244682.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Prunus 
mume]
Length=572

 Score =   222 bits (566),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 163/183 (89%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKEEGN LFKAGKYARASKRYEK  K+I+YDTSFSEE+KKQ+K LK++
Sbjct  390  MNTEEKIEAAGKKKEEGNALFKAGKYARASKRYEKAVKYIDYDTSFSEEDKKQAKVLKVA  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLC+KVLE+E  NVKALYRRAQAYI  AD DLAE DIKKAL
Sbjct  450  CNLNNAACKLKLKDYKQAEKLCSKVLEIEGRNVKALYRRAQAYIQLADLDLAELDIKKAL  509

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDP NR+VKLEYK  KEK+KE+NKK+AKFYGNMFAKLSK +   SNK+A ++AE  ++D
Sbjct  510  EIDPKNRDVKLEYKTLKEKMKEFNKKEAKFYGNMFAKLSKSDSPDSNKTAAKDAEPVSVD  569

Query  158  SKA  150
            SKA
Sbjct  570  SKA  572



>ref|XP_009371084.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Pyrus 
x bretschneideri]
Length=241

 Score =   212 bits (540),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 155/181 (86%), Gaps = 9/181 (5%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIE AGKKKEEGNVLFKAGKY RASKRYEK  + IEYD++FS+EEK+Q+KALKI+
Sbjct  70   MNTQEKIETAGKKKEEGNVLFKAGKYERASKRYEKAVRLIEYDSTFSDEEKQQAKALKIT  129

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYI   D DLAE DIKKAL
Sbjct  130  CNLNDAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQLVDLDLAELDIKKAL  189

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDSK  153
            EIDPDNR+VKLEYKV K+KV+EYNKKDA+FYGN+FAK++K EP             IDSK
Sbjct  190  EIDPDNRDVKLEYKVLKQKVREYNKKDAQFYGNIFAKMNKQEPVPM---------TIDSK  240

Query  152  A  150
            A
Sbjct  241  A  241



>ref|XP_002534361.1| peptidylprolyl isomerase, putative [Ricinus communis]
 gb|EEF28026.1| peptidylprolyl isomerase, putative [Ricinus communis]
Length=583

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGN+LFKAGKYARASKRYEK  K IEYD+SFSEEEKKQ+KALK++
Sbjct  392  MNTQEKIEAAGKKKEEGNILFKAGKYARASKRYEKAVKHIEYDSSFSEEEKKQAKALKVA  451

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKL+LK+YKEAEKLCTKVL+LES NVKALYRRAQAYI  AD DLAEFDIKKAL
Sbjct  452  CNLNNAACKLRLKEYKEAEKLCTKVLDLESRNVKALYRRAQAYIQLADLDLAEFDIKKAL  511

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKS  186
            EI+PDNR+VKLEY+  K+K++E NKK+AKFYGNMFAK++K  P  SN S
Sbjct  512  EIEPDNRDVKLEYRTLKDKMRELNKKEAKFYGNMFAKMNKLGPLDSNVS  560



>gb|KDO40264.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=562

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 156/173 (90%), Gaps = 3/173 (2%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKE+GN LFKAGKYARASKRYEK  K+IEYDTSF +EEKKQ+KALK++
Sbjct  390  MNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDTSFGDEEKKQAKALKVA  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYI  AD DLAEFDIKKAL
Sbjct  450  CNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKAL  509

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKP---EPFSSNKSA  183
            EIDPDNR+VKLEYK  KEK+KEYNKK+AKFYGNMFAK+++P   EP S +  A
Sbjct  510  EIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMTEPKEAEPMSVDSKA  562



>gb|EPS61356.1| hypothetical protein M569_13437, partial [Genlisea aurea]
Length=382

 Score =   215 bits (547),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 143/164 (87%), Gaps = 7/164 (4%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NVLFKAGKY RASKRYEK AK+IEYDTSFS++EKKQSKALK++CNLNNAACKLKLK+YKE
Sbjct  226  NVLFKAGKYTRASKRYEKAAKYIEYDTSFSDDEKKQSKALKVTCNLNNAACKLKLKEYKE  285

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLE+ES NVKALYRRAQ+YI+ AD +LAE DIKKALEI+PDNREVK EYK+ K
Sbjct  286  AEKLCTKVLEIESRNVKALYRRAQSYINTADLELAESDIKKALEIEPDNREVKSEYKILK  345

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDSKA  150
            EKVKEYNKKDAKFYGNMFAKL+K        +   EA  IDSKA
Sbjct  346  EKVKEYNKKDAKFYGNMFAKLNKT-------TQSGEAMTIDSKA  382



>ref|XP_010905157.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Elaeis 
guineensis]
Length=573

 Score =   220 bits (560),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 142/166 (86%), Gaps = 2/166 (1%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK GKY RASKRYEKGAKFIEYD+SFS+EEKKQSK LKI+CNLNNAACKLKLKDYK+
Sbjct  408  NALFKVGKYERASKRYEKGAKFIEYDSSFSDEEKKQSKVLKITCNLNNAACKLKLKDYKQ  467

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLEL+  NVKALYRRAQAYI  AD DLAE DIKKALEIDPDNR+VKLEY+  K
Sbjct  468  AEKLCTKVLELDGRNVKALYRRAQAYIQLADLDLAEVDIKKALEIDPDNRDVKLEYRTLK  527

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AIDSKA  150
            EKVKEYNKKDAKFYGNMFAK+SK E   ++ +   E E  ++DS A
Sbjct  528  EKVKEYNKKDAKFYGNMFAKMSKLENVEAHDAPKPETEPMSVDSAA  573



>ref|XP_006840897.1| hypothetical protein AMTR_s00087p00078190 [Amborella trichopoda]
 gb|ERN02572.1| hypothetical protein AMTR_s00087p00078190 [Amborella trichopoda]
Length=592

 Score =   220 bits (560),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 161/190 (85%), Gaps = 4/190 (2%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT EKIEAA KKKEEGN LFK GKY RASK+YEK AK+IEYDTSFSEEEKKQSK LK++
Sbjct  402  MNTAEKIEAASKKKEEGNALFKVGKYLRASKKYEKAAKYIEYDTSFSEEEKKQSKQLKVT  461

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYIH AD DLAE DIKKAL
Sbjct  462  CNLNNAACKLKLKDYKQAEKLCTKVLDLQSKNVKALYRRAQAYIHTADLDLAELDIKKAL  521

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNK----SAPQEAEA  165
            EIDPDNR+VKLEY+  KEK+KEYNKK+AKFYGNMF+++SK E   SNK    S+ QE E 
Sbjct  522  EIDPDNRDVKLEYRTLKEKLKEYNKKEAKFYGNMFSRMSKLEQLESNKANQASSKQEEEP  581

Query  164  IDSKA*ACSA  135
            ++    A +A
Sbjct  582  MNIDGEAVAA  591



>ref|XP_008372538.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Malus 
domestica]
Length=572

 Score =   219 bits (559),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 163/183 (89%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKEEGN LFKAGKYARASKRYEK  K+I+YD+SFSEE KKQ+KALK++
Sbjct  390  MNTEEKIEAAGKKKEEGNALFKAGKYARASKRYEKAVKYIDYDSSFSEEAKKQAKALKVA  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYK+AEKLC+KVLELE  NVKALYRRAQAYI  AD DLAE DIKKAL
Sbjct  450  CNLNDAACKLKLKDYKQAEKLCSKVLELEGRNVKALYRRAQAYIQLADLDLAELDIKKAL  509

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDP+NR+VKLE+K  KEK+KEYNKK+AKFYGNMFAKL+K +   +NK+  ++AE  ++D
Sbjct  510  EIDPNNRDVKLEHKTLKEKMKEYNKKEAKFYGNMFAKLTKSDSLDNNKATDKDAEPMSVD  569

Query  158  SKA  150
            SKA
Sbjct  570  SKA  572



>ref|XP_007134161.1| hypothetical protein PHAVU_010G024500g [Phaseolus vulgaris]
 gb|ESW06155.1| hypothetical protein PHAVU_010G024500g [Phaseolus vulgaris]
Length=574

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 156/183 (85%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT EKIE AG KKEEGN LFKAGKYA+ASKRYEK  KFIEYDTSFS EEKK SK LK++
Sbjct  392  MNTPEKIEGAGNKKEEGNALFKAGKYAKASKRYEKAVKFIEYDTSFSVEEKKSSKTLKVA  451

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAYI  AD DLAE DIKKAL
Sbjct  452  CNLNNAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYIQLADLDLAEIDIKKAL  511

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA--ID  159
            E+DPDNREVKLEYK  KEK+KEYNKK AKFYGNMF KL K +   +NK+  ++A+   +D
Sbjct  512  ELDPDNREVKLEYKTLKEKMKEYNKKQAKFYGNMFNKLHKLDSLDNNKAESKDAQPMNVD  571

Query  158  SKA  150
            SKA
Sbjct  572  SKA  574



>ref|XP_006363450.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Solanum tuberosum]
Length=453

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAA KKKEEGN LFKAGKYARAS RYEK AKFIE DT FSEEEKKQ+KALKIS
Sbjct  290  MNTQEKIEAAVKKKEEGNALFKAGKYARASTRYEKAAKFIEDDTDFSEEEKKQAKALKIS  349

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVLE ESTNVKALYRRAQAY++  D DLAEFDIKKAL
Sbjct  350  CNLNNAACKLKLKDYKQAEKLCTKVLETESTNVKALYRRAQAYMNMTDLDLAEFDIKKAL  409

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK  213
            EIDP+NR+VKLEYK  KEKVKE+NKKDAKFYGNMFA+L+K
Sbjct  410  EIDPNNRDVKLEYKALKEKVKEFNKKDAKFYGNMFARLNK  449



>ref|XP_010532918.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Tarenaya 
hassleriana]
Length=566

 Score =   216 bits (551),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 156/175 (89%), Gaps = 5/175 (3%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT EKIEAAGKKKEEGN LFKAGKYARASKRYEK  KFIEYD+SF+E+EKKQ+KALK +
Sbjct  392  MNTPEKIEAAGKKKEEGNALFKAGKYARASKRYEKAVKFIEYDSSFNEDEKKQAKALKGA  451

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAAC+LKLKDYK+AEK+CTKVLELESTNVKALYRRAQAYI  AD DLAEFDIKKAL
Sbjct  452  CNLNNAACQLKLKDYKQAEKICTKVLELESTNVKALYRRAQAYIELADLDLAEFDIKKAL  511

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK-----PEPFSSNKSA  183
            +IDP+NRE+KLEY+  KEK+KEYNKK+AKFYGNMFAKL+K     PEP S +  A
Sbjct  512  DIDPNNREMKLEYRRLKEKMKEYNKKEAKFYGNMFAKLNKEASKDPEPMSVDSKA  566



>ref|XP_006363451.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Solanum tuberosum]
Length=555

 Score =   216 bits (550),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAA KKKEEGN LFKAGKYARAS RYEK AKFIE DT FSEEEKKQ+KALKIS
Sbjct  392  MNTQEKIEAAVKKKEEGNALFKAGKYARASTRYEKAAKFIEDDTDFSEEEKKQAKALKIS  451

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVLE ESTNVKALYRRAQAY++  D DLAEFDIKKAL
Sbjct  452  CNLNNAACKLKLKDYKQAEKLCTKVLETESTNVKALYRRAQAYMNMTDLDLAEFDIKKAL  511

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK  213
            EIDP+NR+VKLEYK  KEKVKE+NKKDAKFYGNMFA+L+K
Sbjct  512  EIDPNNRDVKLEYKALKEKVKEFNKKDAKFYGNMFARLNK  551



>ref|XP_009420312.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Musa acuminata 
subsp. malaccensis]
Length=562

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT EKIEAA KKKEEGN LFK GKY RASKRYEKG+KFIE+D+SFSEEEKKQSKALK  
Sbjct  392  MNTAEKIEAAAKKKEEGNALFKMGKYMRASKRYEKGSKFIEHDSSFSEEEKKQSKALKAI  451

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            C+LNNAACKLKLKDYKEAEKLCTKVLE ES NVKALYRRAQAYI  ADFDLAE DIKKAL
Sbjct  452  CSLNNAACKLKLKDYKEAEKLCTKVLETESRNVKALYRRAQAYIQLADFDLAELDIKKAL  511

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSA  183
            EIDPDNR+VKLEYK  KEK+KEYNKKDAKFY N+FAK+SK EP  ++K+ 
Sbjct  512  EIDPDNRDVKLEYKTLKEKMKEYNKKDAKFYSNIFAKMSKLEPTEASKAG  561



>gb|KDO40263.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=577

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKE+GN LFKAGKYARASKRYEK  K+IEYDTSF +EEKKQ+KALK++
Sbjct  390  MNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDTSFGDEEKKQAKALKVA  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYI  AD DLAEFDIKKAL
Sbjct  450  CNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKAL  509

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLS  216
            EIDPDNR+VKLEYK  KEK+KEYNKK+AKFYGNMFAK+S
Sbjct  510  EIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMS  548



>gb|KJB08784.1| hypothetical protein B456_001G103400 [Gossypium raimondii]
Length=568

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            +NTQEKIEAAGKKKEEGNVLFKAGKY RASKRYEK  K+I+YDTSFSEEEKKQSKALK++
Sbjct  390  LNTQEKIEAAGKKKEEGNVLFKAGKYVRASKRYEKAVKYIDYDTSFSEEEKKQSKALKVA  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYK+AEKLCTKVLELES NVKALYRRAQAYI+ AD DLAE DIKKAL
Sbjct  450  CNLNDAACKLKLKDYKQAEKLCTKVLELESANVKALYRRAQAYINLADLDLAELDIKKAL  509

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK  213
            E+DPDNREVKLEYK  KEK+KEYNKK+AKFYGNMFAK++K
Sbjct  510  ELDPDNREVKLEYKALKEKIKEYNKKEAKFYGNMFAKMNK  549



>ref|XP_007034164.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 3 [Theobroma cacao]
 gb|EOY05090.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 3 [Theobroma cacao]
Length=574

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 158/181 (87%), Gaps = 1/181 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGN L+KAGKY RASKRYEK  KFIEYD+SFS+EEK+Q+K LKI+
Sbjct  395  MNTQEKIEAAGKKKEEGNALYKAGKYERASKRYEKAVKFIEYDSSFSDEEKQQTKLLKIT  454

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYKEAEKLCTKVLEL++ NVKALYRRAQAYI   D DLAE DIKKAL
Sbjct  455  CNLNNAACKLKLKDYKEAEKLCTKVLELDNKNVKALYRRAQAYIQIVDLDLAEVDIKKAL  514

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDSK  153
            EIDPDNR+VKLEY+V KEK++EYNKKDA+FYGN+FAK++K E   + K  P    AIDSK
Sbjct  515  EIDPDNRDVKLEYRVLKEKIREYNKKDAQFYGNIFAKMNKLEQAKAAKRGPTPM-AIDSK  573

Query  152  A  150
            A
Sbjct  574  A  574



>gb|KGN57238.1| hypothetical protein Csa_3G172920 [Cucumis sativus]
Length=575

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 144/167 (86%), Gaps = 3/167 (2%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NVLFKAGKY RAS+RYEK  ++IEYDTSFS+EEK+QSKALKISCNLNNAACKLK+KDYK+
Sbjct  409  NVLFKAGKYERASRRYEKAVRYIEYDTSFSDEEKQQSKALKISCNLNNAACKLKVKDYKQ  468

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLEL+S NVKALYRRAQAYI   D DLAE DIKKALEIDPDNR+VK+EY+  +
Sbjct  469  AEKLCTKVLELDSRNVKALYRRAQAYIQLVDLDLAERDIKKALEIDPDNRDVKIEYRQLE  528

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPF-SSNKSAPQEA--EAIDSKA  150
            +KV+EYNK+DA+FYGN+FAK++K E   S+N    QEA    IDSKA
Sbjct  529  DKVREYNKRDAQFYGNIFAKMNKLEHAKSANSGGKQEAVPMTIDSKA  575



>gb|KHN25146.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Glycine soja]
Length=470

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 143/166 (86%), Gaps = 2/166 (1%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFKAGKYARASKRYEK  KFIEYDT+FSEEEKK SK LK++CNLNNAACKLKLKDYK+
Sbjct  305  NALFKAGKYARASKRYEKAVKFIEYDTAFSEEEKKSSKFLKVACNLNNAACKLKLKDYKQ  364

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVL+LESTNVKALYRR QAYI  AD DLAEFDIKKALE++P+NR+VKLEY   K
Sbjct  365  AEKLCTKVLDLESTNVKALYRRTQAYIQLADLDLAEFDIKKALELEPNNRDVKLEYVTLK  424

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA--IDSKA  150
            EK+KEYNKK+AKFYGNMF KL K +   ++K A ++A+   IDSK+
Sbjct  425  EKMKEYNKKEAKFYGNMFNKLHKLDSLDNSKPASKDAQPINIDSKS  470



>ref|XP_006418643.1| hypothetical protein EUTSA_v10002468mg [Eutrema salsugineum]
 gb|ESQ37079.1| hypothetical protein EUTSA_v10002468mg [Eutrema salsugineum]
Length=550

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKEEGN  FKAGKYA ASKRYEK  KFIEYDTSFSEEEKKQSKALK++
Sbjct  391  MNTEEKIEAAGKKKEEGNSKFKAGKYALASKRYEKAVKFIEYDTSFSEEEKKQSKALKVA  450

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLK+YK+AEKLCTKVLELESTNVKALYRRAQAY+  AD DLAEFD+KKAL
Sbjct  451  CNLNDAACKLKLKEYKQAEKLCTKVLELESTNVKALYRRAQAYMELADLDLAEFDVKKAL  510

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK  213
            EIDPDNREVKLE +  KEK+KE+NKK+AKFYGNMFAKL+K
Sbjct  511  EIDPDNREVKLEQRRLKEKMKEFNKKEAKFYGNMFAKLTK  550



>ref|XP_008382577.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Malus 
domestica]
Length=567

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 157/181 (87%), Gaps = 3/181 (2%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKEEGN LFKAGKYARASKRYEK  K+I+YDTSF EEEKKQ+K LK++
Sbjct  390  MNTEEKIEAAGKKKEEGNALFKAGKYARASKRYEKAVKYIDYDTSFGEEEKKQAKVLKVA  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYK+AEKLCTKVLELE  NVKALYRRAQAYI  AD DLAE DIKKAL
Sbjct  450  CNLNDAACKLKLKDYKQAEKLCTKVLELEGRNVKALYRRAQAYIQLADLDLAELDIKKAL  509

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDSK  153
            EIDP+NR+VKLEYK  KEK+KEYNKK+AKFYGNMFAKL  P+  ++  + P    ++DSK
Sbjct  510  EIDPNNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKLLAPQKEAAKDAEPM---SVDSK  566

Query  152  A  150
            A
Sbjct  567  A  567



>ref|XP_006437244.1| hypothetical protein CICLE_v10031088mg [Citrus clementina]
 gb|ESR50484.1| hypothetical protein CICLE_v10031088mg [Citrus clementina]
Length=559

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKE+GN LFKAGKYARASKRYEK  K+IEYDTSF +EEKKQ+KALK++
Sbjct  390  MNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDTSFGDEEKKQAKALKVA  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYI  AD DLAEFDIKKAL
Sbjct  450  CNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKAL  509

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLS  216
            EIDPDNR+VKLEYK  KEK+KEYNKK+AKFYGNMFAK+S
Sbjct  510  EIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMS  548



>ref|XP_009349114.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Pyrus 
x bretschneideri]
Length=572

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 162/183 (89%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKEEGN LFKAGKY RASKRYEK  K+I+YD+SFSEE KKQ+KALK++
Sbjct  390  MNTEEKIEAAGKKKEEGNALFKAGKYVRASKRYEKAVKYIDYDSSFSEEAKKQAKALKVA  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLK+YK+AEKLC+KVLELE  NVKALYRRAQAYI  AD DLAE DIKKAL
Sbjct  450  CNLNDAACKLKLKEYKQAEKLCSKVLELEGRNVKALYRRAQAYIQLADLDLAELDIKKAL  509

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA--ID  159
            EIDP+NR+VKLE+K  KEK+KEYNKK+AKFYGNMFAKL+K +   +NK+A ++AE   +D
Sbjct  510  EIDPNNRDVKLEHKTLKEKMKEYNKKEAKFYGNMFAKLTKSDSPDNNKAADKDAEPMIVD  569

Query  158  SKA  150
            SKA
Sbjct  570  SKA  572



>ref|XP_009371078.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Pyrus x bretschneideri]
Length=457

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 155/181 (86%), Gaps = 9/181 (5%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIE AGKKKEEGNVLFKAGKY RASKRYEK  + IEYD++FS+EEK+Q+KALKI+
Sbjct  286  MNTQEKIETAGKKKEEGNVLFKAGKYERASKRYEKAVRLIEYDSTFSDEEKQQAKALKIT  345

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYI   D DLAE DIKKAL
Sbjct  346  CNLNDAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQLVDLDLAELDIKKAL  405

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDSK  153
            EIDPDNR+VKLEYKV K+KV+EYNKKDA+FYGN+FAK++K EP             IDSK
Sbjct  406  EIDPDNRDVKLEYKVLKQKVREYNKKDAQFYGNIFAKMNKQEPVPMT---------IDSK  456

Query  152  A  150
            A
Sbjct  457  A  457



>ref|XP_004160641.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Cucumis 
sativus]
Length=571

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 142/166 (86%), Gaps = 5/166 (3%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NVLFKAGKY RAS+RYEK  ++IEYDTSFS+EEK+QSKALKISCNLNNAACKLK+KDYK+
Sbjct  409  NVLFKAGKYERASRRYEKAVRYIEYDTSFSDEEKQQSKALKISCNLNNAACKLKVKDYKQ  468

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLEL+S NVKALYRRAQAYI   D DLAE DIKKALEIDPDNR+VK+EY+  K
Sbjct  469  AEKLCTKVLELDSRNVKALYRRAQAYIQLVDLDLAERDIKKALEIDPDNRDVKIEYRQLK  528

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEA--EAIDSKA  150
            +KV+EYNK+DA+FYGN+FAK++K E    N    QEA    IDSKA
Sbjct  529  DKVREYNKRDAQFYGNIFAKMNKLE---HNSGGKQEAVPMTIDSKA  571



>ref|XP_010926682.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Elaeis guineensis]
Length=548

 Score =   214 bits (546),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 146/167 (87%), Gaps = 3/167 (2%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N +FK GKY RASKRYEKGAKFIEYD+SFS+EEK+QSK LKI+ NLNNAACKLKLKDYK+
Sbjct  382  NAVFKVGKYIRASKRYEKGAKFIEYDSSFSDEEKRQSKVLKITFNLNNAACKLKLKDYKQ  441

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVL+L S+NVKALY RAQAYI  AD DLAE DIKKALEIDPDNR+VKLEYK  K
Sbjct  442  AEKLCTKVLQLNSSNVKALYGRAQAYIQLADLDLAERDIKKALEIDPDNRDVKLEYKTLK  501

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQ-EAE--AIDSKA  150
            EKV+EYNKK+AKFYGNMFAK+SK E   +NKSAP+ EA+  +IDS A
Sbjct  502  EKVREYNKKEAKFYGNMFAKMSKLEHTEANKSAPKPEAQPMSIDSAA  548



>ref|XP_004147650.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Cucumis 
sativus]
Length=571

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 142/166 (86%), Gaps = 5/166 (3%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NVLFKAGKY RAS+RYEK  ++IEYDTSFS+EEK+QSKALKISCNLNNAACKLK+KDYK+
Sbjct  409  NVLFKAGKYERASRRYEKAVRYIEYDTSFSDEEKQQSKALKISCNLNNAACKLKVKDYKQ  468

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLEL+S NVKALYRRAQAYI   D DLAE DIKKALEIDPDNR+VK+EY+  +
Sbjct  469  AEKLCTKVLELDSRNVKALYRRAQAYIQLVDLDLAERDIKKALEIDPDNRDVKIEYRQLE  528

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEA--EAIDSKA  150
            +KV+EYNK+DA+FYGN+FAK++K E    N    QEA    IDSKA
Sbjct  529  DKVREYNKRDAQFYGNIFAKMNKLE---HNSGGKQEAVPMTIDSKA  571



>ref|XP_008439052.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Cucumis melo]
Length=575

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 143/167 (86%), Gaps = 3/167 (2%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NVLFKAGKY RAS+RYEK  ++IEYDTSFS+EEK+QSKALKISCNLNNAACKLK+KDYK+
Sbjct  409  NVLFKAGKYERASRRYEKAVRYIEYDTSFSDEEKQQSKALKISCNLNNAACKLKVKDYKQ  468

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLEL+S NVKALYRRAQAYI   D DLAE DIKKALEIDPDNR+VK+EY+  K
Sbjct  469  AEKLCTKVLELDSRNVKALYRRAQAYIQLVDLDLAEQDIKKALEIDPDNRDVKIEYRQLK  528

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPF-SSNKSAPQEA--EAIDSKA  150
            EKVKEYNK+DA+FYGN+FAK++K E   S+N    QE     IDSKA
Sbjct  529  EKVKEYNKRDAQFYGNIFAKMNKLEHAKSANSGGKQEGVPMTIDSKA  575



>ref|XP_009385667.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK GKYA+ASKRYEKGAKFI+YD +FSEEEKKQSKALK +C+LNNAACKLKLKDYKE
Sbjct  411  NALFKLGKYAKASKRYEKGAKFIDYDNNFSEEEKKQSKALKAACSLNNAACKLKLKDYKE  470

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLCTKVLE+ES+NVKALYRRAQAY+  AD DLAE DIKKALEIDP+NR+VKLEYK+ K
Sbjct  471  AIKLCTKVLEIESSNVKALYRRAQAYMQLADLDLAEVDIKKALEIDPNNRDVKLEYKILK  530

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSA  183
            EKV+EYNKKDAKFYGNMFAK+SK EP   NK  
Sbjct  531  EKVREYNKKDAKFYGNMFAKMSKLEPVEPNKGG  563



>ref|XP_010466944.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Camelina 
sativa]
Length=562

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAA KKKEEGN  FKAGKYA ASKRYEK  KFIEYDTSFSEEEKKQ+KALK++
Sbjct  392  MNTEEKIEAATKKKEEGNSQFKAGKYALASKRYEKAVKFIEYDTSFSEEEKKQAKALKVA  451

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY+  AD DLAEFD+KKAL
Sbjct  452  CNLNDAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYMELADLDLAEFDVKKAL  511

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK  213
            EIDP+NREVKLE +  KEK+KE+NKK+AKFYGNMFAKL+K
Sbjct  512  EIDPNNREVKLEQRRLKEKMKEFNKKEAKFYGNMFAKLTK  551



>ref|XP_004149324.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cucumis 
sativus]
 ref|XP_004164600.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cucumis 
sativus]
 gb|KGN44652.1| hypothetical protein Csa_7G363060 [Cucumis sativus]
Length=553

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MN QEKIEAAGKKKEEGNVLFK+GK+ARASKRYEK  KFIEYD+SFSEEEKKQ+KALK++
Sbjct  390  MNNQEKIEAAGKKKEEGNVLFKSGKFARASKRYEKAVKFIEYDSSFSEEEKKQAKALKVA  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLK Y EAEKLCTKVLELES+NVKALYRRAQAYI  AD DLAEFDIKKAL
Sbjct  450  CNLNNAACKLKLKLYNEAEKLCTKVLELESSNVKALYRRAQAYIQLADLDLAEFDIKKAL  509

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPE  207
            +IDP+NR+VKLEYK  KEKVKEYNKKDAKFYGNMFAK+ K E
Sbjct  510  DIDPNNRDVKLEYKTLKEKVKEYNKKDAKFYGNMFAKMKKVE  551



>ref|XP_010488634.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Camelina 
sativa]
Length=561

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAA KKKEEGN  FKAGKYA ASKRYEK  KFIEYDTSFSEEEKKQ+KALK++
Sbjct  391  MNTEEKIEAATKKKEEGNSKFKAGKYALASKRYEKAVKFIEYDTSFSEEEKKQAKALKVA  450

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY+  AD DLAEFD+KKAL
Sbjct  451  CNLNDAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYMELADLDLAEFDVKKAL  510

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK  213
            EIDP+NREVKLE +  KEK+KE+NKK+AKFYGNMFAKL+K
Sbjct  511  EIDPNNREVKLEQRRLKEKMKEFNKKEAKFYGNMFAKLTK  550



>gb|KDO40262.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=567

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKE+GN LFKAGKYARASKRYEK  K+IEYDTSF +EEKKQ+KALK++
Sbjct  390  MNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDTSFGDEEKKQAKALKVA  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYI  AD DLAEFDIKKAL
Sbjct  450  CNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKAL  509

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKL  219
            EIDPDNR+VKLEYK  KEK+KEYNKK+AKFYGNMFAK+
Sbjct  510  EIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKM  547



>ref|XP_008458076.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cucumis 
melo]
Length=553

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MN QEKIEAAGKKKEEGNVLFK+GK+ARASKRYEK  KFIEYD+SFSEEEKKQ+KALK++
Sbjct  390  MNNQEKIEAAGKKKEEGNVLFKSGKFARASKRYEKAVKFIEYDSSFSEEEKKQAKALKVA  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLK Y EAEKLCTKVLELES+NVKALYRRAQAYI  AD DLAEFDIKKAL
Sbjct  450  CNLNNAACKLKLKLYNEAEKLCTKVLELESSNVKALYRRAQAYIQLADLDLAEFDIKKAL  509

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPE  207
            +IDP+NR+VKLEYK  KEKVKEYNKKDAKFYGNMFAK+ K E
Sbjct  510  DIDPNNRDVKLEYKTLKEKVKEYNKKDAKFYGNMFAKMKKVE  551



>gb|KDO40266.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=557

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKE+GN LFKAGKYARASKRYEK  K+IEYDTSF +EEKKQ+KALK++
Sbjct  390  MNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDTSFGDEEKKQAKALKVA  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYI  AD DLAEFDIKKAL
Sbjct  450  CNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKAL  509

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLS  216
            EIDPDNR+VKLEYK  KEK+KEYNKK+AKFYGNMFAK++
Sbjct  510  EIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMN  548



>ref|XP_010514063.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Camelina 
sativa]
Length=562

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAA KKKEEGN  FKAGKYA ASKRYEK  KFIEYDTSFSEEEKKQ+KALK++
Sbjct  392  MNTEEKIEAATKKKEEGNSKFKAGKYALASKRYEKAVKFIEYDTSFSEEEKKQAKALKVA  451

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY+  AD DLAEFD+KKAL
Sbjct  452  CNLNDAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYMELADLDLAEFDVKKAL  511

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK  213
            EIDP+NREVKLE +  KEK+KE+NKK+AKFYGNMFAKL+K
Sbjct  512  EIDPNNREVKLEQRRLKEKMKEFNKKEAKFYGNMFAKLTK  551



>ref|XP_007034162.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 1 [Theobroma cacao]
 gb|EOY05088.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 1 [Theobroma cacao]
Length=609

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGN L+KAGKY RASKRYEK  KFIEYD+SFS+EEK+Q+K LKI+
Sbjct  395  MNTQEKIEAAGKKKEEGNALYKAGKYERASKRYEKAVKFIEYDSSFSDEEKQQTKLLKIT  454

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYKEAEKLCTKVLEL++ NVKALYRRAQAYI   D DLAE DIKKAL
Sbjct  455  CNLNNAACKLKLKDYKEAEKLCTKVLELDNKNVKALYRRAQAYIQIVDLDLAEVDIKKAL  514

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDSK  153
            EIDPDNR+VKLEY+V KEK++EYNKKDA+FYGN+FAK++K E   + K  P    AIDSK
Sbjct  515  EIDPDNRDVKLEYRVLKEKIREYNKKDAQFYGNIFAKMNKLEQAKAAKRGPTPM-AIDSK  573

Query  152  A  150
             
Sbjct  574  V  574



>ref|NP_001052535.1| Os04g0352400 [Oryza sativa Japonica Group]
 gb|AAD29708.2|AF140495_1 FK506-binding protein [Oryza sativa Japonica Group]
 emb|CAE05842.2| OSJNBa0091C07.4 [Oryza sativa Japonica Group]
 dbj|BAF14449.1| Os04g0352400 [Oryza sativa Japonica Group]
 gb|EAZ30344.1| hypothetical protein OsJ_14391 [Oryza sativa Japonica Group]
 dbj|BAG94794.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77072.1| hypothetical protein OsI_15470 [Oryza sativa Indica Group]
Length=585

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 142/168 (85%), Gaps = 5/168 (3%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NV FK GKYA+ASKRYEK AK+IEYD+SF+++EKKQSKALK+SC LNNAACKLKLK+Y+E
Sbjct  419  NVWFKMGKYAKASKRYEKAAKYIEYDSSFTDDEKKQSKALKVSCKLNNAACKLKLKEYRE  478

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLELESTNVKALYRR QAYI  AD +LAE D+KKALEIDPDNR+VK+ YK  K
Sbjct  479  AEKLCTKVLELESTNVKALYRRTQAYIELADLELAELDVKKALEIDPDNRDVKMVYKTLK  538

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAP--QEAE--AIDSKA  150
            EK+KEYNK+DAKFYGNMFAK  K E    NK  P  QEA+  AIDS A
Sbjct  539  EKIKEYNKRDAKFYGNMFAKWRKLEHM-ENKKVPGKQEAQPMAIDSAA  585



>gb|AGT17361.1| peptidylprolyl isomerase [Saccharum hybrid cultivar R570]
Length=590

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 138/166 (83%), Gaps = 3/166 (2%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NV FK GKYA+ASKRYEK AK+IEYD+SFSE+EKKQSKALK+SC LNNAACKLKLK+Y+E
Sbjct  426  NVWFKMGKYAKASKRYEKAAKYIEYDSSFSEDEKKQSKALKVSCKLNNAACKLKLKEYRE  485

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLELESTNVKALYRRAQAYI   D +LAE D+KKALEIDPDNR+VKL YK  K
Sbjct  486  AEKLCTKVLELESTNVKALYRRAQAYIELVDLELAELDVKKALEIDPDNRDVKLVYKTLK  545

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFS--SNKSAPQEAEAIDSKA  150
            E+++EYN++DAKFYGNMFAK  K E       K  PQ   AIDS A
Sbjct  546  ERMREYNRRDAKFYGNMFAKWRKLEQLQKVPGKQEPQPM-AIDSAA  590



>ref|XP_010100792.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Morus notabilis]
 gb|EXB84490.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Morus notabilis]
Length=547

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 135/159 (85%), Gaps = 6/159 (4%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFKAGKY RASKRYEK  K+IEYDT+F EEEKKQ+KALK++CNLNNAACKLKLKDYKE
Sbjct  389  NALFKAGKYLRASKRYEKAVKYIEYDTNFREEEKKQAKALKVACNLNNAACKLKLKDYKE  448

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLE ES NVKALYRRAQAYI  AD DLAEFDIKKALEIDP+N  VKLEYK  K
Sbjct  449  AEKLCTKVLEAESRNVKALYRRAQAYIQLADLDLAEFDIKKALEIDPNNMNVKLEYKTLK  508

Query  281  ekvkeynkKDAKFYGNMFAKLSK------PEPFSSNKSA  183
            EK++EYNKKDAKFYGNMFAK+SK       EP S + SA
Sbjct  509  EKMREYNKKDAKFYGNMFAKMSKNAAAKEAEPTSVDSSA  547



>ref|NP_189160.3| rotamase FKBP 1 [Arabidopsis thaliana]
 sp|Q38931.2|FKB62_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP62; Short=PPIase 
FKBP62; AltName: Full=70 kDa peptidyl-prolyl isomerase; 
AltName: Full=FK506-binding protein 62; Short=AtFKBP62; 
AltName: Full=Immunophilin FKBP62; AltName: Full=Peptidylprolyl 
isomerase ROF1; AltName: Full=Protein ROTAMASE FKBP 1; 
AltName: Full=Rotamase [Arabidopsis thaliana]
 gb|AAB82062.1| rof1 [Arabidopsis thaliana]
 gb|AEE76996.1| rotamase FKBP 1 [Arabidopsis thaliana]
Length=551

 Score =   211 bits (538),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAA KKKEEGN  FK GKY+ ASKRYEK  KFIEYDTSFSEEEKKQ+KALK++
Sbjct  391  MNTEEKIEAASKKKEEGNSKFKGGKYSLASKRYEKAVKFIEYDTSFSEEEKKQAKALKVA  450

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY+  +D DLAEFD+KKAL
Sbjct  451  CNLNDAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYMELSDLDLAEFDVKKAL  510

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK  213
            EIDP+NREVKLE K  KEK+KE+NKK+AKFYGNMFAKLSK
Sbjct  511  EIDPNNREVKLEQKRLKEKMKEFNKKEAKFYGNMFAKLSK  550



>ref|XP_006652190.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Oryza brachyantha]
Length=570

 Score =   211 bits (538),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 141/168 (84%), Gaps = 5/168 (3%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NV FK GKYA+ASKRYEK AKF+EYD+SFS++EKKQSKALK+S  LNNAACKLKLK+YKE
Sbjct  404  NVWFKMGKYAKASKRYEKAAKFVEYDSSFSDDEKKQSKALKVSTKLNNAACKLKLKEYKE  463

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLELE TNVKALYRRAQAYI  AD +LAE D+KKALEIDPDNR+VK+ YK  K
Sbjct  464  AEKLCTKVLELECTNVKALYRRAQAYIQLADLELAELDVKKALEIDPDNRDVKMVYKTLK  523

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAP--QEAE--AIDSKA  150
            EK+KEYNK+DAKFYGNMFAK  K E    NK  P  QEA+  AIDS A
Sbjct  524  EKIKEYNKRDAKFYGNMFAKWRKLEHM-ENKKVPGKQEAQPMAIDSAA  570



>ref|XP_009406340.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Musa acuminata 
subsp. malaccensis]
Length=578

 Score =   211 bits (538),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK GK+ARASKRYEK AK+IEYD+SFS+EEKKQSK LK++CNLNNAACKLKLKDYK+
Sbjct  408  NALFKLGKHARASKRYEKAAKYIEYDSSFSDEEKKQSKVLKVTCNLNNAACKLKLKDYKQ  467

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVL+++STNVKALYRRAQAY+H  D DLAE DIKKALEIDPDNR+VK+EYK+ K
Sbjct  468  AEKLCTKVLDIDSTNVKALYRRAQAYMHLCDLDLAEQDIKKALEIDPDNRDVKMEYKILK  527

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKS  186
            EKVKEYNKKDAKFY N+FAKLSK E   +NK+
Sbjct  528  EKVKEYNKKDAKFYSNIFAKLSKLEQMEANKA  559



>ref|XP_009373610.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Pyrus x bretschneideri]
Length=567

 Score =   211 bits (537),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 154/181 (85%), Gaps = 9/181 (5%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIE AGKKKEEGNVLFKAGKY RASKRYEK  + IEYD++FS+EEK+Q+KALKI+
Sbjct  396  MNTQEKIETAGKKKEEGNVLFKAGKYERASKRYEKAVRLIEYDSTFSDEEKQQAKALKIT  455

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYK+AEKLCTKVL+L+  NVKALYRRAQAYI   D DLAE DIKKAL
Sbjct  456  CNLNDAACKLKLKDYKQAEKLCTKVLDLDGRNVKALYRRAQAYIQLVDLDLAELDIKKAL  515

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDSK  153
            EIDPDNR+VKLEYKV K+KV+EYNKKDA+FYGN+FAK++K EP             IDSK
Sbjct  516  EIDPDNRDVKLEYKVLKQKVREYNKKDAQFYGNIFAKMNKQEPVPMT---------IDSK  566

Query  152  A  150
            A
Sbjct  567  A  567



>sp|Q43207.1|FKB70_WHEAT RecName: Full=70 kDa peptidyl-prolyl isomerase; AltName: Full=Peptidyl-prolyl 
cis-trans isomerase; Short=PPIase; AltName: 
Full=Rotamase [Triticum aestivum]
 emb|CAA60505.1| peptidylprolyl isomerase [Triticum aestivum]
Length=559

 Score =   211 bits (537),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK+GKYARASKRYEK AKFIEYDTSFSE+EKKQSK LKI+CNLNNAACKLKLKDYK+
Sbjct  409  NALFKSGKYARASKRYEKAAKFIEYDTSFSEDEKKQSKQLKITCNLNNAACKLKLKDYKQ  468

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLEL+S NVKALYRRAQAY   AD +LAE DIKKALEIDP+NR+VKL YK  K
Sbjct  469  AEKLCTKVLELDSRNVKALYRRAQAYTQLADLELAEVDIKKALEIDPENRDVKLTYKTLK  528

Query  281  ekvkeynkKDAKFYGNMFAKLSKP  210
            EK+KE NKKDAKFY NMF+K++KP
Sbjct  529  EKIKEINKKDAKFYSNMFSKMTKP  552



>gb|AAB82061.1| rof1 [Arabidopsis thaliana]
Length=551

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAA KKKEEGN  FK GKY+ ASKRYEK  KF+EYDTSFSEEEKKQ+KALK++
Sbjct  391  MNTEEKIEAASKKKEEGNSKFKGGKYSLASKRYEKAVKFVEYDTSFSEEEKKQAKALKVA  450

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY+  +D DLAEFD+KKAL
Sbjct  451  CNLNDAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYMELSDLDLAEFDVKKAL  510

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK  213
            EIDP+NREVKLE K  KEK+KE+NKK+AKFYGNMFAKLSK
Sbjct  511  EIDPNNREVKLEQKRLKEKMKEFNKKEAKFYGNMFAKLSK  550



>ref|XP_009410619.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Musa acuminata 
subsp. malaccensis]
Length=549

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT EKIEAAGKKKEEGN LFK GKYARASKRYEKGAKFIEYD SFSEEEKKQS+ALK  
Sbjct  390  MNTAEKIEAAGKKKEEGNALFKLGKYARASKRYEKGAKFIEYDNSFSEEEKKQSRALKAI  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            C+LNNAACKLK KDYKEAEKLC+KVLE++S NVKALYRRAQAYI  AD DLAE DIKKAL
Sbjct  450  CDLNNAACKLKFKDYKEAEKLCSKVLEVDSRNVKALYRRAQAYIQLADLDLAELDIKKAL  509

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK  213
            EIDPDNR+VKLEYK  KEK++EYNKKDAKFYGN+FAK+SK
Sbjct  510  EIDPDNRDVKLEYKSLKEKMREYNKKDAKFYGNIFAKMSK  549



>ref|XP_010550903.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Tarenaya 
hassleriana]
Length=549

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKEEGN LFKAGKYARAS RYEK  KFIEYD+SFSE+EKKQ+KALK++
Sbjct  391  MNTEEKIEAAGKKKEEGNALFKAGKYARASTRYEKAVKFIEYDSSFSEDEKKQAKALKVT  450

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVLE ESTNVKALYRR+QAYI  AD DLAEFDIKKAL
Sbjct  451  CNLNNAACKLKLKDYKQAEKLCTKVLEQESTNVKALYRRSQAYIELADLDLAEFDIKKAL  510

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKL  219
            EIDP+NREVKLEY+  KEK+KEYNKK+AK YGNMFAKL
Sbjct  511  EIDPNNREVKLEYRRLKEKMKEYNKKEAKLYGNMFAKL  548



>ref|XP_009136108.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Brassica 
rapa]
Length=550

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKEEGN  FKAGKYA ASKRYEK  K+IEYD+SFSEEEKKQ+KALK++
Sbjct  391  MNTEEKIEAAGKKKEEGNAKFKAGKYALASKRYEKAVKYIEYDSSFSEEEKKQAKALKVA  450

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLK+Y++AEKLCTKVLELESTNVKALYRRAQAY+  AD DLAEFD+KKAL
Sbjct  451  CNLNDAACKLKLKEYRQAEKLCTKVLELESTNVKALYRRAQAYMELADLDLAEFDVKKAL  510

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK  213
            E+DPDNREVK+E +  KEK+KE+NKK+AKFYGNMFAKLSK
Sbjct  511  EVDPDNREVKVEQRRLKEKMKEFNKKEAKFYGNMFAKLSK  550



>ref|XP_008352304.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Malus domestica]
Length=567

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 154/181 (85%), Gaps = 9/181 (5%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIE+AGKKKEEGN LFKAGKY RASKRYEK  +FIEYD++F +EEK+Q+KALKI+
Sbjct  396  MNTQEKIESAGKKKEEGNALFKAGKYERASKRYEKAVRFIEYDSTFGDEEKQQAKALKIT  455

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYI   D DLAE DIKKAL
Sbjct  456  CNLNDAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQLVDLDLAELDIKKAL  515

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDSK  153
            EIDPDNR+VK EYKV K+KV+EYNKKDA+FYGN+FAK++K EP             IDSK
Sbjct  516  EIDPDNRDVKQEYKVLKQKVREYNKKDAQFYGNIFAKMNKQEPVPMT---------IDSK  566

Query  152  A  150
            A
Sbjct  567  A  567



>dbj|BAB02082.1| peptidylprolyl isomerase; FK506-binding protein [Arabidopsis 
thaliana]
Length=555

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAA KKKEEGN  FK GKY+ ASKRYEK  KFIEYDTSFSEEEKKQ+KALK++
Sbjct  391  MNTEEKIEAASKKKEEGNSKFKGGKYSLASKRYEKAVKFIEYDTSFSEEEKKQAKALKVA  450

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY+  +D DLAEFD+KKAL
Sbjct  451  CNLNDAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYMELSDLDLAEFDVKKAL  510

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLS  216
            EIDP+NREVKLE K  KEK+KE+NKK+AKFYGNMFAKLS
Sbjct  511  EIDPNNREVKLEQKRLKEKMKEFNKKEAKFYGNMFAKLS  549



>ref|XP_010685108.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Beta vulgaris 
subsp. vulgaris]
Length=547

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEA+GKKKEEGN LFKAGKY RASKRYEK AK+IEYD+SFS+EEKKQ K LK+S
Sbjct  389  MNTEEKIEASGKKKEEGNALFKAGKYVRASKRYEKAAKYIEYDSSFSDEEKKQCKVLKVS  448

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLK+YKEAEKLCTKVLELES NVKALYRRAQAY+H AD +LAEFDIKKAL
Sbjct  449  CNLNNAACKLKLKEYKEAEKLCTKVLELESMNVKALYRRAQAYVHLADLELAEFDIKKAL  508

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLS  216
            EIDPDNR+VKLEYK  KEK++EYNKKDA+ YG MF+K++
Sbjct  509  EIDPDNRDVKLEYKKLKEKIREYNKKDAQLYGKMFSKIA  547



>ref|XP_002883594.1| peptidylprolyl isomerase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59853.1| peptidylprolyl isomerase [Arabidopsis lyrata subsp. lyrata]
Length=551

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            M+T+EKIEAA KKKEEGN  FKAGKYA ASKRYEK  KFIEYDTSFSEEEKKQ+KALK++
Sbjct  388  MSTEEKIEAASKKKEEGNSKFKAGKYALASKRYEKAVKFIEYDTSFSEEEKKQAKALKVA  447

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY+  AD DLAEFD+KKAL
Sbjct  448  CNLNDAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYMEMADLDLAEFDVKKAL  507

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLS  216
            EIDP+NREVKLE +  KEK+KE+NKK+AKFYGNMFAKL+
Sbjct  508  EIDPNNREVKLEQRRLKEKMKEFNKKEAKFYGNMFAKLT  546



>ref|XP_002321107.2| hypothetical protein POPTR_0014s14690g [Populus trichocarpa]
 gb|EEE99422.2| hypothetical protein POPTR_0014s14690g [Populus trichocarpa]
Length=577

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 157/183 (86%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGN  FKAGKY RAS+RYEK AKFIEYD+SF++EEK+QSK LKIS
Sbjct  395  MNTQEKIEAAGKKKEEGNAWFKAGKYERASRRYEKAAKFIEYDSSFTDEEKQQSKVLKIS  454

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            C LNNAACKLKLKDYKEAEKLC+KVLEL+  NVKALYRRAQAYI   D DLAE DIK+AL
Sbjct  455  CKLNNAACKLKLKDYKEAEKLCSKVLELDGKNVKALYRRAQAYIQLVDLDLAEIDIKRAL  514

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEA--EAID  159
            EIDPDNR+VKLE K+ K+KV+EYNKK+A+FY N+FAK++K E  +S  +A Q+A    ID
Sbjct  515  EIDPDNRDVKLENKILKDKVREYNKKEAQFYSNIFAKMNKLEQTNSTMAAKQDAMPMTID  574

Query  158  SKA  150
            SKA
Sbjct  575  SKA  577



>emb|CDP15134.1| unnamed protein product [Coffea canephora]
Length=576

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 161/183 (88%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MN QEKIEAAGKKKEEGNV FKAGKYARASKRYEKG  FIEYD+SFS+EEK+Q+K LKIS
Sbjct  394  MNAQEKIEAAGKKKEEGNVWFKAGKYARASKRYEKGVGFIEYDSSFSDEEKQQAKLLKIS  453

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYKEA KLCTKVL+++S NVKALYRRAQAYI   + +LAE DIKKAL
Sbjct  454  CNLNNAACKLKLKDYKEAVKLCTKVLDIDSRNVKALYRRAQAYIQLVELELAEQDIKKAL  513

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEA--EAID  159
            EIDPDNR+VK+EYK+ K+KVKEYN+KDA+FYG++FAK+SK E  +S+ +  +EA   AID
Sbjct  514  EIDPDNRDVKMEYKILKDKVKEYNRKDAQFYGSIFAKMSKLEQQNSSSAEKKEAMPMAID  573

Query  158  SKA  150
            SKA
Sbjct  574  SKA  576



>emb|CDY52281.1| BnaA03g57740D [Brassica napus]
Length=558

 Score =   209 bits (532),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKEEGN  FKAGKYA ASKRYEK  K+IEYD+SFSEEEKKQ+KALK++
Sbjct  391  MNTEEKIEAAGKKKEEGNAKFKAGKYALASKRYEKAVKYIEYDSSFSEEEKKQAKALKVA  450

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLK+Y++AEKLCTKVLELESTNVKALYRRAQAY+  AD DLAEFD+KKAL
Sbjct  451  CNLNDAACKLKLKEYRQAEKLCTKVLELESTNVKALYRRAQAYMELADLDLAEFDVKKAL  510

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLS  216
            E+DPDNREVK+E +  KEK+KE+NKK+AKFYGNMFAKLS
Sbjct  511  EVDPDNREVKVEQRRLKEKMKEFNKKEAKFYGNMFAKLS  549



>gb|KEH20636.1| peptidyl-prolyl cis-trans isomerase FKBP62-like protein [Medicago 
truncatula]
Length=570

 Score =   209 bits (532),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 162/183 (89%), Gaps = 3/183 (2%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            +NTQEKIEAAGKKKEEGN LFKAGK+ RASKRYEK  ++ EYD+SFS+EEK+Q+KALKIS
Sbjct  389  LNTQEKIEAAGKKKEEGNALFKAGKHERASKRYEKAIRYFEYDSSFSDEEKQQAKALKIS  448

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYK+AEKLCTKVLEL+S NVKALYRRAQAYIH  D DLAE DIKKAL
Sbjct  449  CNLNDAACKLKLKDYKQAEKLCTKVLELDSRNVKALYRRAQAYIHLIDLDLAEMDIKKAL  508

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEA--EAID  159
            EIDPDNR+VK+EYK+ K+KV+EYNKKDA+FYGN+FAK++K E  +   +A QE+   A+D
Sbjct  509  EIDPDNRDVKIEYKILKDKVREYNKKDAQFYGNIFAKMNKVEQ-ARTAAAKQESVPMAVD  567

Query  158  SKA  150
            S+A
Sbjct  568  SQA  570



>dbj|BAK01956.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=589

 Score =   209 bits (533),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NV FK GKYA+ASKRYEK AK+IEYD+SFSE+EKKQ+KA+KIS  LNNAACKLKLKDYKE
Sbjct  427  NVWFKMGKYAKASKRYEKAAKYIEYDSSFSEDEKKQTKAVKISIKLNNAACKLKLKDYKE  486

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLELESTNVKALYRRAQAY    D +LAE DIKKALEIDPDNREVK+ YK  K
Sbjct  487  AEKLCTKVLELESTNVKALYRRAQAYTQLVDLELAELDIKKALEIDPDNREVKVAYKALK  546

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDSKA  150
            +K++EYNK+DAKFYGNMFAK  K E  ++ K    +  AIDS A
Sbjct  547  DKLREYNKRDAKFYGNMFAKWRKTE-NAAGKQQDAQPMAIDSTA  589



>ref|XP_006358774.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Solanum 
tuberosum]
Length=580

 Score =   209 bits (532),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 158/183 (86%), Gaps = 5/183 (3%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGNVLFKAGKY RASKRYEK   FIEYD+SFS++EK+Q K LK+S
Sbjct  401  MNTQEKIEAAGKKKEEGNVLFKAGKYVRASKRYEKAVSFIEYDSSFSDDEKQQVKLLKVS  460

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLK+YKEA KLC++VLE++S NVKALYRRAQAYI   D DLAE DIKKAL
Sbjct  461  CNLNNAACKLKLKEYKEAAKLCSEVLEIDSKNVKALYRRAQAYIQLVDLDLAELDIKKAL  520

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSS--NKSAPQEAEAID  159
            EIDPDNR+VKLEYKV KEK+KEYNKKDA+FYGN+FAK++K E      N++AP    AID
Sbjct  521  EIDPDNRDVKLEYKVLKEKIKEYNKKDAQFYGNIFAKMNKLEQSGEAKNEAAPM---AID  577

Query  158  SKA  150
            SKA
Sbjct  578  SKA  580



>gb|EMS57053.1| 70 kDa peptidyl-prolyl isomerase [Triticum urartu]
Length=582

 Score =   209 bits (531),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 138/166 (83%), Gaps = 6/166 (4%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N  FK GKYA+ASKRYEK AK+IEYD+SFSE+EKKQSKA+KIS  LNNAACKLKLKDYKE
Sbjct  421  NAWFKMGKYAKASKRYEKAAKYIEYDSSFSEDEKKQSKAVKISIKLNNAACKLKLKDYKE  480

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLELESTNVKALYRRAQAY    D +LAE DIKKALEIDPDNREVK+ YK  K
Sbjct  481  AEKLCTKVLELESTNVKALYRRAQAYTELVDLELAELDIKKALEIDPDNREVKVAYKALK  540

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AIDSKA  150
            +K++EYNK+DAKFYGNMFAK  K E    N +  Q+A+  AIDS A
Sbjct  541  DKLREYNKRDAKFYGNMFAKWRKTE----NAAGKQDAQPMAIDSTA  582



>ref|XP_004975324.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Setaria 
italica]
Length=594

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 137/168 (82%), Gaps = 5/168 (3%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N  FK GKYA+ASKRYEK AK+IEYD+SFSE+EKKQSKALKISC LNNAACKLKLK+Y+E
Sbjct  428  NAWFKMGKYAKASKRYEKAAKYIEYDSSFSEDEKKQSKALKISCKLNNAACKLKLKEYRE  487

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLELESTNVKALYRRAQAYI   D +LAE D+KKALE DPDNR+VKL YK  K
Sbjct  488  AEKLCTKVLELESTNVKALYRRAQAYIELVDLELAELDVKKALEFDPDNRDVKLVYKTLK  547

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSS----NKSAPQEAEAIDSKA  150
            EK++EYN++DAKFYGNMFAK  K E   +     K  PQ   AIDS A
Sbjct  548  EKMREYNRRDAKFYGNMFAKWRKLEHMDTKKVPGKQEPQPM-AIDSAA  594



>ref|NP_001118695.1| rotamase FKBP 1 [Arabidopsis thaliana]
 gb|AEE76997.1| rotamase FKBP 1 [Arabidopsis thaliana]
Length=562

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAA KKKEEGN  FK GKY+ ASKRYEK  KFIEYDTSFSEEEKKQ+KALK++
Sbjct  391  MNTEEKIEAASKKKEEGNSKFKGGKYSLASKRYEKAVKFIEYDTSFSEEEKKQAKALKVA  450

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY+  +D DLAEFD+KKAL
Sbjct  451  CNLNDAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYMELSDLDLAEFDVKKAL  510

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKL  219
            EIDP+NREVKLE K  KEK+KE+NKK+AKFYGNMFAKL
Sbjct  511  EIDPNNREVKLEQKRLKEKMKEFNKKEAKFYGNMFAKL  548



>ref|XP_008222791.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Prunus mume]
Length=578

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 158/187 (84%), Gaps = 9/187 (5%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            +NTQEKIEAAGKKKEEGNVLFKAGKY RASKRYEK  KFIEYD++FS+EEK+QSK LKI+
Sbjct  395  LNTQEKIEAAGKKKEEGNVLFKAGKYERASKRYEKAVKFIEYDSAFSDEEKQQSKMLKIT  454

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLK+YK+AEKLCTKVLEL+S NVKALYRRAQAYI   D DLAE DIKKAL
Sbjct  455  CNLNDAACKLKLKEYKQAEKLCTKVLELDSRNVKALYRRAQAYIQLVDLDLAELDIKKAL  514

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE-----  168
            EIDPDNR+VK EYKV KEKV+EYNKKDA+FYG +FAK++K   F   KSA   A+     
Sbjct  515  EIDPDNRDVKQEYKVLKEKVREYNKKDAQFYGAIFAKMNK---FEQVKSASGGAKQDPVP  571

Query  167  -AIDSKA  150
              IDSKA
Sbjct  572  MTIDSKA  578



>ref|NP_001149790.1| LOC100283417 [Zea mays]
 gb|ACG36811.1| peptidyl-prolyl isomerase [Zea mays]
 tpg|DAA48150.1| TPA: peptidyl-prolyl isomerase [Zea mays]
 tpg|DAA48151.1| TPA: peptidyl-prolyl isomerase [Zea mays]
Length=553

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK+GKYARASKRYEK AK+IEYDTSFSE+EKKQSK LKISCNLNNAACKLKLKDYKE
Sbjct  411  NALFKSGKYARASKRYEKAAKYIEYDTSFSEDEKKQSKQLKISCNLNNAACKLKLKDYKE  470

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLCTKVLEL+S NVKALYRR QAYI  AD +LAE DIKKALEIDPDNR+VKLEYK+ K
Sbjct  471  AAKLCTKVLELDSQNVKALYRRVQAYIQLADLELAEADIKKALEIDPDNRDVKLEYKILK  530

Query  281  ekvkeynkKDAKFYGNMFAKLSK  213
            EK+KEYNKKDAKFY NMFAK++K
Sbjct  531  EKIKEYNKKDAKFYSNMFAKMTK  553



>emb|CDY15103.1| BnaC03g44640D [Brassica napus]
Length=558

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKEEGN  FKAGKYA ASKRYEK  K+IEYD+SFSE+EKKQ+KALK++
Sbjct  391  MNTEEKIEAAGKKKEEGNAKFKAGKYALASKRYEKAVKYIEYDSSFSEDEKKQAKALKVA  450

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLK+Y++AEKLCTKVLELESTNVKALYRRAQAY+  AD DLAEFD+KKAL
Sbjct  451  CNLNDAACKLKLKEYRQAEKLCTKVLELESTNVKALYRRAQAYMELADLDLAEFDVKKAL  510

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLS  216
            E+DPDNREVK+E +  KEK+KE+NKK+AKFYGNMFAKLS
Sbjct  511  EVDPDNREVKVEQRRLKEKMKEFNKKEAKFYGNMFAKLS  549



>ref|XP_011000006.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Populus euphratica]
Length=577

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 156/183 (85%), Gaps = 2/183 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGN  FKAGKY RAS+RYEK AKFIEYD+SF++EEK+QSK LKIS
Sbjct  395  MNTQEKIEAAGKKKEEGNAWFKAGKYERASRRYEKAAKFIEYDSSFTDEEKQQSKVLKIS  454

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            C LNNAACKLKLKDYKEAEKLC+KVLEL+  NVKALYRRAQAYI   D DLAE DIK+AL
Sbjct  455  CKLNNAACKLKLKDYKEAEKLCSKVLELDGQNVKALYRRAQAYIQLVDLDLAEIDIKRAL  514

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQE--AEAID  159
            EIDPDNR+VKLEYK+ K+KV+EY KK+A+FY N+FAK++K E  +S  +A Q+     ID
Sbjct  515  EIDPDNRDVKLEYKILKDKVREYKKKEAQFYSNIFAKMNKLEQTNSTMAAKQDPMPMTID  574

Query  158  SKA  150
            SKA
Sbjct  575  SKA  577



>gb|AIU40165.1| peptidyl-prolyl cis-trans isomerase, partial [Triticum aestivum]
Length=438

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK+GKYARASKRYEK AKFI+YDTSFSE+EKKQSK LKI+CNLNNAACKLKLKDYK+
Sbjct  297  NALFKSGKYARASKRYEKAAKFIDYDTSFSEDEKKQSKQLKITCNLNNAACKLKLKDYKQ  356

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLEL+S NVKALYRRAQAY   AD +LAE DIKKALEIDP+NR+VKL YK  K
Sbjct  357  AEKLCTKVLELDSQNVKALYRRAQAYTQLADLELAEVDIKKALEIDPENRDVKLTYKTLK  416

Query  281  ekvkeynkKDAKFYGNMFAKLS  216
            EK+KE NKKDAKFY NMF+K++
Sbjct  417  EKIKEINKKDAKFYSNMFSKMT  438



>ref|XP_004504386.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Cicer 
arietinum]
Length=570

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 160/185 (86%), Gaps = 7/185 (4%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            +NTQEKIEAAGKKKEEGN LFKA K+ RAS RYEK  K+IEYD+SFS++EK+Q+KALKI+
Sbjct  389  LNTQEKIEAAGKKKEEGNALFKASKHERASNRYEKAIKYIEYDSSFSDKEKQQAKALKIT  448

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVLEL+S NVKALYRRAQA+IH  D DLAE DIKKAL
Sbjct  449  CNLNNAACKLKLKDYKQAEKLCTKVLELDSRNVKALYRRAQAHIHLVDLDLAEMDIKKAL  508

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSS----NKSAPQEAEA  165
            EIDPDNR+VK+EYK+ K+KV+EYNKKDA+FYGN+FAKL+K E   +     +SAP    A
Sbjct  509  EIDPDNRDVKIEYKILKDKVREYNKKDAQFYGNIFAKLNKVEQARTAAAKQESAPM---A  565

Query  164  IDSKA  150
            +DSKA
Sbjct  566  VDSKA  570



>tpg|DAA48152.1| TPA: hypothetical protein ZEAMMB73_593378 [Zea mays]
Length=559

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK+GKYARASKRYEK AK+IEYDTSFSE+EKKQSK LKISCNLNNAACKLKLKDYKE
Sbjct  417  NALFKSGKYARASKRYEKAAKYIEYDTSFSEDEKKQSKQLKISCNLNNAACKLKLKDYKE  476

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLCTKVLEL+S NVKALYRR QAYI  AD +LAE DIKKALEIDPDNR+VKLEYK+ K
Sbjct  477  AAKLCTKVLELDSQNVKALYRRVQAYIQLADLELAEADIKKALEIDPDNRDVKLEYKILK  536

Query  281  ekvkeynkKDAKFYGNMFAKLSK  213
            EK+KEYNKKDAKFY NMFAK++K
Sbjct  537  EKIKEYNKKDAKFYSNMFAKMTK  559



>ref|XP_007222365.1| hypothetical protein PRUPE_ppa003399mg [Prunus persica]
 gb|EMJ23564.1| hypothetical protein PRUPE_ppa003399mg [Prunus persica]
Length=578

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 158/187 (84%), Gaps = 9/187 (5%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            +NTQEKIEAAGKKKEEGNVLFKAGKY RASKRYEK  KFIEYD++FS+EEK+QSK LK++
Sbjct  395  LNTQEKIEAAGKKKEEGNVLFKAGKYERASKRYEKAVKFIEYDSAFSDEEKQQSKMLKVT  454

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLK+YK+AEKLCTKVLEL+S NVKALYRRAQAYI   D DLAE DIKKAL
Sbjct  455  CNLNDAACKLKLKEYKQAEKLCTKVLELDSRNVKALYRRAQAYIQLVDLDLAELDIKKAL  514

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE-----  168
            EIDPDNR+VK EYKV KEKV+EYNKKDA+FYG +FAK++K   F   KSA   A+     
Sbjct  515  EIDPDNRDVKQEYKVLKEKVREYNKKDAQFYGAIFAKMNK---FEQVKSASGGAKQDPVP  571

Query  167  -AIDSKA  150
              IDSKA
Sbjct  572  MTIDSKA  578



>ref|NP_001062292.1| Os08g0525600 [Oryza sativa Japonica Group]
 dbj|BAD11570.1| putative 70 kDa peptidylprolyl isomerase [Oryza sativa Japonica 
Group]
 dbj|BAF24206.1| Os08g0525600 [Oryza sativa Japonica Group]
 dbj|BAG95934.1| unnamed protein product [Oryza sativa Japonica Group]
Length=580

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK GKY RASKRYEK AKFIEYD+SFSE+EKKQSK LK++CNLNNAACKLKLKDYK+
Sbjct  414  NALFKLGKYVRASKRYEKAAKFIEYDSSFSEDEKKQSKQLKVTCNLNNAACKLKLKDYKQ  473

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLEL+S NVKALYRRAQAY+  AD +LAE DIKKALEIDPDNR+VKL YK  K
Sbjct  474  AEKLCTKVLELDSQNVKALYRRAQAYMQLADLELAEVDIKKALEIDPDNRDVKLTYKNLK  533

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSA  183
            EKVKEYNKKDAKFY NMFAK++K +P    K+ 
Sbjct  534  EKVKEYNKKDAKFYSNMFAKMTK-QPAEDGKAG  565



>ref|XP_006492988.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
FKBP65-like [Citrus sinensis]
Length=567

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 156/184 (85%), Gaps = 3/184 (2%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGNVLFKAGKY RASKRYEK   +I YD+SFS+EEK+Q+K LKI+
Sbjct  384  MNTQEKIEAAGKKKEEGNVLFKAGKYERASKRYEKAVNYIGYDSSFSDEEKQQAKVLKIT  443

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLK+YK+AEKLC+KVLEL+S NVKALYRR QAYI   D DLAE DIKKAL
Sbjct  444  CNLNNAACKLKLKEYKQAEKLCSKVLELDSKNVKALYRRVQAYIQLVDLDLAELDIKKAL  503

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA---I  162
            EIDPDNR V++EYK+ KEKV+EYNKKDA+FYGN+FAK++K E   S  S  ++  A   I
Sbjct  504  EIDPDNRAVRMEYKLLKEKVREYNKKDAQFYGNIFAKMNKLEQAKSASSMAKQEPAPMVI  563

Query  161  DSKA  150
            DSKA
Sbjct  564  DSKA  567



>gb|KDP32575.1| hypothetical protein JCGZ_13125 [Jatropha curcas]
Length=579

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 157/184 (85%), Gaps = 3/184 (2%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGN LFKAGKY RAS+RYEK   FIEYD+SFS+EEKKQ+KALKI+
Sbjct  396  MNTQEKIEAAGKKKEEGNALFKAGKYERASRRYEKAVSFIEYDSSFSDEEKKQTKALKIT  455

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            C LNNAACKLKLKDYKEA KLCTKVLEL+  NVKALYRRAQAYI   D DLAE DIKKAL
Sbjct  456  CKLNNAACKLKLKDYKEAVKLCTKVLELDIRNVKALYRRAQAYIQLVDLDLAEMDIKKAL  515

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPF-SSNKSAPQE--AEAI  162
            EIDPDNR+VKLEYK+ KEKV+EYNKKDA+FY N+F+K+SK E   S+N +  Q+    A+
Sbjct  516  EIDPDNRDVKLEYKILKEKVREYNKKDAQFYSNIFSKISKLEQTKSANGTGKQDPMPMAV  575

Query  161  DSKA  150
            DSKA
Sbjct  576  DSKA  579



>ref|XP_006659596.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Oryza brachyantha]
Length=579

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK GKY +ASKRYEK AKFIEYD+SFSE+EKKQSK LK++CNLNNAACKLKLKDYK+
Sbjct  414  NALFKLGKYVKASKRYEKAAKFIEYDSSFSEDEKKQSKQLKVTCNLNNAACKLKLKDYKQ  473

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLEL+S NVKALYRRAQAYI  AD +LAE DIKKALEIDPDNR+VKL YK  K
Sbjct  474  AEKLCTKVLELDSQNVKALYRRAQAYIQLADLELAEVDIKKALEIDPDNRDVKLTYKNLK  533

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSA  183
            EKVKEYNKKDAKFY NMFAK++K +P   +K+ 
Sbjct  534  EKVKEYNKKDAKFYSNMFAKMTK-QPADDSKAG  565



>ref|XP_007034163.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 2 [Theobroma cacao]
 gb|EOY05089.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 2 [Theobroma cacao]
Length=609

 Score =   207 bits (528),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGN L+KAGKY RASKRYEK  KFIEYD+SFS+EEK+Q+K LKI+
Sbjct  395  MNTQEKIEAAGKKKEEGNALYKAGKYERASKRYEKAVKFIEYDSSFSDEEKQQTKLLKIT  454

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYKEAEKLCTKVLEL++ NVKALYRRAQAYI   D DLAE DIKKAL
Sbjct  455  CNLNNAACKLKLKDYKEAEKLCTKVLELDNKNVKALYRRAQAYIQIVDLDLAEVDIKKAL  514

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPE  207
            EIDPDNR+VKLEY+V KEK++EYNKKDA+FYGN+FAK++K E
Sbjct  515  EIDPDNRDVKLEYRVLKEKIREYNKKDAQFYGNIFAKMNKLE  556



>dbj|BAK02378.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK GKYARASKRYEK AK IEYDTSFSE+EKKQSK LKI+CNLNNAACKLKLKDYK+
Sbjct  409  NALFKLGKYARASKRYEKAAKIIEYDTSFSEDEKKQSKQLKITCNLNNAACKLKLKDYKQ  468

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLEL+S NVKALYRR+QAY   AD +LAE DIKKALEIDP+NR+VKL YK  K
Sbjct  469  AEKLCTKVLELDSRNVKALYRRSQAYTQLADLELAEVDIKKALEIDPENRDVKLTYKTLK  528

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKS  186
            EK+KE NKKDAKFY NMF+K+++P    S K+
Sbjct  529  EKIKEINKKDAKFYSNMFSKMTRPSAEESQKA  560



>gb|KHN10949.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Glycine soja]
Length=544

 Score =   206 bits (524),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            +NT+EK+EAAGKKKEEGNVLFKAGK+ARASKRYEK  K+IEYD+SF EEEKKQ+K LK++
Sbjct  382  LNTEEKLEAAGKKKEEGNVLFKAGKHARASKRYEKAVKYIEYDSSFGEEEKKQAKTLKVA  441

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYKEAEKLCTKVL+LESTNVKALYRRAQAY+   D DLAE DIKKAL
Sbjct  442  CNLNNAACKLKLKDYKEAEKLCTKVLDLESTNVKALYRRAQAYMQLTDLDLAELDIKKAL  501

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK  213
            EIDP+NR+VKLEY+  KEKVK  N+K+A+FYGNM  K++K
Sbjct  502  EIDPNNRDVKLEYRTLKEKVKANNRKEAQFYGNMINKMTK  541



>ref|XP_004290160.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Fragaria 
vesca subsp. vesca]
Length=565

 Score =   206 bits (524),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 157/181 (87%), Gaps = 6/181 (3%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT EKIEAAGKKKEEGN  FKAGKYA+ASKRYEK  K+IEYDT+F+EEEKKQ+KALK++
Sbjct  391  MNTPEKIEAAGKKKEEGNAFFKAGKYAKASKRYEKAVKYIEYDTAFAEEEKKQAKALKVA  450

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AA KLKLK+YK+AEKLCTKVLELE  NVKALYRRAQAYI  AD DLAE DIKKAL
Sbjct  451  CNLNDAASKLKLKEYKQAEKLCTKVLELEGRNVKALYRRAQAYIQLADLDLAELDIKKAL  510

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDSK  153
            EIDP+NR+VKLEYK  KEK+KE+NKK+AKFYGNMFAKL+K     S+K A  E  ++DSK
Sbjct  511  EIDPNNRDVKLEYKTLKEKMKEFNKKEAKFYGNMFAKLTK----DSDKDA--EPMSVDSK  564

Query  152  A  150
            A
Sbjct  565  A  565



>emb|CAA68913.1| peptidylprolyl isomerase [Triticum aestivum]
Length=568

 Score =   206 bits (523),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 135/162 (83%), Gaps = 4/162 (2%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N  FK GKYA+ASKRYEK AK+IEYD+SFSE+EKKQSKA+KIS  LNNAACKLKLKDYKE
Sbjct  407  NAWFKMGKYAKASKRYEKAAKYIEYDSSFSEDEKKQSKAVKISIKLNNAACKLKLKDYKE  466

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEK+C+KVLELESTNVKALYRRAQAY    D +LAE DIKKALEIDPDNREVK+ YK  K
Sbjct  467  AEKICSKVLELESTNVKALYRRAQAYTELVDLELAELDIKKALEIDPDNREVKVAYKALK  526

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDS  156
            +K++EYNK+DAKFYGNMFAK  K E    N +  QEA+ + S
Sbjct  527  DKLREYNKRDAKFYGNMFAKWRKTE----NAAGKQEAQPMAS  564



>ref|XP_007153782.1| hypothetical protein PHAVU_003G064500g [Phaseolus vulgaris]
 gb|ESW25776.1| hypothetical protein PHAVU_003G064500g [Phaseolus vulgaris]
Length=569

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 156/183 (85%), Gaps = 3/183 (2%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            +NT EKIE AGKKKEEGN LFK GKY RASKRYEK  KFIEYD+SF +EEK+QSKALKI+
Sbjct  388  LNTPEKIEGAGKKKEEGNALFKVGKYERASKRYEKAMKFIEYDSSFGDEEKQQSKALKIT  447

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLCTKVLEL+S NVKALYRRAQAY+H  D DLAE DIKKAL
Sbjct  448  CNLNNAACKLKLKDYKQAEKLCTKVLELDSRNVKALYRRAQAYLHLVDLDLAEMDIKKAL  507

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQE--AEAID  159
            EI+P+NR+VK+EYK+ K+KV+EYNKKDA+FYG MFAK++K E  +   +A QE     ID
Sbjct  508  EIEPENRDVKMEYKLLKQKVREYNKKDAQFYGIMFAKMNKLEE-ARTATAKQEPVPMTID  566

Query  158  SKA  150
            SKA
Sbjct  567  SKA  569



>gb|EMT25795.1| 70 kDa peptidyl-prolyl isomerase [Aegilops tauschii]
Length=587

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 136/166 (82%), Gaps = 6/166 (4%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N  FK GKYA+ASKRYEK AK+IEYD+SFSE+EKKQSKA+KIS  LNNAACKLKLKDYKE
Sbjct  426  NAWFKMGKYAKASKRYEKAAKYIEYDSSFSEDEKKQSKAVKISIKLNNAACKLKLKDYKE  485

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLC KVLELESTNVKALYRRAQAY    D +LAE DIKKALEIDPDNREVK+ YK  K
Sbjct  486  AEKLCAKVLELESTNVKALYRRAQAYTELVDLELAELDIKKALEIDPDNREVKVAYKALK  545

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AIDSKA  150
            +K++EYNK+DAKFYGNMFAK  K E    N +  Q A+  AIDS A
Sbjct  546  DKLREYNKRDAKFYGNMFAKWRKTE----NAAGKQNAQPMAIDSTA  587



>ref|XP_003574798.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase [Brachypodium distachyon]
Length=567

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK  KYARASKRYEK AK IEYDTSFSE+EKKQSK LKI+CNLNNAACKLKLKDYK+
Sbjct  414  NALFKLSKYARASKRYEKAAKLIEYDTSFSEDEKKQSKQLKITCNLNNAACKLKLKDYKQ  473

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLEL+S NVKALYRRAQAY   AD +LAE DIKKALEI+PDNR+VKL YK  K
Sbjct  474  AEKLCTKVLELDSQNVKALYRRAQAYTQLADLELAETDIKKALEIEPDNRDVKLTYKNLK  533

Query  281  ekvkeynkKDAKFYGNMFAKLSKP  210
            EK+KE NKKDAKFY NMFAK++KP
Sbjct  534  EKIKEINKKDAKFYSNMFAKMTKP  557



>gb|EYU40640.1| hypothetical protein MIMGU_mgv1a003616mg [Erythranthe guttata]
 gb|EYU40641.1| hypothetical protein MIMGU_mgv1a003616mg [Erythranthe guttata]
Length=574

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKIEAAGKKKEEGN LFKAGKYA+ASKRYEK AK+IE++TSFS+EEKK  K LK+S
Sbjct  416  MNTEEKIEAAGKKKEEGNSLFKAGKYAKASKRYEKAAKYIEHETSFSDEEKKLCKVLKVS  475

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEKLC+KVLELESTNVKALYRRAQAY++ AD D+AEFDIKKAL
Sbjct  476  CNLNNAACKLKLKDYKQAEKLCSKVLELESTNVKALYRRAQAYMNMADLDVAEFDIKKAL  535

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKL  219
            E+DP+NREVKL YK  KEK+KEYNKKDAKFYGNMFAKL
Sbjct  536  ELDPENREVKLGYKALKEKMKEYNKKDAKFYGNMFAKL  573



>ref|XP_004973965.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Setaria 
italica]
 ref|XP_004973966.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Setaria 
italica]
Length=553

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK GKYARASKRYEK AK+IEYD+SFSE+EKKQSK LKISCNLNNAACKLKLKDYK+
Sbjct  411  NTLFKLGKYARASKRYEKAAKYIEYDSSFSEDEKKQSKQLKISCNLNNAACKLKLKDYKQ  470

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLEL+S NVKALYRR QAYI  AD +LAE DIKK LEIDPDNR+ KLEYK  K
Sbjct  471  AEKLCTKVLELDSQNVKALYRRVQAYIQLADLELAEADIKKGLEIDPDNRDFKLEYKTLK  530

Query  281  ekvkeynkKDAKFYGNMFAKLSK  213
            EK+KEYNKKDAKFY NMFAK++K
Sbjct  531  EKIKEYNKKDAKFYSNMFAKMTK  553



>ref|XP_003524915.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoformX1 [Glycine 
max]
Length=570

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 159/183 (87%), Gaps = 3/183 (2%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            +NTQEKIEAAGKKKEEGN  FK GKY RASKRYEK  KF+EYD+SFS+EEK+Q+KALKI+
Sbjct  389  LNTQEKIEAAGKKKEEGNAFFKVGKYERASKRYEKAIKFVEYDSSFSDEEKQQTKALKIT  448

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEK+CTKVLEL+S NVKALYRRAQAY+H  D DLAE DIKKAL
Sbjct  449  CNLNNAACKLKLKDYKQAEKMCTKVLELDSRNVKALYRRAQAYLHLVDLDLAEMDIKKAL  508

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQE--AEAID  159
            EI+P+NR+VK+EYK+ K+KV+E+NKKDA+FYG++FAK++K E  +   +A QE     ID
Sbjct  509  EIEPNNRDVKMEYKILKQKVREHNKKDAQFYGSIFAKMNKLEQ-ARTATAKQEPVPMTID  567

Query  158  SKA  150
            SKA
Sbjct  568  SKA  570



>gb|KJB42564.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=516

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT EKIEAAGKKKEEGNVLFK+GKYARASKRYEK  K+I+YD+SFSEEEKKQ+KALK++
Sbjct  390  MNTPEKIEAAGKKKEEGNVLFKSGKYARASKRYEKAVKYIDYDSSFSEEEKKQAKALKVA  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKD+K+AEKLCTKVLE+ES+NVKALYRRAQAYIH AD DLAEFD+KKAL
Sbjct  450  CNLNNAACKLKLKDFKQAEKLCTKVLEIESSNVKALYRRAQAYIHLADLDLAEFDVKKAL  509

Query  332  EIDPDNR  312
            EIDPDNR
Sbjct  510  EIDPDNR  516



>ref|XP_008669632.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Zea mays]
 tpg|DAA38461.1| TPA: hypothetical protein ZEAMMB73_460939 [Zea mays]
Length=588

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 136/166 (82%), Gaps = 3/166 (2%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NV FK GKYA+ASKRYEK AK+IEYD+SF+E+EKKQSKALK+S  LNNAACKLK+K+Y+E
Sbjct  424  NVWFKMGKYAKASKRYEKAAKYIEYDSSFNEDEKKQSKALKVSSKLNNAACKLKMKEYRE  483

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLELESTNVKALYRRAQAYI   D +LAE D+KKALEIDPDNR+VKL YK  K
Sbjct  484  AEKLCTKVLELESTNVKALYRRAQAYIELVDLELAELDVKKALEIDPDNRDVKLVYKTLK  543

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFS--SNKSAPQEAEAIDSKA  150
            E+++EYN++DA FYGNMFAK  K E       K  PQ   AIDS A
Sbjct  544  ERMREYNRRDAMFYGNMFAKWRKLEQLQKVPGKQEPQPM-AIDSAA  588



>ref|XP_004504385.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Cicer 
arietinum]
Length=571

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 161/186 (87%), Gaps = 8/186 (4%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGA-KFIEYDTSFSEEEKKQSKALKI  516
            +NTQEKIEAAGKKKEEGN LFKA K+ RAS RYEK A K+IEYD+SFS++EK+Q+KALKI
Sbjct  389  LNTQEKIEAAGKKKEEGNALFKASKHERASNRYEKVAIKYIEYDSSFSDKEKQQAKALKI  448

Query  515  SCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKA  336
            +CNLNNAACKLKLKDYK+AEKLCTKVLEL+S NVKALYRRAQA+IH  D DLAE DIKKA
Sbjct  449  TCNLNNAACKLKLKDYKQAEKLCTKVLELDSRNVKALYRRAQAHIHLVDLDLAEMDIKKA  508

Query  335  LEIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSS----NKSAPQEAE  168
            LEIDPDNR+VK+EYK+ K+KV+EYNKKDA+FYGN+FAKL+K E   +     +SAP    
Sbjct  509  LEIDPDNRDVKIEYKILKDKVREYNKKDAQFYGNIFAKLNKVEQARTAAAKQESAPM---  565

Query  167  AIDSKA  150
            A+DSKA
Sbjct  566  AVDSKA  571



>gb|KHN12365.1| Peptidyl-prolyl cis-trans isomerase FKBP65 [Glycine soja]
Length=570

 Score =   203 bits (517),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 159/183 (87%), Gaps = 3/183 (2%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            +NTQEKIEAAGKKKEEGN LFK GKY RASKRYEK  KF+EYD+SFS+EE++++KALKI+
Sbjct  389  LNTQEKIEAAGKKKEEGNALFKVGKYERASKRYEKAIKFVEYDSSFSDEERQKTKALKIT  448

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEK+CTKVLEL+S NVKALYRRAQ Y+H  D DLAE DIKKAL
Sbjct  449  CNLNNAACKLKLKDYKQAEKMCTKVLELDSRNVKALYRRAQGYLHLVDLDLAEMDIKKAL  508

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQE--AEAID  159
            EI+PDNR+VK+EYK+ K+KV+EYNKKDA+FYG++FAK++K E  +   +A QE     ID
Sbjct  509  EIEPDNRDVKMEYKILKQKVREYNKKDAQFYGSIFAKMNKLEQ-ARTATAKQEPVPMTID  567

Query  158  SKA  150
            S+A
Sbjct  568  SEA  570



>gb|EEC83911.1| hypothetical protein OsI_29964 [Oryza sativa Indica Group]
 gb|EEE69029.1| hypothetical protein OsJ_28006 [Oryza sativa Japonica Group]
Length=583

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 129/156 (83%), Gaps = 4/156 (3%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK GKY RASKRYEK AKFIEYD+SFSE+EKKQSK LK++CNLNNAACKLKLKDYK+
Sbjct  414  NALFKLGKYVRASKRYEKAAKFIEYDSSFSEDEKKQSKQLKVTCNLNNAACKLKLKDYKQ  473

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykv--  288
            AEKLCTKVLEL+S NVKALYRRAQAY+  AD +LAE DIKKALEIDPDNR+V        
Sbjct  474  AEKLCTKVLELDSQNVKALYRRAQAYMQLADLELAEVDIKKALEIDPDNRQVLDVKLTYK  533

Query  287  -xkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSA  183
              KEKVKEYNKKDAKFY NMFAK++K +P    K+ 
Sbjct  534  NLKEKVKEYNKKDAKFYSNMFAKMTK-QPAEDGKAG  568



>ref|NP_199668.1| peptidyl-prolyl cis-trans isomerase FKBP65 [Arabidopsis thaliana]
 sp|Q9FJL3.1|FKB65_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP65; Short=PPIase 
FKBP65; AltName: Full=70 kDa peptidyl-prolyl isomerase; 
AltName: Full=FK506-binding protein 65; Short=AtFKBP65; 
AltName: Full=Immunophilin FKBP65; AltName: Full=Peptidyl-prolyl 
isomerase ROF2; AltName: Full=Protein ROTAMASE FKBP 2; 
AltName: Full=Rotamase [Arabidopsis thaliana]
 dbj|BAB10690.1| peptidylprolyl isomerase [Arabidopsis thaliana]
 gb|AED95689.1| peptidyl-prolyl cis-trans isomerase FKBP65 [Arabidopsis thaliana]
Length=578

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 157/183 (86%), Gaps = 7/183 (4%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQE+IEAAGKKKEEGNVLFKAGKYARASKRYE+G K+IEYD++F EEEKK+SK LKI+
Sbjct  401  MNTQERIEAAGKKKEEGNVLFKAGKYARASKRYERGVKYIEYDSTFDEEEKKKSKDLKIA  460

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYKEA KL TKVLE++S NVKA+YRRA AY+  AD DLAE DIKKAL
Sbjct  461  CNLNDAACKLKLKDYKEAAKLSTKVLEMDSRNVKAMYRRAHAYLETADLDLAELDIKKAL  520

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA--ID  159
            EIDPDN+EVK+EYK  KEKVKEYNKKDAKFY NM +K+ +P     +K   +EA+A  ID
Sbjct  521  EIDPDNKEVKIEYKKLKEKVKEYNKKDAKFYSNMLSKMLEP-----HKGTQKEAQAMSID  575

Query  158  SKA  150
            +KA
Sbjct  576  TKA  578



>dbj|BAE99990.1| peptidylprolyl isomerase [Arabidopsis thaliana]
Length=578

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 157/183 (86%), Gaps = 7/183 (4%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQE+IEAAGKKKEEGNVLFKAGKYARASKRYE+G K+IEYD++F EEEKK+SK LKI+
Sbjct  401  MNTQERIEAAGKKKEEGNVLFKAGKYARASKRYERGVKYIEYDSTFDEEEKKKSKDLKIA  460

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYKEA KL TKVLE++S NVKA+YRRA AY+  AD DLAE DIKKAL
Sbjct  461  CNLNDAACKLKLKDYKEAAKLSTKVLEMDSRNVKAMYRRAHAYLETADLDLAELDIKKAL  520

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA--ID  159
            EIDPDN+EVK+EYK  KEKVKEYNKKDAKFY NM +K+ +P     +K   +EA+A  ID
Sbjct  521  EIDPDNKEVKIEYKKLKEKVKEYNKKDAKFYSNMLSKMLEP-----HKGTQKEAQAMSID  575

Query  158  SKA  150
            +KA
Sbjct  576  TKA  578



>gb|EMT24309.1| 70 kDa peptidyl-prolyl isomerase [Aegilops tauschii]
Length=611

 Score =   202 bits (515),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 123/155 (79%), Gaps = 11/155 (7%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK+GKYARASKRYEK AKFI+YDTSFSE+EKKQSK LKI+CNLNNAACKLKLKDYK+
Sbjct  409  NALFKSGKYARASKRYEKAAKFIDYDTSFSEDEKKQSKQLKITCNLNNAACKLKLKDYKQ  468

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLEL+S NVKALYRRAQAY   AD +LAE DIKKALEIDP+NR+V  +     
Sbjct  469  AEKLCTKVLELDSQNVKALYRRAQAYTQLADLELAEVDIKKALEIDPENRQVPQKVAASD  528

Query  281  ekvkey-----------nkKDAKFYGNMFAKLSKP  210
              VK             NKKDAKFY NMF+K++KP
Sbjct  529  RDVKLTYKTLKEKIKEINKKDAKFYSNMFSKMTKP  563



>ref|XP_010547132.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Tarenaya 
hassleriana]
Length=573

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 154/183 (84%), Gaps = 7/183 (4%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAG+KKEEGN LFKAGKY RASKRYEKG ++IEY++S  EEEKKQ+KALKIS
Sbjct  396  MNTQEKIEAAGRKKEEGNALFKAGKYDRASKRYEKGVRYIEYESSLGEEEKKQAKALKIS  455

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLK KDYK+  KLCTKVLE+E  NVKALYRRA+AYI  AD +LAE DIKKAL
Sbjct  456  CNLNNAACKLKQKDYKQVVKLCTKVLEMEGRNVKALYRRAEAYIETADLELAEIDIKKAL  515

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AID  159
            EIDPDN+EVK EYK  KEK KEYNKKDA+FY NM AK+ +P     +K+A +EA+  +ID
Sbjct  516  EIDPDNKEVKREYKKLKEKEKEYNKKDARFYSNMLAKMLEP-----HKTAKKEAQPMSID  570

Query  158  SKA  150
            +KA
Sbjct  571  AKA  573



>ref|XP_003579568.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Brachypodium 
distachyon]
Length=596

 Score =   202 bits (514),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 139/168 (83%), Gaps = 7/168 (4%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NV FK GKYA+ASKRY+K AK+IEYD+SF+E+EKKQSKALKI+  LNNAACKL+LK+YKE
Sbjct  432  NVWFKMGKYAKASKRYDKAAKYIEYDSSFTEDEKKQSKALKINIKLNNAACKLRLKEYKE  491

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLELESTNVKALYRRAQAY    D +LAE DIKKALEIDPDNR+VK+ YK  K
Sbjct  492  AEKLCTKVLELESTNVKALYRRAQAYTELVDLELAEMDIKKALEIDPDNRDVKMAYKALK  551

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAP--QEAE--AIDSKA  150
            +KVKEYNK+DAK YGNMFAK  K E   S +  P  QEA+  AIDS A
Sbjct  552  DKVKEYNKRDAKLYGNMFAKWRKVE---SAEKVPGKQEAQPMAIDSAA  596



>gb|KJB08782.1| hypothetical protein B456_001G103400 [Gossypium raimondii]
Length=516

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            +NTQEKIEAAGKKKEEGNVLFKAGKY RASKRYEK  K+I+YDTSFSEEEKKQSKALK++
Sbjct  390  LNTQEKIEAAGKKKEEGNVLFKAGKYVRASKRYEKAVKYIDYDTSFSEEEKKQSKALKVA  449

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYK+AEKLCTKVLELES NVKALYRRAQAYI+ AD DLAE DIKKAL
Sbjct  450  CNLNDAACKLKLKDYKQAEKLCTKVLELESANVKALYRRAQAYINLADLDLAELDIKKAL  509

Query  332  EIDPDNR  312
            E+DPDNR
Sbjct  510  ELDPDNR  516



>gb|ABK95085.1| unknown [Populus trichocarpa]
Length=608

 Score =   202 bits (514),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 150/173 (87%), Gaps = 2/173 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGN  FKAGKY RAS+RYEK AKFIEYD+SF++EEK+QSK LKIS
Sbjct  395  MNTQEKIEAAGKKKEEGNAWFKAGKYERASRRYEKAAKFIEYDSSFTDEEKQQSKVLKIS  454

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            C LNNAACKLKLKDYKEAEKLC+KVLEL+  NVKALYRRAQAYI   D DLAE DIK+AL
Sbjct  455  CKLNNAACKLKLKDYKEAEKLCSKVLELDGQNVKALYRRAQAYIQLVDLDLAEIDIKRAL  514

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSS--NKSAP  180
            EIDPDNR+VKLE K+ K+KV+EYNKK+A+FY N+FAK++K E  +S  N+  P
Sbjct  515  EIDPDNRDVKLENKILKDKVREYNKKEAQFYSNIFAKMNKLEQTNSTVNRQNP  567



>ref|XP_004975323.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Setaria 
italica]
Length=709

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N  FK GKYA+ASKRYEK AK+IEYD+SFSE+EKKQSKALKISC LNNAACKLKLK+Y+E
Sbjct  428  NAWFKMGKYAKASKRYEKAAKYIEYDSSFSEDEKKQSKALKISCKLNNAACKLKLKEYRE  487

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLELESTNVKALYRRAQAYI   D +LAE D+KKALE DPDNR+VKL YK  K
Sbjct  488  AEKLCTKVLELESTNVKALYRRAQAYIELVDLELAELDVKKALEFDPDNRDVKLVYKTLK  547

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSA  183
            EK++EYN++DAKFYGNMFAK  K E   +  S 
Sbjct  548  EKMREYNRRDAKFYGNMFAKWRKLEHMDTKVST  580



>ref|XP_006375512.1| hypothetical protein POPTR_0014s14690g [Populus trichocarpa]
 gb|ERP53309.1| hypothetical protein POPTR_0014s14690g [Populus trichocarpa]
Length=608

 Score =   202 bits (513),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 150/173 (87%), Gaps = 2/173 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGN  FKAGKY RAS+RYEK AKFIEYD+SF++EEK+QSK LKIS
Sbjct  395  MNTQEKIEAAGKKKEEGNAWFKAGKYERASRRYEKAAKFIEYDSSFTDEEKQQSKVLKIS  454

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            C LNNAACKLKLKDYKEAEKLC+KVLEL+  NVKALYRRAQAYI   D DLAE DIK+AL
Sbjct  455  CKLNNAACKLKLKDYKEAEKLCSKVLELDGKNVKALYRRAQAYIQLVDLDLAEIDIKRAL  514

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSS--NKSAP  180
            EIDPDNR+VKLE K+ K+KV+EYNKK+A+FY N+FAK++K E  +S  N+  P
Sbjct  515  EIDPDNRDVKLENKILKDKVREYNKKEAQFYSNIFAKMNKLEQTNSTVNRQNP  567



>ref|XP_003532733.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Glycine max]
Length=570

 Score =   201 bits (511),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 158/183 (86%), Gaps = 3/183 (2%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            +NTQEKIEAAGKKKEEGN LFK GKY RASKRYEK  KF+EYD+SFS+EEK+++KALKI+
Sbjct  389  LNTQEKIEAAGKKKEEGNALFKVGKYERASKRYEKAIKFVEYDSSFSDEEKQKTKALKIT  448

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+AEK+CTKVLEL+S NVKALYRRAQ Y+H  D DLAE DIKKAL
Sbjct  449  CNLNNAACKLKLKDYKQAEKMCTKVLELDSRNVKALYRRAQGYLHLVDLDLAEMDIKKAL  508

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQE--AEAID  159
            EI+PDNR+VK+EYK+ K+KV+EYNKKDA+FY ++FAK++K E  +   +A QE     ID
Sbjct  509  EIEPDNRDVKMEYKILKQKVREYNKKDAQFYSSIFAKMNKLEQ-ARTATAKQEPVPMTID  567

Query  158  SKA  150
            S+A
Sbjct  568  SEA  570



>ref|XP_002436973.1| hypothetical protein SORBIDRAFT_10g012970 [Sorghum bicolor]
 gb|EER88340.1| hypothetical protein SORBIDRAFT_10g012970 [Sorghum bicolor]
Length=592

 Score =   201 bits (512),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 137/168 (82%), Gaps = 7/168 (4%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NV FK GKYA+ASKRYEK AK+IEYD SFSE+EKKQSK+LKIS  LNNAACKLKLK+Y+E
Sbjct  428  NVWFKMGKYAKASKRYEKAAKYIEYDNSFSEDEKKQSKSLKISSKLNNAACKLKLKEYRE  487

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVL+LEST+VKALYRRAQAYI   D +LAE D+KKALEIDPDNR+VKL YK  K
Sbjct  488  AEKLCTKVLDLESTSVKALYRRAQAYIELVDLELAELDVKKALEIDPDNRDVKLVYKTLK  547

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE----AIDSKA  150
            E+++EYN++DAKFYGNMFAK  K E     +  P + E    AIDS A
Sbjct  548  ERMREYNRRDAKFYGNMFAKWRKLEQL---QKVPGKQELQPMAIDSAA  592



>ref|XP_004247908.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Solanum lycopersicum]
Length=581

 Score =   201 bits (511),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 157/183 (86%), Gaps = 5/183 (3%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            M+TQEKIEAAGKKKEEGNVLFKAGKY RASKRYEK   FIEY++SFS++EK+Q+K LK++
Sbjct  402  MSTQEKIEAAGKKKEEGNVLFKAGKYVRASKRYEKAVSFIEYESSFSDDEKQQAKLLKVT  461

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
             NLNNAACKLKLK+YKEA KLC+KVLE++S NVKALYRRAQAYI   D DLAE DIKKAL
Sbjct  462  SNLNNAACKLKLKEYKEAAKLCSKVLEIDSKNVKALYRRAQAYIQLVDLDLAELDIKKAL  521

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSS--NKSAPQEAEAID  159
            EIDPDNR+VKLEYKV KEK+KEYNKKDA+FYGN+FAK++K E      N++AP     ID
Sbjct  522  EIDPDNRDVKLEYKVLKEKIKEYNKKDAQFYGNIFAKMNKLEQSGGAKNEAAPM---TID  578

Query  158  SKA  150
            SKA
Sbjct  579  SKA  581



>gb|ABK24451.1| unknown [Picea sitchensis]
Length=578

 Score =   201 bits (511),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK GKY RASK+Y+K AK+IEYDTSFSEEEKKQSK LKI+CNLNNAACKLKLKDY +
Sbjct  403  NALFKVGKYFRASKKYKKAAKYIEYDTSFSEEEKKQSKPLKITCNLNNAACKLKLKDYTQ  462

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVLE+ES NVKALYRRAQ+YI  AD +LAE DIKKALEIDP+NR+VKLEY+  K
Sbjct  463  AEKLCTKVLEIESQNVKALYRRAQSYIQTADLELAEIDIKKALEIDPNNRDVKLEYRALK  522

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAID  159
            EK KEYNKK+AKFYGNMFA++SK E   S KS  Q+ E +D
Sbjct  523  EKQKEYNKKEAKFYGNMFARMSKLEELESRKSGSQKVETVD  563



>ref|XP_011000005.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Populus euphratica]
Length=608

 Score =   201 bits (512),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGN  FKAGKY RAS+RYEK AKFIEYD+SF++EEK+QSK LKIS
Sbjct  395  MNTQEKIEAAGKKKEEGNAWFKAGKYERASRRYEKAAKFIEYDSSFTDEEKQQSKVLKIS  454

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            C LNNAACKLKLKDYKEAEKLC+KVLEL+  NVKALYRRAQAYI   D DLAE DIK+AL
Sbjct  455  CKLNNAACKLKLKDYKEAEKLCSKVLELDGQNVKALYRRAQAYIQLVDLDLAEIDIKRAL  514

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSN  192
            EIDPDNR+VKLEYK+ K+KV+EY KK+A+FY N+FAK++K E  +S 
Sbjct  515  EIDPDNRDVKLEYKILKDKVREYKKKEAQFYSNIFAKMNKLEQTNST  561



>ref|XP_003552100.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Glycine 
max]
Length=544

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            +NT+EK+EAAGKKKEEGNVLFKA KYARASKRYEK  K+IEYD+SF EEEKKQ+K LK++
Sbjct  382  LNTEEKLEAAGKKKEEGNVLFKASKYARASKRYEKAVKYIEYDSSFGEEEKKQAKTLKVA  441

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYKEAEKLCTKVL+LESTNVKALYRRAQA++   + DLAE DIKKAL
Sbjct  442  CNLNNAACKLKLKDYKEAEKLCTKVLDLESTNVKALYRRAQAHMQLTNLDLAELDIKKAL  501

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK  213
            +IDP+NR+VKLEY+  KEKVKE N+K+A+FYGNM  K++K
Sbjct  502  DIDPNNRDVKLEYRTLKEKVKENNRKEAQFYGNMINKMTK  541



>ref|XP_007140683.1| hypothetical protein PHAVU_008G133100g [Phaseolus vulgaris]
 ref|XP_007140684.1| hypothetical protein PHAVU_008G133100g [Phaseolus vulgaris]
 gb|ESW12677.1| hypothetical protein PHAVU_008G133100g [Phaseolus vulgaris]
 gb|ESW12678.1| hypothetical protein PHAVU_008G133100g [Phaseolus vulgaris]
Length=544

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            +NT+EK+EAAGKKKEEGNVLFKAGKY RASKRYEK  K IEYD+SF EEEKK +K LK++
Sbjct  382  LNTEEKLEAAGKKKEEGNVLFKAGKYVRASKRYEKAVKHIEYDSSFGEEEKKLAKTLKVA  441

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYKEAEKL TKVL+LESTNVKALYRRAQAY+   DFDLAE D+KKAL
Sbjct  442  CNLNNAACKLKLKDYKEAEKLSTKVLDLESTNVKALYRRAQAYMQLTDFDLAELDLKKAL  501

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK  213
            EIDP+NR++KLEYK  +EKVKE N+K+A+FYGNM  KL+K
Sbjct  502  EIDPNNRDLKLEYKTLREKVKENNRKEAQFYGNMINKLTK  541



>gb|AFK48238.1| unknown [Lotus japonicus]
Length=547

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            +NTQEKIEAAGKKKEEGNVLFKAGKYARASKRY+K  K++EYDTSFSEEEKKQSK LK++
Sbjct  385  LNTQEKIEAAGKKKEEGNVLFKAGKYARASKRYDKAVKYVEYDTSFSEEEKKQSKTLKVA  444

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKL D+ EAEKLCT+VL LESTNVKALYRRA+A +  AD DLAE DIKKA 
Sbjct  445  CNLNNAACKLKLNDFIEAEKLCTRVLNLESTNVKALYRRAEALMQLADLDLAELDIKKAF  504

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK  213
            E+DPDNREVKL+YK  KEKVKE+NKK+A+FYGNM  K +K
Sbjct  505  EVDPDNREVKLQYKTLKEKVKEFNKKEARFYGNMLNKFTK  544



>tpg|DAA48154.1| TPA: hypothetical protein ZEAMMB73_593378 [Zea mays]
Length=239

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 125/170 (74%), Gaps = 27/170 (16%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK+GKYARASKRYEK AK+IEYDTSFSE+EKKQSK LKISCNLNNAACKLKLKDYKE
Sbjct  70   NALFKSGKYARASKRYEKAAKYIEYDTSFSEDEKKQSKQLKISCNLNNAACKLKLKDYKE  129

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkley----  294
            A KLCTKVLEL+S NVKALYRR QAYI  AD +LAE DIKKALEIDPDNR          
Sbjct  130  AAKLCTKVLELDSQNVKALYRRVQAYIQLADLELAEADIKKALEIDPDNRYSLGNGFCKA  189

Query  293  -----------------------kvxkekvkeynkKDAKFYGNMFAKLSK  213
                                   K+ KEK+KEYNKKDAKFY NMFAK++K
Sbjct  190  GSTLITYHADNFGNNPRDVKLEYKILKEKIKEYNKKDAKFYSNMFAKMTK  239



>ref|XP_003547780.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Glycine 
max]
Length=574

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 144/166 (87%), Gaps = 2/166 (1%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFKAGKYARASKRYEK  KFIEYDT+FSEEEKK SK+LK++CNLNNAACKLKLKDYK+
Sbjct  409  NALFKAGKYARASKRYEKAVKFIEYDTAFSEEEKKSSKSLKVACNLNNAACKLKLKDYKQ  468

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AEKLCTKVL+LESTNVKALYRR QAYI  AD DLAEFDIKKALE++P+NR+VKLEY   K
Sbjct  469  AEKLCTKVLDLESTNVKALYRRTQAYIQLADLDLAEFDIKKALELEPNNRDVKLEYVTLK  528

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA--IDSKA  150
            EK+KEYNKK+AKFYGNMF KL K +   ++K A ++A+   IDSK+
Sbjct  529  EKMKEYNKKEAKFYGNMFNKLHKLDSLDNSKPASKDAQPINIDSKS  574



>ref|XP_002865651.1| hypothetical protein ARALYDRAFT_494919 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41910.1| hypothetical protein ARALYDRAFT_494919 [Arabidopsis lyrata subsp. 
lyrata]
Length=570

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 154/181 (85%), Gaps = 9/181 (5%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGN+LFKAGKYARASKRYE+G K+IEYD++F EEEKK+++ LKI+
Sbjct  399  MNTQEKIEAAGKKKEEGNMLFKAGKYARASKRYERGVKYIEYDSTFDEEEKKKARDLKIA  458

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKDYKEA KL TKVLE++S NVKA+YRRA AY+  AD DLAE DIKKAL
Sbjct  459  CNLNDAACKLKLKDYKEAAKLSTKVLEMDSRNVKAMYRRAHAYMETADLDLAELDIKKAL  518

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDSK  153
            EIDPDN+EVK+EYK  KEKVKEYNKKDAKFYGNM +K+ +P          + A +ID+K
Sbjct  519  EIDPDNKEVKIEYKKLKEKVKEYNKKDAKFYGNMLSKMLEPH---------KGAMSIDTK  569

Query  152  A  150
            A
Sbjct  570  A  570



>ref|XP_006395163.1| hypothetical protein EUTSA_v10003906mg [Eutrema salsugineum]
 gb|ESQ32449.1| hypothetical protein EUTSA_v10003906mg [Eutrema salsugineum]
Length=573

 Score =   198 bits (504),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 155/183 (85%), Gaps = 7/183 (4%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGN LFKAGKY RASKRY++G ++IEYD++F EEEKK+++ALKIS
Sbjct  396  MNTQEKIEAAGKKKEEGNALFKAGKYTRASKRYKRGVEYIEYDSTFDEEEKKKAQALKIS  455

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYKEA K  TKVLE++  NVKALYRRA AY+  AD DLAE DIKKAL
Sbjct  456  CNLNNAACKLKLKDYKEAAKFSTKVLEMDGGNVKALYRRAHAYMEMADLDLAELDIKKAL  515

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA--ID  159
            EIDPDN+EVK+EYK  KEKVKEYNKKDAKFY NM AK+ +P     +K A +EA+A  ID
Sbjct  516  EIDPDNKEVKMEYKKLKEKVKEYNKKDAKFYSNMLAKMLEP-----HKEARKEAQAMSID  570

Query  158  SKA  150
            +KA
Sbjct  571  TKA  573



>ref|XP_004296967.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Fragaria 
vesca subsp. vesca]
Length=566

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 153/181 (85%), Gaps = 9/181 (5%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGN LFKA KY RASKRYEK  ++IEYD+SFS++EK+Q++ LKI+
Sbjct  395  MNTQEKIEAAGKKKEEGNALFKAAKYERASKRYEKAVRYIEYDSSFSDDEKQQARVLKIT  454

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLK YKEAEKLCTKVLEL+S NVKALYRRAQAYI   D DLAE DIKKAL
Sbjct  455  CNLNDAACKLKLKKYKEAEKLCTKVLELDSRNVKALYRRAQAYIQLVDLDLAEQDIKKAL  514

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDSK  153
            EI+P+N++VKLEYK+ KEKV+EYNKKDA+FYGN+FAK+SK +P             IDSK
Sbjct  515  EIEPNNKDVKLEYKLLKEKVREYNKKDAQFYGNIFAKMSKHDPVPMT---------IDSK  565

Query  152  A  150
            A
Sbjct  566  A  566



>ref|XP_010023594.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW59903.1| hypothetical protein EUGRSUZ_H02629 [Eucalyptus grandis]
Length=587

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 153/184 (83%), Gaps = 3/184 (2%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MN QEKIEAA +KKEEGN  FKAGKY RASKRYEK  +FIEYD+SFS+EEK+Q+K LK +
Sbjct  404  MNNQEKIEAAARKKEEGNAAFKAGKYVRASKRYEKAVRFIEYDSSFSDEEKQQAKTLKNT  463

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKD+KEAEKLCTKVLE +  NVKALYRRAQAYI   D DLAE DIKKAL
Sbjct  464  CNLNDAACKLKLKDFKEAEKLCTKVLEGDGKNVKALYRRAQAYIQLVDLDLAEQDIKKAL  523

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPE-PFSSNKSAPQEAE--AI  162
            EIDP+NR+VKLEYK+ KEKV+EYNK+DA+FYGNMFAK++K E   ++   A  EA    I
Sbjct  524  EIDPNNRDVKLEYKILKEKVREYNKRDAQFYGNMFAKMNKLEHSRTAGMGAKHEAAPMTI  583

Query  161  DSKA  150
            DSKA
Sbjct  584  DSKA  587



>ref|XP_002453845.1| hypothetical protein SORBIDRAFT_04g019590 [Sorghum bicolor]
 gb|EES06821.1| hypothetical protein SORBIDRAFT_04g019590 [Sorghum bicolor]
Length=685

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NV FK GKYARASKRYEK   FIEYD+SFSEEEK+ SK LKISC LNNAACKL+L DYKE
Sbjct  467  NVWFKVGKYARASKRYEKALSFIEYDSSFSEEEKQLSKPLKISCKLNNAACKLRLNDYKE  526

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A++LCT+VLE +STNVKALYRRAQA++H  D DLAE DIKKALEIDPDNR+VK+ Y+  K
Sbjct  527  AKELCTEVLESDSTNVKALYRRAQAHMHLVDLDLAEADIKKALEIDPDNRDVKMGYRRLK  586

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQ  177
            EKVKEY ++DAK YGNM +KLSK E    N    Q
Sbjct  587  EKVKEYKRRDAKLYGNMISKLSKLEDTEDNDQMSQ  621



>ref|XP_004952509.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Setaria italica]
Length=676

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NV FK GKYARASKRY+K   F+EYD+SFSEEEK+ SK LKISC LNNAACKLKLKDYKE
Sbjct  459  NVWFKVGKYARASKRYKKALSFVEYDSSFSEEEKQLSKPLKISCKLNNAACKLKLKDYKE  518

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A++LCT+VLEL+ TNVKALYRRAQA+ H  D DLAE DIKKALEIDPDNR+VK+ Y+  K
Sbjct  519  AKELCTEVLELDCTNVKALYRRAQAHTHLVDLDLAEADIKKALEIDPDNRDVKMGYRRLK  578

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSN  192
            E VKEY ++DAK YGNM +KLSK E    N
Sbjct  579  ETVKEYKRRDAKLYGNMISKLSKVEDTEGN  608



>gb|KEH22557.1| FKBP-type peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=544

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGNVLFKAGKY RASKRY+K AK+IEYD+SFSEEEKK SK LKI+
Sbjct  385  MNTQEKIEAAGKKKEEGNVLFKAGKYERASKRYDKAAKYIEYDSSFSEEEKKLSKTLKIA  444

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
              LNNAACKLKLK+YK+AEKLCTKVL++ESTNVKALYRRAQA +   D DLAE DIKKAL
Sbjct  445  SYLNNAACKLKLKEYKDAEKLCTKVLDIESTNVKALYRRAQASMQLTDLDLAEIDIKKAL  504

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFA  225
            E+DPDNREVKLEYK  K+ VKEYN K AKFYGNMF 
Sbjct  505  EVDPDNREVKLEYKNLKQMVKEYNNKQAKFYGNMFG  540



>ref|XP_004492269.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Cicer arietinum]
 ref|XP_004492270.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Cicer arietinum]
Length=545

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 142/160 (89%), Gaps = 1/160 (1%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGNVLFKAGKYARASKRYEK  K+IEYD+SFSEEEKK SK LK++
Sbjct  386  MNTQEKIEAAGKKKEEGNVLFKAGKYARASKRYEKAVKYIEYDSSFSEEEKKVSKTLKLA  445

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
              LNNAAC LKLK+YK+AEKLCTKVL++ESTNVKALYRRAQA +   D DLAE DIKKAL
Sbjct  446  SYLNNAACNLKLKEYKDAEKLCTKVLDIESTNVKALYRRAQASMQLGDLDLAEIDIKKAL  505

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK  213
            E+DPDNREVKLEY+  KE VKEYNKK AKFYGNMF KL+K
Sbjct  506  EVDPDNREVKLEYRTLKEMVKEYNKKQAKFYGNMF-KLTK  544



>gb|KHF97531.1| Peptidyl-prolyl cis-trans isomerase FKBP65 -like protein [Gossypium 
arboreum]
Length=567

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 153/181 (85%), Gaps = 5/181 (3%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            M+T +KIEAAGKKKEEGN LFKAGK+ RASKRYEK   FIEYD+SF++EEKKQ+K LK++
Sbjct  392  MDTPQKIEAAGKKKEEGNALFKAGKFERASKRYEKAVSFIEYDSSFNDEEKKQAKLLKVN  451

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAA KLKLKDYK+A KLCTKVLEL+S NVKALYRRAQAYI   D DLAE DIKKAL
Sbjct  452  CNLNNAASKLKLKDYKQAAKLCTKVLELDSGNVKALYRRAQAYIQLVDLDLAEADIKKAL  511

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDSK  153
            EIDPDNR+VKLEY+V KEK+KEYNK+DA+FY N+FAK++K       ++AP    AIDSK
Sbjct  512  EIDPDNRDVKLEYRVLKEKIKEYNKRDAQFYSNIFAKMNKSA--GKREAAPM---AIDSK  566

Query  152  A  150
            A
Sbjct  567  A  567



>ref|XP_007034165.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 4 [Theobroma cacao]
 gb|EOY05091.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 4 [Theobroma cacao]
Length=533

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGN L+KAGKY RASKRYEK  KFIEYD+SFS+EEK+Q+K LKI+
Sbjct  395  MNTQEKIEAAGKKKEEGNALYKAGKYERASKRYEKAVKFIEYDSSFSDEEKQQTKLLKIT  454

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYKEAEKLCTKVLEL++ NVKALYRRAQAYI   D DLAE DIKKAL
Sbjct  455  CNLNNAACKLKLKDYKEAEKLCTKVLELDNKNVKALYRRAQAYIQIVDLDLAEVDIKKAL  514

Query  332  EIDPDNR  312
            EIDPDNR
Sbjct  515  EIDPDNR  521



>ref|XP_010023593.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW59904.1| hypothetical protein EUGRSUZ_H02629 [Eucalyptus grandis]
Length=617

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MN QEKIEAA +KKEEGN  FKAGKY RASKRYEK  +FIEYD+SFS+EEK+Q+K LK +
Sbjct  404  MNNQEKIEAAARKKEEGNAAFKAGKYVRASKRYEKAVRFIEYDSSFSDEEKQQAKTLKNT  463

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLN+AACKLKLKD+KEAEKLCTKVLE +  NVKALYRRAQAYI   D DLAE DIKKAL
Sbjct  464  CNLNDAACKLKLKDFKEAEKLCTKVLEGDGKNVKALYRRAQAYIQLVDLDLAEQDIKKAL  523

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPE  207
            EIDP+NR+VKLEYK+ KEKV+EYNK+DA+FYGNMFAK++K E
Sbjct  524  EIDPNNRDVKLEYKILKEKVREYNKRDAQFYGNMFAKMNKLE  565



>gb|KJB37904.1| hypothetical protein B456_006G225400 [Gossypium raimondii]
Length=559

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 153/181 (85%), Gaps = 5/181 (3%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            M+T +KIEAAGKKKEEGN LFKAGK+ RASKRYEK   FIEYD+SF++EEKKQ+K LK++
Sbjct  384  MDTPQKIEAAGKKKEEGNALFKAGKFERASKRYEKAVSFIEYDSSFNDEEKKQAKLLKVN  443

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAA KLKLKDYK+A KLCTKVLEL+S NVKALYRRAQAYI   D DLAE DIKKAL
Sbjct  444  CNLNNAASKLKLKDYKQAAKLCTKVLELDSGNVKALYRRAQAYIQLVDLDLAEADIKKAL  503

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDSK  153
            EIDPDNR+VKLEY+V KEK+KEYNK+DA+FY N+FAK++K       ++AP    AIDSK
Sbjct  504  EIDPDNRDVKLEYRVLKEKIKEYNKRDAQFYSNIFAKMNKLA--GKQEAAPM---AIDSK  558

Query  152  A  150
            A
Sbjct  559  A  559



>gb|KHN03897.1| Peptidyl-prolyl cis-trans isomerase FKBP62, partial [Glycine 
soja]
Length=136

 Score =   181 bits (460),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            +NT+EK++AAGKKKEEGNVLFKAGK+ARASKRYEK  K+IEYD+ F EEEKKQ+K LK+S
Sbjct  1    LNTEEKLKAAGKKKEEGNVLFKAGKHARASKRYEKVVKYIEYDSLFGEEEKKQAKTLKVS  60

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYKEAEKLCTKVL++EST+VKALYRRAQAY+   D DL E DI K L
Sbjct  61   CNLNNAACKLKLKDYKEAEKLCTKVLDIESTSVKALYRRAQAYMQLTDLDLTELDINKTL  120

Query  332  EIDPDNR  312
            EIDP+NR
Sbjct  121  EIDPNNR  127



>gb|KJB37901.1| hypothetical protein B456_006G225400 [Gossypium raimondii]
Length=567

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 153/181 (85%), Gaps = 5/181 (3%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            M+T +KIEAAGKKKEEGN LFKAGK+ RASKRYEK   FIEYD+SF++EEKKQ+K LK++
Sbjct  392  MDTPQKIEAAGKKKEEGNALFKAGKFERASKRYEKAVSFIEYDSSFNDEEKKQAKLLKVN  451

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAA KLKLKDYK+A KLCTKVLEL+S NVKALYRRAQAYI   D DLAE DIKKAL
Sbjct  452  CNLNNAASKLKLKDYKQAAKLCTKVLELDSGNVKALYRRAQAYIQLVDLDLAEADIKKAL  511

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDSK  153
            EIDPDNR+VKLEY+V KEK+KEYNK+DA+FY N+FAK++K       ++AP    AIDSK
Sbjct  512  EIDPDNRDVKLEYRVLKEKIKEYNKRDAQFYSNIFAKMNKLA--GKQEAAPM---AIDSK  566

Query  152  A  150
            A
Sbjct  567  A  567



>ref|XP_011084142.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Sesamum 
indicum]
Length=650

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNT+EKI AAGKKKEEGNV FKAGKY RASKRYEK  +FIE+D++F+EEEK+++K LK+S
Sbjct  399  MNTEEKIAAAGKKKEEGNVWFKAGKYKRASKRYEKAVRFIEFDSNFNEEEKEKAKVLKVS  458

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYKEAEKLCTKVLE++  NVKALYRRAQAY++  + +LAE DIKKAL
Sbjct  459  CNLNNAACKLKLKDYKEAEKLCTKVLEIDGKNVKALYRRAQAYLNLVELELAEKDIKKAL  518

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPE  207
            EIDPDNR+VKLEYK+ KEKVKEYNKKDA+FYG++FAK++K E
Sbjct  519  EIDPDNRDVKLEYKILKEKVKEYNKKDAQFYGSIFAKMNKLE  560



>gb|AFW71473.2| peptidyl-prolyl isomerase [Zea mays]
Length=619

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NV FK GKYARASKRYEK   F+EYD+SF+EEEK+ SK L+ISC LNNAACKL+L DYKE
Sbjct  401  NVWFKIGKYARASKRYEKALSFVEYDSSFTEEEKQLSKPLQISCKLNNAACKLRLNDYKE  460

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A++LCT+VLE ++TNVKALYRRAQA++H  D DLAE DIKKALEIDPDNR+VK+ YK  K
Sbjct  461  AKELCTEVLESDNTNVKALYRRAQAHMHLVDLDLAEADIKKALEIDPDNRDVKMGYKRLK  520

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQ  177
            EKVKEY ++DAK YGNM +KLSK E    N    Q
Sbjct  521  EKVKEYKRRDAKLYGNMISKLSKLEDTEDNGQMSQ  555



>ref|XP_002977259.1| hypothetical protein SELMODRAFT_443450 [Selaginella moellendorffii]
 gb|EFJ21868.1| hypothetical protein SELMODRAFT_443450 [Selaginella moellendorffii]
Length=567

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 130/156 (83%), Gaps = 0/156 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NVL+KAGK+ARASK+YE+  KFI+YD++FS++EKKQ+KALK+SCNLNNAA KLKL ++K+
Sbjct  395  NVLYKAGKFARASKKYEQALKFIDYDSNFSDDEKKQAKALKVSCNLNNAASKLKLNEFKD  454

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A K C+KVLELES NVKALYRRAQAY   AD DLAEFDIKKALEIDP NR++++EYK  K
Sbjct  455  AIKCCSKVLELESQNVKALYRRAQAYTRTADLDLAEFDIKKALEIDPQNRDLRMEYKSLK  514

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQE  174
            +K  EYNKK+AK YGNMFA+LSK E       AP +
Sbjct  515  QKQVEYNKKEAKLYGNMFARLSKLEALEQKSEAPMD  550



>emb|CDX86295.1| BnaA06g30120D [Brassica napus]
Length=573

 Score =   191 bits (485),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 159/183 (87%), Gaps = 7/183 (4%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGN LFKAGKYARASKRYE+G KFIEYD+SF EE+KK++KALK++
Sbjct  396  MNTQEKIEAAGKKKEEGNTLFKAGKYARASKRYERGVKFIEYDSSFDEEDKKKAKALKVA  455

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYKEA KL TKVLE++ +NVKA+YRRAQAY+  AD DLAE DIKKAL
Sbjct  456  CNLNNAACKLKLKDYKEAAKLATKVLEMDGSNVKAMYRRAQAYMETADLDLAELDIKKAL  515

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA--ID  159
            EIDPDN+EVK+EYK  KEKV+EYNKKDAKFY NM AK+ +P     +K A ++A+A  ID
Sbjct  516  EIDPDNKEVKIEYKKLKEKVREYNKKDAKFYSNMLAKMLEP-----HKEARKDAQAMSID  570

Query  158  SKA  150
            +KA
Sbjct  571  AKA  573



>ref|NP_001151484.1| LOC100285117 [Zea mays]
 gb|ACG43033.1| peptidyl-prolyl isomerase [Zea mays]
Length=677

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NV FK GKYARASKRYEK   F+EYD+SF+EEEK+ SK L+ISC LNNAACKL+L DYKE
Sbjct  459  NVWFKIGKYARASKRYEKALSFVEYDSSFTEEEKQLSKPLQISCKLNNAACKLRLNDYKE  518

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A++LCT+VLE ++TNVKALYRRAQA++H  D DLAE DIKKALEIDPDNR+VK+ YK  K
Sbjct  519  AKELCTEVLESDNTNVKALYRRAQAHMHLVDLDLAEADIKKALEIDPDNRDVKMGYKRLK  578

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQ  177
            EKVKEY ++DAK YGNM +KLSK E    N    Q
Sbjct  579  EKVKEYKRRDAKLYGNMISKLSKLEDTEDNGQMSQ  613



>gb|ACN30883.1| unknown [Zea mays]
Length=677

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NV FK GKYARASKRYEK   F+EYD+SF+EEEK+ SK L+ISC LNNAACKL+L DYKE
Sbjct  459  NVWFKIGKYARASKRYEKALSFVEYDSSFTEEEKQLSKPLQISCKLNNAACKLRLNDYKE  518

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A++LCT+VLE ++TNVKALYRRAQA++H  D DLAE DIKKALEIDPDNR+VK+ YK  K
Sbjct  519  AKELCTEVLESDNTNVKALYRRAQAHMHLVDLDLAEADIKKALEIDPDNRDVKMGYKRLK  578

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQ  177
            EKVKEY ++DAK YGNM +KLSK E    N    Q
Sbjct  579  EKVKEYKRRDAKLYGNMISKLSKLEDTEDNGQMSQ  613



>ref|XP_009151655.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65 [Brassica 
rapa]
Length=573

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 158/183 (86%), Gaps = 7/183 (4%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGN LFKAGKYARASKRYE+G KFIEYD+SF EE+KK++KALKI+
Sbjct  396  MNTQEKIEAAGKKKEEGNTLFKAGKYARASKRYERGVKFIEYDSSFDEEDKKKAKALKIA  455

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYKEA KL TKVLE++ +NVKA+YRRAQAY+  AD DLAE DIKK L
Sbjct  456  CNLNNAACKLKLKDYKEAAKLSTKVLEMDGSNVKAMYRRAQAYMETADLDLAELDIKKVL  515

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA--ID  159
            EIDPDN+EVK+EYK  KEKV+EYNKKDAKFY NM AK+ +P     +K A ++A+A  ID
Sbjct  516  EIDPDNKEVKMEYKKLKEKVREYNKKDAKFYSNMLAKMLEP-----HKEARKDAQAMSID  570

Query  158  SKA  150
            +KA
Sbjct  571  AKA  573



>gb|KJB37905.1| hypothetical protein B456_006G225400 [Gossypium raimondii]
Length=568

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 153/182 (84%), Gaps = 6/182 (3%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            M+T +KIEAAGKKKEEGN LFKAGK+ RASKRYEK   FIEYD+SF++EEKKQ+K LK++
Sbjct  392  MDTPQKIEAAGKKKEEGNALFKAGKFERASKRYEKAVSFIEYDSSFNDEEKKQAKLLKVN  451

Query  512  CNLNNAACKLKLKDYKEAEKLCTK-VLELESTNVKALYRRAQAYIHFADFDLAEFDIKKA  336
            CNLNNAA KLKLKDYK+A KLCTK VLEL+S NVKALYRRAQAYI   D DLAE DIKKA
Sbjct  452  CNLNNAASKLKLKDYKQAAKLCTKVVLELDSGNVKALYRRAQAYIQLVDLDLAEADIKKA  511

Query  335  LEIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDS  156
            LEIDPDNR+VKLEY+V KEK+KEYNK+DA+FY N+FAK++K       ++AP    AIDS
Sbjct  512  LEIDPDNRDVKLEYRVLKEKIKEYNKRDAQFYSNIFAKMNKLA--GKQEAAPM---AIDS  566

Query  155  KA  150
            KA
Sbjct  567  KA  568



>gb|EMT19050.1| 70 kDa peptidyl-prolyl isomerase [Aegilops tauschii]
Length=676

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NV FK GKYARASKRY K   FIEY++SF+EEEK+ SK LK+SC LN AACKLKLKDYKE
Sbjct  466  NVWFKMGKYARASKRYGKALDFIEYESSFNEEEKQLSKPLKVSCKLNKAACKLKLKDYKE  525

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A+ LCT+VLE++STNVKALYRRAQA++H  DFDLAE DIK+ALEIDP+NR+VK+ Y+  K
Sbjct  526  AKNLCTEVLEIDSTNVKALYRRAQAHMHLVDFDLAEVDIKRALEIDPENRDVKMGYRRLK  585

Query  281  ekvkeynkKDAKFYGNMFAKLSKPE  207
            EKVKEY ++DAKFYGNM  KLSK E
Sbjct  586  EKVKEYERRDAKFYGNMINKLSKLE  610



>gb|KJB28026.1| hypothetical protein B456_005G022600, partial [Gossypium raimondii]
Length=493

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 132/167 (79%), Gaps = 7/167 (4%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NVLF AG   RASKRYEK  ++IE+D SF+ EE++QSK LK++CNLNNAAC+LKLKDYK+
Sbjct  331  NVLFTAGNIERASKRYEKAVRYIEHDYSFNHEEQQQSKLLKVTCNLNNAACQLKLKDYKQ  390

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            AE+LCTKVLELES NVKALYRRAQAYI   D DLAE  IKKALEIDP NRE+K+ Y+V K
Sbjct  391  AEELCTKVLELESRNVKALYRRAQAYIQLVDLDLAEAGIKKALEIDPGNRELKVGYRVLK  450

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA---IDSKA  150
            +K++EYNKKDA+FYGN+FAK++         +A QE      IDSKA
Sbjct  451  QKMREYNKKDAQFYGNIFAKMN----LQQANAAKQEQRTPMIIDSKA  493



>ref|XP_002992143.1| hypothetical protein SELMODRAFT_134839 [Selaginella moellendorffii]
 gb|EFJ06798.1| hypothetical protein SELMODRAFT_134839 [Selaginella moellendorffii]
Length=593

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NVL+KAGK+ARASK+YE+  KFI+YD++FS++EKKQ+KALK+SCNLNNAA KLKL ++K+
Sbjct  408  NVLYKAGKFARASKKYEQALKFIDYDSNFSDDEKKQAKALKVSCNLNNAASKLKLNEFKD  467

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A K C+KVLELES NVKALYRRAQAY   AD DLAEFDIKKALEIDP NR++++EYK  K
Sbjct  468  AIKCCSKVLELESQNVKALYRRAQAYTRTADLDLAEFDIKKALEIDPQNRDLRMEYKSLK  527

Query  281  ekvkeynkKDAKFYGNMFAKLSKPE  207
            +K  EYNKK+AK YGNMFA+LSK E
Sbjct  528  QKQVEYNKKEAKLYGNMFARLSKLE  552



>ref|XP_001769063.1| predicted protein [Physcomitrella patens]
 gb|EDQ66141.1| predicted protein [Physcomitrella patens]
Length=562

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFKAG YARASKRYEK  K IEYD+SF + +KKQ+K LK+SCNLN AACKLKLKDY+E
Sbjct  410  NALFKAGNYARASKRYEKAVKLIEYDSSFDDAQKKQAKTLKVSCNLNMAACKLKLKDYRE  469

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
              KL TKVLELES+NVKALYRR QAYI   D D AE DIKKAL+IDP NREVKLEYK  K
Sbjct  470  VVKLTTKVLELESSNVKALYRRVQAYIELLDLDYAETDIKKALDIDPQNREVKLEYKRLK  529

Query  281  ekvkeynkKDAKFYGNMFAKLSKPE  207
            +K+ E NKK+AK YGNMFA+LSK E
Sbjct  530  QKLAEQNKKEAKLYGNMFARLSKME  554



>gb|EEC73201.1| hypothetical protein OsI_07270 [Oryza sativa Indica Group]
Length=600

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N  FK  KYARASKRY K   FIEYD+SFSEEEK+ SK LK+SC LNNAACKLKLKDYKE
Sbjct  382  NAWFKMEKYARASKRYGKALNFIEYDSSFSEEEKQLSKPLKVSCKLNNAACKLKLKDYKE  441

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A++LCT+VLEL+S NVKA YRRAQA+++  DFDLAE DIKKALEIDPDNR+VK+ Y+  K
Sbjct  442  AKELCTEVLELDSMNVKAFYRRAQAHMYLVDFDLAELDIKKALEIDPDNRDVKMGYRRLK  501

Query  281  ekvkeynkKDAKFYGNMFAKLSKPE  207
            EKVKE  +K+ K YGNM +KLSK E
Sbjct  502  EKVKEQKRKETKLYGNMISKLSKLE  526



>ref|XP_006280236.1| hypothetical protein CARUB_v10026151mg [Capsella rubella]
 gb|EOA13134.1| hypothetical protein CARUB_v10026151mg [Capsella rubella]
Length=575

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 157/183 (86%), Gaps = 7/183 (4%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGN LFKAGKYARASKRYE+G K+IEYD+SF EEEKK++KALKI+
Sbjct  398  MNTQEKIEAAGKKKEEGNALFKAGKYARASKRYERGVKYIEYDSSFDEEEKKKAKALKIA  457

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYKEA KL TKVLE++  NVKA+YRRA AY+  AD DLAE DIKKAL
Sbjct  458  CNLNNAACKLKLKDYKEAAKLSTKVLEMDGGNVKAMYRRAHAYMETADLDLAELDIKKAL  517

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA--ID  159
            EIDPDN+EVK+EYK  KEKVKEYNKKDAKFY NM +KL +P     +K A +EA+A  ID
Sbjct  518  EIDPDNKEVKIEYKKLKEKVKEYNKKDAKFYSNMLSKLLEP-----HKGAQKEAQAMSID  572

Query  158  SKA  150
            +KA
Sbjct  573  TKA  575



>gb|EEE57017.1| hypothetical protein OsJ_06790 [Oryza sativa Japonica Group]
Length=600

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N  FK  KYARASKRY K   FI+YD+SFSEEEK+ SK LK+SC LNNAACKLKLKDYKE
Sbjct  382  NAWFKMEKYARASKRYGKALNFIQYDSSFSEEEKQLSKPLKVSCKLNNAACKLKLKDYKE  441

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A++LCT+VLEL+S NVKA YRRAQA+++  DFDLAE DIKKALEIDPDNR+VK+ Y+  K
Sbjct  442  AKELCTEVLELDSMNVKAFYRRAQAHMYLVDFDLAELDIKKALEIDPDNRDVKMGYRRLK  501

Query  281  ekvkeynkKDAKFYGNMFAKLSKPE  207
            EKVKE  +K+ K YGNM +KLSK E
Sbjct  502  EKVKEQKRKETKLYGNMISKLSKLE  526



>ref|XP_003574982.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Brachypodium 
distachyon]
Length=648

 Score =   183 bits (464),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NV FK  KY RASKRY K   FI+YD+SFSEEEK+ S+ALK+SC LNNAACKLKLKDYK+
Sbjct  433  NVWFKMCKYTRASKRYGKALSFIDYDSSFSEEEKQPSRALKVSCKLNNAACKLKLKDYKK  492

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A++LCT+VLEL++TNVKALYRRAQA  H  D DLAE DIKKALEIDPDNR+VK+ Y+  K
Sbjct  493  AKELCTEVLELDNTNVKALYRRAQAQTHLVDLDLAELDIKKALEIDPDNRDVKMGYRRLK  552

Query  281  ekvkeynkKDAKFYGNMFAKLSKPE  207
            E VK+YN+K+AKFYGN+  KL K E
Sbjct  553  ETVKQYNRKEAKFYGNIIDKLGKLE  577



>ref|NP_001046873.1| Os02g0491400 [Oryza sativa Japonica Group]
 dbj|BAD21897.1| putative peptidylprolyl isomerase [Oryza sativa Japonica Group]
 dbj|BAD22074.1| putative peptidylprolyl isomerase [Oryza sativa Japonica Group]
 dbj|BAF08787.1| Os02g0491400 [Oryza sativa Japonica Group]
Length=682

 Score =   183 bits (464),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N  FK  KYARASKRY K   FI+YD+SFSEEEK+ SK LK+SC LNNAACKLKLKDYKE
Sbjct  464  NAWFKMEKYARASKRYGKALNFIQYDSSFSEEEKQLSKPLKVSCKLNNAACKLKLKDYKE  523

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A++LCT+VLEL+S NVKA YRRAQA+++  DFDLAE DIKKALEIDPDNR+VK+ Y+  K
Sbjct  524  AKELCTEVLELDSMNVKAFYRRAQAHMYLVDFDLAELDIKKALEIDPDNRDVKMGYRRLK  583

Query  281  ekvkeynkKDAKFYGNMFAKLSKPE  207
            EKVKE  +K+ K YGNM +KLSK E
Sbjct  584  EKVKEQKRKETKLYGNMISKLSKLE  608



>ref|XP_010442282.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Camelina 
sativa]
Length=576

 Score =   182 bits (461),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 155/183 (85%), Gaps = 7/183 (4%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            M+T+EKIEAAGKKK EGN LFKAGKYARASKRYE+G K+IEYD++F EE+KK++KALKI+
Sbjct  399  MDTKEKIEAAGKKKGEGNALFKAGKYARASKRYERGVKYIEYDSAFDEEDKKKAKALKIA  458

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKL+DYKEA KL TKVLE++  NVKA+YRRA AY+  AD DLAE DIKKAL
Sbjct  459  CNLNNAACKLKLRDYKEAAKLSTKVLEMDGRNVKAMYRRAHAYMETADLDLAELDIKKAL  518

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA--ID  159
            EIDPDN+EVK+EY   KEKVKEYNKKDAKFY NM +KL +P     +K A +EA+A  ID
Sbjct  519  EIDPDNKEVKIEYMKLKEKVKEYNKKDAKFYSNMLSKLLEP-----HKGAQKEAQAMSID  573

Query  158  SKA  150
            +KA
Sbjct  574  AKA  576



>ref|XP_010493687.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65 [Camelina 
sativa]
Length=575

 Score =   182 bits (461),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 157/183 (86%), Gaps = 7/183 (4%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGN LFKAGKYARASKRYE+G K+IEYD++F EEEKK++KALKI+
Sbjct  398  MNTQEKIEAAGKKKEEGNALFKAGKYARASKRYERGVKYIEYDSTFDEEEKKKAKALKIA  457

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYKEA KL TKVLE++  NVKA+YRRA AY+  AD DLAE DIKKAL
Sbjct  458  CNLNNAACKLKLKDYKEAAKLSTKVLEMDGRNVKAMYRRAHAYMETADLDLAELDIKKAL  517

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA--ID  159
            EIDPDN+EVK+EYK  KEKVKEYNKKDAKFY NM +KL +P     +K A +EA+A  ID
Sbjct  518  EIDPDNKEVKIEYKKLKEKVKEYNKKDAKFYSNMLSKLLEP-----HKGAQKEAQAMSID  572

Query  158  SKA  150
            +KA
Sbjct  573  TKA  575



>ref|XP_010482107.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Camelina 
sativa]
Length=578

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 157/183 (86%), Gaps = 7/183 (4%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            M+T+EKIEAAGKKKEEGNVLFK GKYARASKRYE+G ++IEYD++F EE+KK++KALKI+
Sbjct  401  MDTKEKIEAAGKKKEEGNVLFKNGKYARASKRYERGVRYIEYDSAFDEEDKKKAKALKIA  460

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYKEA KL TKVLE++  NVKA+YRRA AY+  AD DLAE DIKKAL
Sbjct  461  CNLNNAACKLKLKDYKEAAKLSTKVLEMDGRNVKAMYRRAHAYMETADLDLAELDIKKAL  520

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA--ID  159
            EIDPDN+EVK+EYK  KEKVKEYNKKDAKFY NM +KL +P     +K A +EA+A  ID
Sbjct  521  EIDPDNKEVKIEYKKLKEKVKEYNKKDAKFYSNMLSKLLEP-----HKGAQKEAQAMSID  575

Query  158  SKA  150
            +KA
Sbjct  576  TKA  578



>ref|XP_006647293.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Oryza 
brachyantha]
Length=558

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N  FK  KYARASKRY K   F+EYD+SFSEEEK+ SK LK+SC LNNAACKLKLKDYKE
Sbjct  340  NAWFKMEKYARASKRYGKALNFVEYDSSFSEEEKQLSKPLKVSCKLNNAACKLKLKDYKE  399

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A++LCT+VLEL++ NVKA YRRAQA+++  DFDLAE DIKKALEIDPDNR+VK+ Y+  K
Sbjct  400  AKELCTEVLELDNMNVKAFYRRAQAHMYLVDFDLAEQDIKKALEIDPDNRDVKMGYRRLK  459

Query  281  ekvkeynkKDAKFYGNMFAKLSKPE  207
            EK+KE  +K+ K YGNM +KLSK E
Sbjct  460  EKIKEQKRKETKLYGNMISKLSKLE  484



>emb|CDX85348.1| BnaC07g26590D [Brassica napus]
Length=570

 Score =   179 bits (453),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 156/183 (85%), Gaps = 7/183 (4%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            M TQEKIEAAGKKKEEGN LFKAG YARASKRYE+G K+IEYD+SF EE+KK++KALKI+
Sbjct  393  MITQEKIEAAGKKKEEGNTLFKAGNYARASKRYERGVKYIEYDSSFDEEDKKKAKALKIA  452

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            C LNNAACKLKLKDYKEA KL TKVLE++ +NVKA+YRRA+AY+  AD DLAE DIKKAL
Sbjct  453  CYLNNAACKLKLKDYKEAAKLSTKVLEMDGSNVKAMYRRAEAYMETADLDLAELDIKKAL  512

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA--ID  159
            EIDPDN+E+K+EYK  KEKVKEYNKKDAKFY NM AK+ +P     +K A ++A+A  ID
Sbjct  513  EIDPDNKELKMEYKKLKEKVKEYNKKDAKFYSNMLAKMLEP-----HKEARKDAQAMSID  567

Query  158  SKA  150
            +KA
Sbjct  568  AKA  570



>gb|KHG01160.1| Peptidyl-prolyl cis-trans isomerase FKBP65 -like protein [Gossypium 
arboreum]
Length=606

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 164/214 (77%), Gaps = 10/214 (5%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MN QEKIEAAGKKKEEGN LFKAGKY RASKRYEK  +FIEYD+SFS+EEK+Q+K LK++
Sbjct  392  MNAQEKIEAAGKKKEEGNALFKAGKYERASKRYEKAFRFIEYDSSFSDEEKQQAKLLKVT  451

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+A+KLCT+VLEL+  NVKALYRRAQAY+   DFDLAE DIKKAL
Sbjct  452  CNLNNAACKLKLKDYKKAKKLCTEVLELDDRNVKALYRRAQAYMELVDFDLAEADIKKAL  511

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDSK  153
            EIDPDNR+VKLEY+V KEK+++YNKKDA+FYGN+ AK+SK E     K+  +E+  I   
Sbjct  512  EIDPDNRDVKLEYRVLKEKIRQYNKKDAQFYGNIIAKMSKLE---QAKATKKESRHITIG  568

Query  152  A*ACSAEK-QVCYLLKF------LWVAWSVKLGD  72
               C      VC  L F      +W  WS  L D
Sbjct  569  RKVCRLPVLLVCIFLIFPVIAAVIWQKWSDPLVD  602



>gb|KJB71963.1| hypothetical protein B456_011G150600 [Gossypium raimondii]
Length=607

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 161/221 (73%), Gaps = 23/221 (10%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MN QEKIEAAGKKKEEGN LFKAGKY RA KRYEK  +FIEYD+SFS+EEK+Q+K LK++
Sbjct  392  MNAQEKIEAAGKKKEEGNALFKAGKYERALKRYEKAFRFIEYDSSFSDEEKQQAKMLKVT  451

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+A+KLCT+VLEL+  NVKALYRRAQAY+   DFDLAE DIKKAL
Sbjct  452  CNLNNAACKLKLKDYKKAKKLCTEVLELDDRNVKALYRRAQAYMELVDFDLAEADIKKAL  511

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDSK  153
            EIDPDNR+VKLEY+V KEK+++YNKKDA+FYGN+ AK+SK E   + K  P+        
Sbjct  512  EIDPDNRDVKLEYRVLKEKIRQYNKKDAQFYGNIIAKMSKSEQEKATKKEPRH-------  564

Query  152  A*ACSAEKQVCYLLKFL--------------WVAWSVKLGD  72
                   KQVC L   L              W  WS  L D
Sbjct  565  --MTIGRKQVCRLPVLLVCIFLILPVIAAVIWQKWSDPLVD  603



>ref|XP_002988507.1| hypothetical protein SELMODRAFT_183937 [Selaginella moellendorffii]
 gb|EFJ10303.1| hypothetical protein SELMODRAFT_183937 [Selaginella moellendorffii]
Length=569

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFKAGKY RAS +YEK  K+I++D SFSEEEKK  K L+ S NLNNAACKLKLK+Y+E
Sbjct  394  NALFKAGKYQRASSKYEKAIKYIQHDNSFSEEEKKVVKKLRASSNLNNAACKLKLKEYQE  453

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLCT VL++ES NVKALYRRAQAY+   D DLAE+D++KALE+DP+NREVK+E    K
Sbjct  454  AAKLCTTVLQVESQNVKALYRRAQAYVETLDLDLAEWDLRKALELDPNNREVKVELTRLK  513

Query  281  ekvkeynkKDAKFYGNMFAKLSK  213
            +KV EYNK  AK YGNMFA+LSK
Sbjct  514  QKVCEYNKIQAKMYGNMFARLSK  536



>ref|XP_002979133.1| hypothetical protein SELMODRAFT_110584 [Selaginella moellendorffii]
 gb|EFJ19541.1| hypothetical protein SELMODRAFT_110584 [Selaginella moellendorffii]
Length=569

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFKAGKY RAS +YEK  K+I++D SFSEEEKK  K L+ S NLNNAACKLKLK+Y+E
Sbjct  394  NALFKAGKYQRASSKYEKAIKYIQHDNSFSEEEKKVVKKLRASSNLNNAACKLKLKEYQE  453

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLCT VL++ES NVKALYRRAQAY+   D DLAE+D++KALE+DP+NREVK+E    K
Sbjct  454  AAKLCTTVLQVESQNVKALYRRAQAYVETLDLDLAEWDLRKALELDPNNREVKVELTRLK  513

Query  281  ekvkeynkKDAKFYGNMFAKLSK  213
            +KV EYNK  AK YGNMFA+LSK
Sbjct  514  QKVCEYNKIQAKMYGNMFARLSK  536



>gb|KJB71964.1| hypothetical protein B456_011G150600 [Gossypium raimondii]
Length=606

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 162/214 (76%), Gaps = 10/214 (5%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MN QEKIEAAGKKKEEGN LFKAGKY RA KRYEK  +FIEYD+SFS+EEK+Q+K LK++
Sbjct  392  MNAQEKIEAAGKKKEEGNALFKAGKYERALKRYEKAFRFIEYDSSFSDEEKQQAKMLKVT  451

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLKDYK+A+KLCT+VLEL+  NVKALYRRAQAY+   DFDLAE DIKKAL
Sbjct  452  CNLNNAACKLKLKDYKKAKKLCTEVLELDDRNVKALYRRAQAYMELVDFDLAEADIKKAL  511

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEAIDSK  153
            EIDPDNR+VKLEY+V KEK+++YNKKDA+FYGN+ AK+SK E   + K  P+    I  K
Sbjct  512  EIDPDNRDVKLEYRVLKEKIRQYNKKDAQFYGNIIAKMSKSEQEKATKKEPRHM-TIGRK  570

Query  152  A*ACSAEK-QVCYLL------KFLWVAWSVKLGD  72
               C      VC  L        +W  WS  L D
Sbjct  571  --VCRLPVLLVCIFLILPVIAAVIWQKWSDPLVD  602



>gb|EMS49100.1| 70 kDa peptidyl-prolyl isomerase [Triticum urartu]
Length=651

 Score =   171 bits (434),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NV FK GKYARASKRY K   FIEY++SFSEEEK+ SK LK+SC LN AACKLKLKDYKE
Sbjct  441  NVWFKMGKYARASKRYGKALDFIEYESSFSEEEKQLSKPLKVSCKLNKAACKLKLKDYKE  500

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A++LCT+VLE++STNVKALYRRAQA++H  DFDLAE DIK+ALEIDP+NR++K+ Y+  K
Sbjct  501  AKELCTEVLEIDSTNVKALYRRAQAHMHLVDFDLAEVDIKRALEIDPENRDIKMGYRRLK  560

Query  281  ekvkeynkKDAKFYGNMFAKLSKPE  207
            EKVKEY ++DAKFYGNM  KLSK E
Sbjct  561  EKVKEYERRDAKFYGNMINKLSKLE  585



>dbj|BAJ95453.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=650

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NV FK GKY+RASKRY K   FIEY++SFSEEEK+ SK LK+SC LN AACKLKLKDYKE
Sbjct  440  NVWFKMGKYSRASKRYGKALDFIEYESSFSEEEKQLSKPLKLSCKLNKAACKLKLKDYKE  499

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A++LCTKVLE++STNVKALYRRAQA++H  D DLAE DIK+ALEIDP+NR+VK+ Y+  K
Sbjct  500  AKELCTKVLEMDSTNVKALYRRAQAHMHLVDLDLAELDIKRALEIDPENRDVKMGYRRLK  559

Query  281  ekvkeynkKDAKFYGNMFAKLSKPE  207
            EKVKEY ++DAKFYGNM  KLSK E
Sbjct  560  EKVKEYERRDAKFYGNMIDKLSKLE  584



>gb|AFK48961.1| unknown [Medicago truncatula]
Length=495

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = -3

Query  605  SKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELE  426
            S  Y + AK+IEYD+SFSEEEKK SK LKI+  LNNAACKLKLK+YK+AEKLCTKVL++E
Sbjct  365  STVYYEAAKYIEYDSSFSEEEKKLSKTLKIASYLNNAACKLKLKEYKDAEKLCTKVLDIE  424

Query  425  STNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxkekvkeynkKDAK  246
            STNVKALYRRAQA +   D DLAE DIKKALE+DPDNREVKLEYK  K+ VKEYN K AK
Sbjct  425  STNVKALYRRAQASMQLTDLDLAEIDIKKALEVDPDNREVKLEYKNLKQMVKEYNNKQAK  484

Query  245  FYGNMFA  225
            FYGNMF 
Sbjct  485  FYGNMFG  491



>gb|ACJ85592.1| unknown [Medicago truncatula]
Length=495

 Score =   159 bits (401),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = -3

Query  605  SKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELE  426
            S  Y + AK+IEYD+SFSEEEKK SK LKI+  LNNAACKLKLK+YK+AEKLCTKVL++E
Sbjct  365  STVYYEAAKYIEYDSSFSEEEKKLSKTLKIASYLNNAACKLKLKEYKDAEKLCTKVLDIE  424

Query  425  STNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxkekvkeynkKDAK  246
            STNVKALYRRAQA +   D DLAE DIKKALE+DPDNREVKLEYK  K+ VKEYN K AK
Sbjct  425  STNVKALYRRAQASMQLTDLDLAEIDIKKALEVDPDNREVKLEYKNLKQMVKEYNNKHAK  484

Query  245  FYGNMFA  225
            FYGNMF 
Sbjct  485  FYGNMFG  491



>gb|KDO57440.1| hypothetical protein CISIN_1g028428mg [Citrus sinensis]
Length=159

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LF+AGKY RASK+YEK AK IE+  SF+++EK Q+  L++SC LNNAACKLKL+DY E
Sbjct  18   NLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNAACKLKLEDYSE  77

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
               LCTKVLELE  NVKALYRR+QA++  ++ + AE DIK+AL IDP+NR VKL Y   K
Sbjct  78   TSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRALTIDPNNRVVKLVYMELK  137

Query  281  ekvkeynkKDAKFYGNMFAKLS  216
            +K +EY K  A+ +G M +K+ 
Sbjct  138  DKQREYAKYQAEIFGTMLSKMG  159



>gb|KDO57438.1| hypothetical protein CISIN_1g028428mg [Citrus sinensis]
 gb|KDO57439.1| hypothetical protein CISIN_1g028428mg [Citrus sinensis]
Length=209

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LF+AGKY RASK+YEK AK IE+  SF+++EK Q+  L++SC LNNAACKLKL+DY E
Sbjct  68   NLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNAACKLKLEDYSE  127

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
               LCTKVLELE  NVKALYRR+QA++  ++ + AE DIK+AL IDP+NR VKL Y   K
Sbjct  128  TSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRALTIDPNNRVVKLVYMELK  187

Query  281  ekvkeynkKDAKFYGNMFAKLS  216
            +K +EY K  A+ +G M +K+ 
Sbjct  188  DKQREYAKYQAEIFGTMLSKMG  209



>ref|XP_006857116.1| hypothetical protein AMTR_s00065p00132670 [Amborella trichopoda]
 gb|ERN18583.1| hypothetical protein AMTR_s00065p00132670 [Amborella trichopoda]
Length=599

 Score =   157 bits (396),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            M+T E+I+AA  KKEEGNVL+K GKY RA+K+Y+K   ++  D SF + + K  KALK+S
Sbjct  393  MDTHERIKAAETKKEEGNVLYKIGKYTRAAKKYDKAMDYVREDDSFEDNQMKLVKALKVS  452

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            C LNN AC LKL +YK A  LC+KVL +ES NVKALYRRAQAY+  +D DLAE D+KKAL
Sbjct  453  CWLNNGACSLKLDEYKGAINLCSKVLNVESQNVKALYRRAQAYMGTSDLDLAELDLKKAL  512

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNK  189
            E+DP NREVK  +K  K+   E NK+DAK +GNMF+++ K E   S K
Sbjct  513  EVDPQNREVKALHKTLKQMQIESNKRDAKLFGNMFSRMRKDECMGSKK  560



>ref|XP_009613900.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X4 [Nicotiana tomentosiformis]
Length=188

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 111/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFK GKY RA K+YEK   +I  D +F +++++  K+L++SC LN AAC LK  D++E
Sbjct  18   NLLFKNGKYQRAMKKYEKAVDYINEDGTFEDDDQRLVKSLRVSCWLNGAACCLKQNDFQE  77

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLC+KVLE+ES NVKALYRRAQA++  AD  LAE D KKALEIDP NREVKL  K  K
Sbjct  78   AFKLCSKVLEIESCNVKALYRRAQAFMETADLHLAELDFKKALEIDPQNREVKLIQKTLK  137

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA  165
            +   E NKKDAK Y  MF +LS     ++ +   +E E+
Sbjct  138  QLQVESNKKDAKLYTTMFTRLSNENSSAAKRLKVEETES  176



>ref|XP_003544491.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Glycine 
max]
 gb|KHN17168.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Glycine soja]
Length=582

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NVLFK G Y RA K+YEK A F+E D SF ++E+KQ++ L++SC LN AAC LKL D+  
Sbjct  404  NVLFKGGNYQRAGKKYEKAADFVEEDGSFGDDEQKQAQTLRVSCWLNGAACSLKLNDFPG  463

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLC++VL++E  NVKA YRRAQAYI   D+ LA+ DIKKAL +DP NREVK+  K  K
Sbjct  464  AIKLCSQVLDVEFCNVKAFYRRAQAYIETGDYLLADVDIKKALVVDPQNREVKVIQKKLK  523

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFS  198
            +   + +KKDAK Y NMFA+ +K  P +
Sbjct  524  QLQADSDKKDAKLYENMFARKTKDSPMA  551



>ref|XP_010552023.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Tarenaya 
hassleriana]
Length=548

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 127/170 (75%), Gaps = 0/170 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            M TQEKIEAA  KKEEGN LFKAGKYA+A KRY+K   +IEY ++F EEE+K++K L+ +
Sbjct  379  MYTQEKIEAAESKKEEGNALFKAGKYAKALKRYDKAVGYIEYGSAFGEEERKKTKELRAA  438

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            C+LN AACKLK ++Y+EA +LCTKVL  E  NVKALYRRA+AY+   + +LAEFDIKKAL
Sbjct  439  CDLNKAACKLKQREYREAVELCTKVLSGEEENVKALYRRAEAYMETDELELAEFDIKKAL  498

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSA  183
             IDP NREVK EY+  KEKVK YNK++AKFY  M  K     P   +  A
Sbjct  499  HIDPSNREVKSEYRKLKEKVKGYNKREAKFYSKMLGKTKDERPIGVDAEA  548



>ref|XP_006430496.1| hypothetical protein CICLE_v10011447mg [Citrus clementina]
 gb|ESR43736.1| hypothetical protein CICLE_v10011447mg [Citrus clementina]
Length=535

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LF+AGKY RASK+YEK AK IE+  SF+++EK Q+  L++SC LNNAACKLKL+DY E
Sbjct  394  NLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNAACKLKLEDYSE  453

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
               LCTKVLELE  NVKALYRR+QAY+  ++ + AE DIK+AL IDP+NR+VKL Y   K
Sbjct  454  TSSLCTKVLELEPLNVKALYRRSQAYLKTSELEKAEADIKRALTIDPNNRDVKLVYMELK  513

Query  281  ekvkeynkKDAKFYGNMFAKLS  216
            +K +EY K  A+ +G M +K+ 
Sbjct  514  DKQREYAKYQAEIFGTMLSKMG  535



>ref|XP_006482027.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Citrus 
sinensis]
Length=535

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LF+AGKY RASK+YEK AK IE+  SF+++EK Q+  L++SC LNNAACKLKL+DY E
Sbjct  394  NLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNAACKLKLEDYSE  453

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
               LCTKVLELE  NVKALYRR+QA++  ++ + AE DIK+AL IDP+NR VKL Y   K
Sbjct  454  TSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRALTIDPNNRVVKLVYMELK  513

Query  281  ekvkeynkKDAKFYGNMFAKLS  216
            +K +EY K  A+ +G M +K+ 
Sbjct  514  DKQREYAKYQAEIFGTMLSKMG  535



>gb|KJB58679.1| hypothetical protein B456_009G2211002, partial [Gossypium raimondii]
 gb|KJB58680.1| hypothetical protein B456_009G2211002, partial [Gossypium raimondii]
Length=212

 Score =   145 bits (365),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 119/160 (74%), Gaps = 0/160 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            +N QEKIEAAGKKKEEGN+LFK G Y RA K+Y+K   ++  D  F ++E+KQ KAL+IS
Sbjct  7    LNNQEKIEAAGKKKEEGNILFKDGNYQRAGKKYDKAVDYVSEDGLFQDDEQKQIKALRIS  66

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            C LN AAC LKL D+  A +LC+KVL+ ES NVKALYRRAQAY+  +D   AE DIKKAL
Sbjct  67   CWLNGAACSLKLSDFWGAIQLCSKVLDFESHNVKALYRRAQAYMKTSDLISAEMDIKKAL  126

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK  213
            E DP NREVKL  K  ++   E NK+DAK + NMFA++SK
Sbjct  127  EADPQNREVKLLQKTLRQLQVESNKRDAKLFTNMFARMSK  166



>ref|XP_010653645.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Vitis vinifera]
Length=517

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFKAGK+  ASK+YEK  K+IE+D SF++EEK Q+ AL+ISCNLNNAACKLKL +Y E
Sbjct  376  NMLFKAGKFWHASKKYEKAEKYIEFDHSFTDEEKVQANALRISCNLNNAACKLKLGEYLE  435

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNR  312
            A K CTKVLEL+ +N+KALYRR+Q+Y+  ++ + AE DI++AL IDP NR
Sbjct  436  ASKQCTKVLELDPSNIKALYRRSQSYLRISELEKAEADIRRALTIDPSNR  485



>ref|XP_007018460.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
[Theobroma cacao]
 gb|EOY15685.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
[Theobroma cacao]
Length=603

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            +N+QEKIEAAGKKKEEGN+LFK+GKY RA K+Y+K   ++  D  F ++E+K  KAL+IS
Sbjct  398  LNSQEKIEAAGKKKEEGNMLFKSGKYQRAGKKYDKAVDYVSEDGPFGDDEQKLVKALRIS  457

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            C LN AAC LKL D++ A KLC+KVL+ E  NVKALYRRAQAY+  +D  LAE DIKKAL
Sbjct  458  CWLNGAACSLKLSDFQGAIKLCSKVLDFEFHNVKALYRRAQAYMETSDLVLAELDIKKAL  517

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK  213
            E DP NREVKL  K  ++   E N +DAK + NMFA++SK
Sbjct  518  EADPQNREVKLLQKTLRQLQVESNMRDAKLFTNMFARMSK  557



>ref|XP_009613899.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X3 [Nicotiana tomentosiformis]
Length=362

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 111/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFK GKY RA K+YEK   +I  D +F +++++  K+L++SC LN AAC LK  D++E
Sbjct  192  NLLFKNGKYQRAMKKYEKAVDYINEDGTFEDDDQRLVKSLRVSCWLNGAACCLKQNDFQE  251

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLC+KVLE+ES NVKALYRRAQA++  AD  LAE D KKALEIDP NREVKL  K  K
Sbjct  252  AFKLCSKVLEIESCNVKALYRRAQAFMETADLHLAELDFKKALEIDPQNREVKLIQKTLK  311

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA  165
            +   E NKKDAK Y  MF +LS     ++ +   +E E+
Sbjct  312  QLQVESNKKDAKLYTTMFTRLSNENSSAAKRLKVEETES  350



>ref|XP_009764363.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X3 [Nicotiana sylvestris]
Length=361

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 112/159 (70%), Gaps = 1/159 (1%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFK GKY RA  +YEK   +I  D +F +++++  K+L++SC LN AAC LK  D++E
Sbjct  192  NLLFKNGKYQRAMTKYEKAVDYINEDGTFEDDDQRLVKSLRVSCWLNGAACCLKQNDFQE  251

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A K C+KVLE+ES NVKALYRRAQA++  AD  LAE DIKKALEIDP NREVKL  +  K
Sbjct  252  AIKQCSKVLEIESCNVKALYRRAQAFMETADLHLAELDIKKALEIDPQNREVKLIQRTLK  311

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA  165
            +   E NKKDAK Y  MFA+LS  E  S+ K    EAE+
Sbjct  312  QLQAESNKKDAKVYTTMFARLSN-ENSSAAKRLKVEAES  349



>ref|XP_006433656.1| hypothetical protein CICLE_v10003372mg [Citrus clementina]
 gb|ESR46896.1| hypothetical protein CICLE_v10003372mg [Citrus clementina]
Length=606

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MN QEKIEAAG+KKEEGN+LFK GKY RA K+Y K A  +  D SF ++E+K  K+L++S
Sbjct  400  MNNQEKIEAAGRKKEEGNLLFKNGKYERAGKKYNKAADCVSEDGSFVDDEQKLVKSLRVS  459

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            C LN+AAC LKLKDY+ A +LC+KVL+ +  NVKALYRRAQAY+  AD  LAE DIKKA+
Sbjct  460  CWLNSAACCLKLKDYQGAIELCSKVLDCDCHNVKALYRRAQAYMEIADLILAELDIKKAI  519

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNK  189
            E DP NREV L  K  K+   E NK+DAKFY NMFA ++K    ++ K
Sbjct  520  EADPQNREVTLLQKSLKQLQAESNKRDAKFYANMFAHVTKDSSVATKK  567



>ref|XP_010273186.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Nelumbo nucifera]
Length=437

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 109/159 (69%), Gaps = 0/159 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK GK+ RA+KRYEK   ++  D +  + E+K  KAL++SC LN AAC LKL D++ 
Sbjct  227  NALFKNGKFQRAAKRYEKATDYVSEDGTSEDGEQKLVKALRVSCWLNIAACNLKLNDFQG  286

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLC+KVL++E  NVKALYRRAQAYI  AD D AE D+KKALE+DP NRE K   K  K
Sbjct  287  AIKLCSKVLDIEFYNVKALYRRAQAYIETADLDFAELDVKKALEVDPQNREFKSMQKKLK  346

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA  165
            +   E NK+DAK Y +MFA + K  P ++ +   ++AE 
Sbjct  347  QLQVESNKRDAKLYTSMFAWMKKDTPVATKRLKVEKAEG  385



>ref|XP_006472323.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Citrus sinensis]
Length=606

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 125/168 (74%), Gaps = 0/168 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MN Q KIEAAG+KKEEGN+LFK GKY RA K+Y K A  +  D SF ++E+K  K+L++S
Sbjct  400  MNNQGKIEAAGRKKEEGNLLFKNGKYERAGKKYYKAADCVSEDGSFVDDEQKLVKSLRVS  459

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            C LN+AAC LKLKDY+ A +LC+KVL+ +  NVKALYRRAQAY+  AD  LAE DIKKA+
Sbjct  460  CWLNSAACCLKLKDYQGAIELCSKVLDCDCHNVKALYRRAQAYMEIADLILAELDIKKAI  519

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNK  189
            E DP NREVKL  K  K+   E NK+DAKFY NMFA+++K    ++ K
Sbjct  520  EADPQNREVKLLQKSLKQLQAESNKRDAKFYANMFARVTKDSSVATKK  567



>ref|XP_010244430.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Nelumbo nucifera]
Length=541

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 116/153 (76%), Gaps = 8/153 (5%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEK--------GAKFIEYDTSFSEEEKKQSKALKISCNLNNAACK  486
            N+LFK GK+  ASK+YEK          K+IE+D SF++EEK Q+ AL+ISCNLNNAACK
Sbjct  388  NMLFKNGKFLFASKKYEKEIIFYYLQAVKYIEFDHSFTDEEKSQANALRISCNLNNAACK  447

Query  485  LKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRev  306
            LKL +Y EA  LCTKVLEL+  NVKALYRR+Q+YI  +D + AE DIKKAL +DP+NR+V
Sbjct  448  LKLGEYVEAAGLCTKVLELDPFNVKALYRRSQSYIRTSDLEKAEIDIKKALTVDPNNRDV  507

Query  305  kleykvxkekvkeynkKDAKFYGNMFAKLSKPE  207
            KLEYK  K+K KEY K  A+ +G MF+++++ E
Sbjct  508  KLEYKKLKDKAKEYAKYQAEIFGTMFSRMAQLE  540



>gb|KEH40013.1| FKBP-type peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=340

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFK+GKY RA+K+Y+K A F+  D S  ++E+K +K+L++SC LN AAC LKL D+  
Sbjct  194  NLLFKSGKYQRAAKKYDKAADFVSRDGSLGDDEEKLAKSLRVSCWLNGAACCLKLNDFPG  253

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLCT+VL++E  NVKALYRRAQAYI   DF LA+ DIKKALE+DP NREVK+     K
Sbjct  254  AIKLCTQVLDVEFHNVKALYRRAQAYIETEDFLLADVDIKKALEVDPQNREVKVLKMKLK  313

Query  281  ekvkeynkKDAKFYGNMFAKLSK  213
            +   + +KKDAK Y +MFA  +K
Sbjct  314  QLQADSDKKDAKLYESMFAPKTK  336



>gb|KEH40012.1| FKBP-type peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=370

 Score =   146 bits (368),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFK+GKY RA+K+Y+K A F+  D S  ++E+K +K+L++SC LN AAC LKL D+  
Sbjct  194  NLLFKSGKYQRAAKKYDKAADFVSRDGSLGDDEEKLAKSLRVSCWLNGAACCLKLNDFPG  253

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLCT+VL++E  NVKALYRRAQAYI   DF LA+ DIKKALE+DP NREVK+     K
Sbjct  254  AIKLCTQVLDVEFHNVKALYRRAQAYIETEDFLLADVDIKKALEVDPQNREVKVLKMKLK  313

Query  281  ekvkeynkKDAKFYGNMFAKLSK  213
            +   + +KKDAK Y +MFA  +K
Sbjct  314  QLQADSDKKDAKLYESMFAPKTK  336



>ref|XP_002510075.1| peptidylprolyl isomerase, putative [Ricinus communis]
 gb|EEF52262.1| peptidylprolyl isomerase, putative [Ricinus communis]
Length=598

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFK+GK+ RA K+Y+K A +I  + SF ++E+K  K+L++SC LN AAC LKL D++ 
Sbjct  409  NLLFKSGKFQRAGKKYDKAADYIVEEVSFDDDEQKLIKSLRVSCWLNGAACSLKLGDFQG  468

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
               LC+KVL++E  NVKALYRRAQAY+  AD   AE DIKKALEIDP NREVK   K  +
Sbjct  469  TINLCSKVLDVEFDNVKALYRRAQAYMQTADLVSAELDIKKALEIDPHNREVKSLQKTLR  528

Query  281  ekvkeynkKDAKFYGNMFAKLSK  213
            +   E +K+DAK Y NMFA+++K
Sbjct  529  QLQVERDKRDAKLYSNMFARMTK  551



>ref|XP_009613898.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Nicotiana tomentosiformis]
Length=571

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 111/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFK GKY RA K+YEK   +I  D +F +++++  K+L++SC LN AAC LK  D++E
Sbjct  401  NLLFKNGKYQRAMKKYEKAVDYINEDGTFEDDDQRLVKSLRVSCWLNGAACCLKQNDFQE  460

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLC+KVLE+ES NVKALYRRAQA++  AD  LAE D KKALEIDP NREVKL  K  K
Sbjct  461  AFKLCSKVLEIESCNVKALYRRAQAFMETADLHLAELDFKKALEIDPQNREVKLIQKTLK  520

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA  165
            +   E NKKDAK Y  MF +LS     ++ +   +E E+
Sbjct  521  QLQVESNKKDAKLYTTMFTRLSNENSSAAKRLKVEETES  559



>ref|XP_010273182.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Nelumbo 
nucifera]
Length=623

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 109/159 (69%), Gaps = 0/159 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N LFK GK+ RA+KRYEK   ++  D +  + E+K  KAL++SC LN AAC LKL D++ 
Sbjct  413  NALFKNGKFQRAAKRYEKATDYVSEDGTSEDGEQKLVKALRVSCWLNIAACNLKLNDFQG  472

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLC+KVL++E  NVKALYRRAQAYI  AD D AE D+KKALE+DP NRE K   K  K
Sbjct  473  AIKLCSKVLDIEFYNVKALYRRAQAYIETADLDFAELDVKKALEVDPQNREFKSMQKKLK  532

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA  165
            +   E NK+DAK Y +MFA + K  P ++ +   ++AE 
Sbjct  533  QLQVESNKRDAKLYTSMFAWMKKDTPVATKRLKVEKAEG  571



>gb|KEH40011.1| FKBP-type peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=424

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFK+GKY RA+K+Y+K A F+  D S  ++E+K +K+L++SC LN AAC LKL D+  
Sbjct  278  NLLFKSGKYQRAAKKYDKAADFVSRDGSLGDDEEKLAKSLRVSCWLNGAACCLKLNDFPG  337

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLCT+VL++E  NVKALYRRAQAYI   DF LA+ DIKKALE+DP NREVK+     K
Sbjct  338  AIKLCTQVLDVEFHNVKALYRRAQAYIETEDFLLADVDIKKALEVDPQNREVKVLKMKLK  397

Query  281  ekvkeynkKDAKFYGNMFAKLSK  213
            +   + +KKDAK Y +MFA  +K
Sbjct  398  QLQADSDKKDAKLYESMFAPKTK  420



>ref|XP_009613897.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Nicotiana tomentosiformis]
Length=581

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 111/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFK GKY RA K+YEK   +I  D +F +++++  K+L++SC LN AAC LK  D++E
Sbjct  411  NLLFKNGKYQRAMKKYEKAVDYINEDGTFEDDDQRLVKSLRVSCWLNGAACCLKQNDFQE  470

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLC+KVLE+ES NVKALYRRAQA++  AD  LAE D KKALEIDP NREVKL  K  K
Sbjct  471  AFKLCSKVLEIESCNVKALYRRAQAFMETADLHLAELDFKKALEIDPQNREVKLIQKTLK  530

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA  165
            +   E NKKDAK Y  MF +LS     ++ +   +E E+
Sbjct  531  QLQVESNKKDAKLYTTMFTRLSNENSSAAKRLKVEETES  569



>gb|KEH40010.1| FKBP-type peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=454

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFK+GKY RA+K+Y+K A F+  D S  ++E+K +K+L++SC LN AAC LKL D+  
Sbjct  278  NLLFKSGKYQRAAKKYDKAADFVSRDGSLGDDEEKLAKSLRVSCWLNGAACCLKLNDFPG  337

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLCT+VL++E  NVKALYRRAQAYI   DF LA+ DIKKALE+DP NREVK+     K
Sbjct  338  AIKLCTQVLDVEFHNVKALYRRAQAYIETEDFLLADVDIKKALEVDPQNREVKVLKMKLK  397

Query  281  ekvkeynkKDAKFYGNMFAKLSK  213
            +   + +KKDAK Y +MFA  +K
Sbjct  398  QLQADSDKKDAKLYESMFAPKTK  420



>ref|XP_009764362.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Nicotiana sylvestris]
Length=570

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 112/159 (70%), Gaps = 1/159 (1%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFK GKY RA  +YEK   +I  D +F +++++  K+L++SC LN AAC LK  D++E
Sbjct  401  NLLFKNGKYQRAMTKYEKAVDYINEDGTFEDDDQRLVKSLRVSCWLNGAACCLKQNDFQE  460

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A K C+KVLE+ES NVKALYRRAQA++  AD  LAE DIKKALEIDP NREVKL  +  K
Sbjct  461  AIKQCSKVLEIESCNVKALYRRAQAFMETADLHLAELDIKKALEIDPQNREVKLIQRTLK  520

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA  165
            +   E NKKDAK Y  MFA+LS  E  S+ K    EAE+
Sbjct  521  QLQAESNKKDAKVYTTMFARLSN-ENSSAAKRLKVEAES  558



>ref|XP_009764360.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Nicotiana sylvestris]
Length=580

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 112/159 (70%), Gaps = 1/159 (1%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFK GKY RA  +YEK   +I  D +F +++++  K+L++SC LN AAC LK  D++E
Sbjct  411  NLLFKNGKYQRAMTKYEKAVDYINEDGTFEDDDQRLVKSLRVSCWLNGAACCLKQNDFQE  470

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A K C+KVLE+ES NVKALYRRAQA++  AD  LAE DIKKALEIDP NREVKL  +  K
Sbjct  471  AIKQCSKVLEIESCNVKALYRRAQAFMETADLHLAELDIKKALEIDPQNREVKLIQRTLK  530

Query  281  ekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAEA  165
            +   E NKKDAK Y  MFA+LS  E  S+ K    EAE+
Sbjct  531  QLQAESNKKDAKVYTTMFARLSN-ENSSAAKRLKVEAES  568



>gb|KEH40009.1| FKBP-type peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=550

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFK+GKY RA+K+Y+K A F+  D S  ++E+K +K+L++SC LN AAC LKL D+  
Sbjct  404  NLLFKSGKYQRAAKKYDKAADFVSRDGSLGDDEEKLAKSLRVSCWLNGAACCLKLNDFPG  463

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLCT+VL++E  NVKALYRRAQAYI   DF LA+ DIKKALE+DP NREVK+     K
Sbjct  464  AIKLCTQVLDVEFHNVKALYRRAQAYIETEDFLLADVDIKKALEVDPQNREVKVLKMKLK  523

Query  281  ekvkeynkKDAKFYGNMFAKLSK  213
            +   + +KKDAK Y +MFA  +K
Sbjct  524  QLQADSDKKDAKLYESMFAPKTK  546



>gb|AES59301.2| FKBP-type peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=580

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFK+GKY RA+K+Y+K A F+  D S  ++E+K +K+L++SC LN AAC LKL D+  
Sbjct  404  NLLFKSGKYQRAAKKYDKAADFVSRDGSLGDDEEKLAKSLRVSCWLNGAACCLKLNDFPG  463

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLCT+VL++E  NVKALYRRAQAYI   DF LA+ DIKKALE+DP NREVK+     K
Sbjct  464  AIKLCTQVLDVEFHNVKALYRRAQAYIETEDFLLADVDIKKALEVDPQNREVKVLKMKLK  523

Query  281  ekvkeynkKDAKFYGNMFAKLSK  213
            +   + +KKDAK Y +MFA  +K
Sbjct  524  QLQADSDKKDAKLYESMFAPKTK  546



>gb|KEH40014.1| FKBP-type peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=556

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFK+GKY RA+K+Y+K A F+  D S  ++E+K +K+L++SC LN AAC LKL D+  
Sbjct  380  NLLFKSGKYQRAAKKYDKAADFVSRDGSLGDDEEKLAKSLRVSCWLNGAACCLKLNDFPG  439

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLCT+VL++E  NVKALYRRAQAYI   DF LA+ DIKKALE+DP NREVK+     K
Sbjct  440  AIKLCTQVLDVEFHNVKALYRRAQAYIETEDFLLADVDIKKALEVDPQNREVKVLKMKLK  499

Query  281  ekvkeynkKDAKFYGNMFAKLSK  213
            +   + +KKDAK Y +MFA  +K
Sbjct  500  QLQADSDKKDAKLYESMFAPKTK  522



>ref|XP_010553661.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase isoform X3 [Tarenaya 
hassleriana]
Length=376

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 124/171 (73%), Gaps = 3/171 (2%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MN QEKIEAA +KK+EGN L+K  KY RA+K+Y+K A  +E   SF ++E+KQ KAL++S
Sbjct  177  MNNQEKIEAACRKKDEGNQLYKNQKYQRAAKKYDKAADCVEA-CSFGDDEEKQVKALRVS  235

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            C LN AAC LKLKD+ EA +LC+KVLE+E  NVKALYRRAQAYI   D   AE DI+KAL
Sbjct  236  CWLNGAACSLKLKDFPEAIRLCSKVLEIEFLNVKALYRRAQAYIEIGDLFQAEMDIRKAL  295

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAP  180
            E DP+NREVK   +  K+   E +K+DAK Y NMF +L+  +  S + SAP
Sbjct  296  EADPENREVKSLERTLKQSKAETDKRDAKLYSNMFKRLATKD--SLDLSAP  344



>ref|XP_003589050.1| 70 kDa peptidyl-prolyl isomerase [Medicago truncatula]
Length=609

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFK+GKY RA+K+Y+K A F+  D S  ++E+K +K+L++SC LN AAC LKL D+  
Sbjct  404  NLLFKSGKYQRAAKKYDKAADFVSRDGSLGDDEEKLAKSLRVSCWLNGAACCLKLNDFPG  463

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLCT+VL++E  NVKALYRRAQAYI   DF LA+ DIKKALE+DP NREVK+     K
Sbjct  464  AIKLCTQVLDVEFHNVKALYRRAQAYIETEDFLLADVDIKKALEVDPQNREVKVLKMKLK  523

Query  281  ekvkeynkKDAKFYGNMFAKLSK  213
            +   + +KKDAK Y +MFA  +K
Sbjct  524  QLQADSDKKDAKLYESMFAPKTK  546



>ref|XP_007162035.1| hypothetical protein PHAVU_001G118200g [Phaseolus vulgaris]
 gb|ESW34029.1| hypothetical protein PHAVU_001G118200g [Phaseolus vulgaris]
Length=610

 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            M+TQEKIEA  +KK +GN+LFKA  +  ASK+YEK  K+IE+D SFSE+EK +S  L++S
Sbjct  452  MDTQEKIEACERKKYDGNLLFKAENFMHASKKYEKAVKYIEFDHSFSEDEKHRSNTLRLS  511

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKL +Y EA +LCTKVLE +  N+KALYRR+QAY+  +D + AE DIK+AL
Sbjct  512  CNLNNAACKLKLGEYIEASRLCTKVLEQDPLNIKALYRRSQAYVKTSDLEKAEADIKRAL  571

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLS  216
             IDP+NR++KLEYK  K K KEY++ +A  +  M +++S
Sbjct  572  TIDPNNRDIKLEYKELKLKQKEYSRYEAGIFSTMVSRMS  610



>gb|KHN36977.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Glycine soja]
Length=583

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NVLFK G Y RA K+YEK A F++ D SF  +E+KQ++ LK+SC LN+AAC LKL D+  
Sbjct  405  NVLFKVGNYQRAGKKYEKAADFVDEDGSFGFDEQKQAQTLKVSCWLNSAACSLKLDDFPG  464

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLC++VL++E  NVKA YRRAQAYI   D+ LA+ DIKKAL +DP NR+VK+  K  K
Sbjct  465  AIKLCSQVLDVEFCNVKAFYRRAQAYIETGDYLLADVDIKKALVVDPQNRDVKVIQKKLK  524

Query  281  ekvkeynkKDAKFYGNMFAKLSK  213
            +   + +KKDAK Y NM A+ +K
Sbjct  525  QLQADSDKKDAKLYENMLARKTK  547



>ref|XP_011013751.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Populus 
euphratica]
Length=221

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 118/160 (74%), Gaps = 0/160 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MN QEKI+AA +KKEEGN+LFK+GKY RA K+Y+K A ++  +  F ++E+K   A++++
Sbjct  9    MNNQEKIKAAERKKEEGNLLFKSGKYLRAGKKYDKAASYVGEEEVFGDDEQKLVTAMRVT  68

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            C LN AAC LKL D++ A KLC+KVL++E  N+KALYRRAQA I   D   A+ DIKKAL
Sbjct  69   CWLNKAACSLKLNDFQGAIKLCSKVLDIEFYNIKALYRRAQALIQTTDLVSADMDIKKAL  128

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK  213
            E+DP NRE+KL  K  K+   E NK+DAK Y NMFA +++
Sbjct  129  EVDPQNREMKLIQKTLKQLQAESNKRDAKLYSNMFADMTR  168



>ref|XP_003550301.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Glycine 
max]
Length=583

 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NVLFK G Y RA K+YEK A F++ D SF  +E+KQ++ LK+SC LN+AAC LKL D+  
Sbjct  405  NVLFKVGNYQRAGKKYEKAADFVDEDGSFGFDEQKQAQTLKVSCWLNSAACSLKLNDFPG  464

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLC++VL++E  NVKA YRRAQAYI   D+ LA+ DIKKAL +DP NR+VK+  K  K
Sbjct  465  AIKLCSQVLDVEFCNVKAFYRRAQAYIETGDYLLADVDIKKALVVDPQNRDVKVIQKKLK  524

Query  281  ekvkeynkKDAKFYGNMFAKLSK  213
            +   + +KKDAK Y NM A+ +K
Sbjct  525  QLQADSDKKDAKLYENMLARKTK  547



>ref|XP_007221858.1| hypothetical protein PRUPE_ppa019344mg [Prunus persica]
 gb|EMJ23057.1| hypothetical protein PRUPE_ppa019344mg [Prunus persica]
Length=569

 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFK GKY +A K+Y+KG  ++  D +F ++E K ++ L++S  LN AAC LKL D++E
Sbjct  415  NLLFKEGKYQKAGKKYDKGVDYVSEDGNFGDDESKLARELRLSFWLNGAACSLKLNDFQE  474

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLC+KVL++E  NVKALYRRAQAY+  AD  LAE DIKKALE+DP NREVKL  K  K
Sbjct  475  AIKLCSKVLDIEFHNVKALYRRAQAYMQVADLVLAELDIKKALEVDPQNREVKLIEKNLK  534

Query  281  ekvkeynkKDAKFYGNMFAKLSK  213
                E NK+DAK Y N+F +++K
Sbjct  535  RLQVESNKRDAKLYTNIFGRMTK  557



>ref|XP_008220384.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Prunus mume]
Length=569

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LF  GKY +A K+Y+KGA ++  D +F ++E K ++ L++S  LN AAC LKL D++E
Sbjct  415  NLLFIEGKYQKAGKKYDKGADYVSEDGNFGDDESKLARELRLSFWLNGAACSLKLNDFQE  474

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLC+KVL++E  NVKALYRRAQAY+  AD  LAE DIKKALE+DP NREVKL  K  K
Sbjct  475  AIKLCSKVLDIEFHNVKALYRRAQAYMQVADLVLAELDIKKALEVDPQNREVKLIEKNLK  534

Query  281  ekvkeynkKDAKFYGNMFAKLSK  213
                E NK+DAK Y N+F +++K
Sbjct  535  RLQVESNKRDAKLYTNIFGRMTK  557



>ref|XP_010553659.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase isoform X1 [Tarenaya 
hassleriana]
Length=598

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 124/171 (73%), Gaps = 3/171 (2%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MN QEKIEAA +KK+EGN L+K  KY RA+K+Y+K A  +E   SF ++E+KQ KAL++S
Sbjct  399  MNNQEKIEAACRKKDEGNQLYKNQKYQRAAKKYDKAADCVEA-CSFGDDEEKQVKALRVS  457

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            C LN AAC LKLKD+ EA +LC+KVLE+E  NVKALYRRAQAYI   D   AE DI+KAL
Sbjct  458  CWLNGAACSLKLKDFPEAIRLCSKVLEIEFLNVKALYRRAQAYIEIGDLFQAEMDIRKAL  517

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAP  180
            E DP+NREVK   +  K+   E +K+DAK Y NMF +L+  +  S + SAP
Sbjct  518  EADPENREVKSLERTLKQSKAETDKRDAKLYSNMFKRLATKD--SLDLSAP  566



>gb|KHG02788.1| Peptidyl-prolyl cis-trans isomerase FKBP65 -like protein [Gossypium 
arboreum]
Length=603

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 119/160 (74%), Gaps = 0/160 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            +N QEKIEAAGKKKEEGN+LFK G Y RA K+Y+K   ++  D  F ++E+KQ KAL+IS
Sbjct  398  LNNQEKIEAAGKKKEEGNILFKDGNYQRAGKKYDKAVDYVSEDGLFQDDEQKQIKALRIS  457

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            C LN AAC LKL D+  A +LC+KVL+ ES NVKALYRRAQAY+  +D   AE DIKKAL
Sbjct  458  CWLNGAACSLKLSDFWGAIQLCSKVLDFESYNVKALYRRAQAYMKTSDLISAEMDIKKAL  517

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK  213
            E DP NREVKL  K  ++   E NK+DAK + NMFA++SK
Sbjct  518  EADPQNREVKLLQKTLRQLQVESNKRDAKLFTNMFAQMSK  557



>ref|XP_006380967.1| hypothetical protein POPTR_0006s03190g [Populus trichocarpa]
 gb|ERP58764.1| hypothetical protein POPTR_0006s03190g [Populus trichocarpa]
Length=535

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NVLFKAGK+ RASK+YEK AK+IE+D SF++EE   +K+L++SC LNNAACKLK  ++ E
Sbjct  394  NVLFKAGKFWRASKKYEKAAKYIEFDHSFTDEEMCLAKSLRLSCYLNNAACKLKSGEFLE  453

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNR  312
            A +LCTKVLEL+  NVKAL+RR+QAY+  ++ + AE DIKKAL IDP+NR
Sbjct  454  ASRLCTKVLELDPLNVKALFRRSQAYLKTSELEKAEADIKKALAIDPNNR  503



>ref|XP_009360953.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Pyrus x bretschneideri]
Length=553

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFK GK+ +A K+Y+K A ++  D +F ++E K ++AL++ C LN AAC LKL D++E
Sbjct  402  NLLFKKGKHQQAGKKYDKAADYVSEDGNFGDDESKLARALRMLCWLNGAACSLKLNDFQE  461

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A KLC+KVL++E  NVKALYRRAQAY+  AD  LAE DIKKALE+DP NREVKL  K  K
Sbjct  462  AIKLCSKVLDIEFHNVKALYRRAQAYMEIADLVLAELDIKKALEVDPHNREVKLIEKNLK  521

Query  281  ekvkeynkKDAKFYGNMFAKLSK  213
                E +K+DAK Y N+F + +K
Sbjct  522  RLQVESDKRDAKLYTNIFGRATK  544



>ref|XP_010061642.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Eucalyptus 
grandis]
 gb|KCW68629.1| hypothetical protein EUGRSUZ_F02235 [Eucalyptus grandis]
Length=608

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFKAGK  RA K+Y+K A ++  D SF ++E+K  KAL+++C LN AAC LKL +++E
Sbjct  413  NLLFKAGKLRRAGKKYDKAADYVGEDGSFGDDEQKLVKALRVACWLNAAACSLKLNNFQE  472

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A +LC+KVL+ E  NVKALYRRAQAY+  AD   AE DI+KAL+IDP NREVK+  +  K
Sbjct  473  AIRLCSKVLDYEFYNVKALYRRAQAYMETADLVSAELDIRKALDIDPVNREVKMLERSLK  532

Query  281  ekvkeynkKDAKFYGNMFAKLSK  213
            +   E N++DAK Y NMFA ++K
Sbjct  533  QLQAESNRRDAKVYSNMFAWMTK  555



>ref|XP_010096077.1| Peptidyl-prolyl cis-trans isomerase FKBP65 [Morus notabilis]
 gb|EXB63110.1| Peptidyl-prolyl cis-trans isomerase FKBP65 [Morus notabilis]
Length=586

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFK+GKY RA+K+Y+K A+++  + SF ++  K +K L++SC LN AAC LKL D++ 
Sbjct  409  NLLFKSGKYQRAAKKYDKAAEYVSEEISFGDDVLKLAKPLRLSCWLNGAACSLKLNDFQG  468

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A +LC+KVL++E  NVKALYRRAQAY+  AD  LAE DIKKALE DP+NREVKL  +  K
Sbjct  469  AIELCSKVLDVEFHNVKALYRRAQAYMGNADLILAELDIKKALEADPENREVKLIQRNLK  528

Query  281  ekvkeynkKDAKFYGNMFAK  222
            +   E NK+DAK Y NMFA+
Sbjct  529  QLQVESNKRDAKLYANMFAR  548



>gb|KDO52833.1| hypothetical protein CISIN_1g036950mg [Citrus sinensis]
Length=469

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 120/181 (66%), Gaps = 28/181 (15%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MNTQEKIEAAGKKKEEGNVLFKAGKY RASKRYE+   +I YD+SFS+EEK+Q+K LKI+
Sbjct  281  MNTQEKIEAAGKKKEEGNVLFKAGKYERASKRYEQAVNYIGYDSSFSDEEKQQAKVLKIT  340

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            CNLNNAACKLKLK+YK+AEKLC+KVLEL+                       + DIKKAL
Sbjct  341  CNLNNAACKLKLKEYKQAEKLCSKVLELD-----------------------KLDIKKAL  377

Query  332  EIDPDNRevkleykvxkekvkeynkK-----DAKFYGNMFAKLSKPEPFSSNKSAPQEAE  168
            EIDPDN          + K+ +   +     D +FYGN+FAK++K E   S  S  ++  
Sbjct  378  EIDPDNSLEAGWGVRMEYKLLKEKVREYNKKDVQFYGNIFAKINKLEQAKSASSMAKQEP  437

Query  167  A  165
            A
Sbjct  438  A  438



>gb|KDP41599.1| hypothetical protein JCGZ_16006 [Jatropha curcas]
Length=601

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 116/160 (73%), Gaps = 0/160 (0%)
 Frame = -3

Query  692  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  513
            MN QEKIEAA  KKEEGN+LFK+GKY +A K+Y+K   ++  + SF + E+K  K+L +S
Sbjct  396  MNNQEKIEAACIKKEEGNLLFKSGKYQKAGKKYDKAVDYVVEEESFGDNEQKLVKSLIVS  455

Query  512  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  333
            C LN AAC LKL D + A KLC+KVL++E  NVKALYRRAQAYI   D   AE DIKKAL
Sbjct  456  CWLNGAACSLKLDDLQGAIKLCSKVLDIEYNNVKALYRRAQAYIRILDLFSAEVDIKKAL  515

Query  332  EIDPDNRevkleykvxkekvkeynkKDAKFYGNMFAKLSK  213
            E+DP +REVK   K+ K+   E NK+DAK Y NMFA ++K
Sbjct  516  EVDPQSREVKSLQKMLKQLQAESNKRDAKLYSNMFAHMTK  555



>ref|XP_011040722.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Populus 
euphratica]
Length=489

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NVLFKAGK+ RASK+YEK AK+IE+D SF++EE   +K+L++SC LNN+ACKLK  ++ E
Sbjct  348  NVLFKAGKFWRASKKYEKAAKYIEFDHSFTDEEMCLAKSLRLSCYLNNSACKLKSGEFLE  407

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNR  312
            A +LCTKVLEL+  NVKAL+RR+QA++  ++ + AE DIKKAL IDP+NR
Sbjct  408  ASRLCTKVLELDPLNVKALFRRSQAFLKTSELEKAEADIKKALAIDPNNR  457



>ref|XP_011040721.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Populus 
euphratica]
Length=535

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            NVLFKAGK+ RASK+YEK AK+IE+D SF++EE   +K+L++SC LNN+ACKLK  ++ E
Sbjct  394  NVLFKAGKFWRASKKYEKAAKYIEFDHSFTDEEMCLAKSLRLSCYLNNSACKLKSGEFLE  453

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNR  312
            A +LCTKVLEL+  NVKAL+RR+QA++  ++ + AE DIKKAL IDP+NR
Sbjct  454  ASRLCTKVLELDPLNVKALFRRSQAFLKTSELEKAEADIKKALAIDPNNR  503



>ref|XP_010090815.1| Peptidyl-prolyl cis-trans isomerase FKBP65 [Morus notabilis]
 gb|EXC36632.1| Peptidyl-prolyl cis-trans isomerase FKBP65 [Morus notabilis]
Length=586

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFK+GKY RA+K+Y+K A+++  + SF ++  K +K L++SC LN  AC LKL D++ 
Sbjct  409  NLLFKSGKYQRAAKKYDKAAEYVSEEISFGDDVLKLAKPLRLSCWLNGVACSLKLNDFQG  468

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvxk  282
            A +LC+KVL++E  NVKALYRRAQAY+  AD  LAE DIKKALE DP+NREVKL  +  K
Sbjct  469  AIELCSKVLDVEFHNVKALYRRAQAYMGNADLILAELDIKKALEADPENREVKLIQRNLK  528

Query  281  ekvkeynkKDAKFYGNMFAK  222
            +   E NK+DAK Y NMFA+
Sbjct  529  QLQVESNKRDAKLYANMFAR  548



>ref|XP_004493326.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Cicer arietinum]
Length=527

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -3

Query  641  NVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKE  462
            N+LFKA  + RAS++YEK  K+IE+D +FS+ EK+ + +L++SCNLNNAACKLKL +Y E
Sbjct  386  NLLFKAQNFRRASQKYEKAVKYIEFDHTFSDGEKRHANSLRLSCNLNNAACKLKLGEYTE  445

Query  461  AEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNR  312
              KLCTKVLE +  NVKALYRR QAY+  +D + AE DIK+AL IDP+NR
Sbjct  446  TAKLCTKVLEQDHLNVKALYRRCQAYLKTSDLEKAEADIKRALIIDPNNR  495



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340