BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF022P01

Length=672
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011072995.1|  PREDICTED: phosphoethanolamine N-methyltrans...    168   1e-70   Sesamum indicum [beniseed]
ref|XP_011084235.1|  PREDICTED: phosphoethanolamine N-methyltrans...    167   2e-70   Sesamum indicum [beniseed]
ref|XP_011084227.1|  PREDICTED: phosphoethanolamine N-methyltrans...    167   2e-70   Sesamum indicum [beniseed]
ref|XP_004299531.1|  PREDICTED: phosphomethylethanolamine N-methy...    164   1e-69   Fragaria vesca subsp. vesca
ref|XP_009782224.1|  PREDICTED: phosphoethanolamine N-methyltrans...    166   1e-69   Nicotiana sylvestris
ref|NP_001234549.1|  phosphoethanolamine N-methyltransferase            163   2e-69   Solanum lycopersicum
ref|XP_009776424.1|  PREDICTED: phosphoethanolamine N-methyltrans...    162   2e-69   Nicotiana sylvestris
ref|XP_009614862.1|  PREDICTED: phosphoethanolamine N-methyltrans...    162   4e-69   Nicotiana tomentosiformis
ref|XP_006341528.1|  PREDICTED: phosphoethanolamine N-methyltrans...    162   5e-69   Solanum tuberosum [potatoes]
ref|XP_009757363.1|  PREDICTED: phosphoethanolamine N-methyltrans...    162   5e-69   Nicotiana sylvestris
ref|XP_006843796.1|  hypothetical protein AMTR_s00007p00250490          166   6e-69   Amborella trichopoda
ref|XP_004241642.1|  PREDICTED: phosphoethanolamine N-methyltrans...    166   7e-69   Solanum lycopersicum
ref|XP_009595958.1|  PREDICTED: phosphoethanolamine N-methyltrans...    167   7e-69   Nicotiana tomentosiformis
ref|XP_006365411.1|  PREDICTED: phosphoethanolamine N-methyltrans...    166   1e-68   Solanum tuberosum [potatoes]
ref|XP_011039130.1|  PREDICTED: phosphomethylethanolamine N-methy...    164   1e-68   Populus euphratica
ref|XP_010033717.1|  PREDICTED: phosphoethanolamine N-methyltrans...    162   2e-68   Eucalyptus grandis [rose gum]
ref|XP_008240154.1|  PREDICTED: phosphoethanolamine N-methyltrans...    159   2e-68   
ref|XP_008240152.1|  PREDICTED: phosphoethanolamine N-methyltrans...    159   3e-68   Prunus mume [ume]
gb|EYU24136.1|  hypothetical protein MIMGU_mgv1a005261mg                160   3e-68   Erythranthe guttata [common monkey flower]
gb|AFW04224.1|  phosphoethanolamine N-methyl transferase                164   4e-68   Suaeda maritima
dbj|BAC57432.1|  phosphoethanolamine N-methyltransferase                164   4e-68   Suaeda japonica
ref|XP_009616694.1|  PREDICTED: phosphoethanolamine N-methyltrans...    159   5e-68   Nicotiana tomentosiformis
pir||H96762  hypothetical protein F6D5.1 [imported] - Arabidopsis...    161   7e-68
gb|ABG57185.1|  phosphoethanolamine N-methyltransferase                 166   1e-67   Salicornia europaea [chicken-claws]
emb|CBI26877.3|  unnamed protein product                                164   1e-67   Vitis vinifera
gb|ABK42071.1|  phosphoethanolamine N-methyltransferase                 162   1e-67   Suaeda liaotungensis
ref|NP_974139.2|  putative phosphoethanolamine N-methyltransferase 3    160   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177501.2|  putative phosphoethanolamine N-methyltransferase 3    160   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010655490.1|  PREDICTED: phosphomethylethanolamine N-methy...    163   2e-67   Vitis vinifera
ref|XP_011014101.1|  PREDICTED: phosphomethylethanolamine N-methy...    159   3e-67   Populus euphratica
gb|AAG52075.1|AC012679_13  putative S-adenosyl-methionine-sterol-...    160   4e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006451624.1|  hypothetical protein CICLE_v10010749mg             161   4e-67   Citrus clementina [clementine]
dbj|BAE99185.1|  putative phosphoethanolamine N-methyltransferase       160   5e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002317876.2|  hypothetical protein POPTR_0012s044901g            159   5e-67   
ref|XP_010428286.1|  PREDICTED: phosphoethanolamine N-methyltrans...    158   5e-67   Camelina sativa [gold-of-pleasure]
ref|XP_006376720.1|  hypothetical protein POPTR_0012s044901g            159   6e-67   
gb|AFZ78648.1|  methyl transferase                                      159   6e-67   Populus tomentosa [Chinese white poplar]
ref|XP_010428285.1|  PREDICTED: phosphoethanolamine N-methyltrans...    158   6e-67   Camelina sativa [gold-of-pleasure]
ref|XP_006490771.1|  PREDICTED: phosphoethanolamine N-methyltrans...    160   6e-67   
ref|XP_011008809.1|  PREDICTED: phosphomethylethanolamine N-methy...    158   8e-67   Populus euphratica
ref|XP_011008808.1|  PREDICTED: phosphomethylethanolamine N-methy...    159   9e-67   Populus euphratica
emb|CDY11100.1|  BnaC06g23520D                                          157   1e-66   Brassica napus [oilseed rape]
emb|CDX68222.1|  BnaA07g22620D                                          157   1e-66   
ref|XP_009104804.1|  PREDICTED: phosphoethanolamine N-methyltrans...    157   1e-66   Brassica rapa
ref|XP_006390538.1|  hypothetical protein EUTSA_v10018431mg             156   1e-66   Eutrema salsugineum [saltwater cress]
ref|XP_008364653.1|  PREDICTED: phosphoethanolamine N-methyltrans...    150   2e-66   
gb|AGI56231.1|  phosphoethanolamine N-methyltransferase                 153   2e-66   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_010686587.1|  PREDICTED: phosphoethanolamine N-methyltrans...    159   2e-66   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAE07178.1|  phosphoethanolamine N-methyltransferase                159   2e-66   Beta vulgaris [beet]
ref|XP_010416170.1|  PREDICTED: phosphoethanolamine N-methyltrans...    156   3e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010471422.1|  PREDICTED: phosphoethanolamine N-methyltrans...    155   4e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010471421.1|  PREDICTED: phosphoethanolamine N-methyltrans...    155   4e-66   Camelina sativa [gold-of-pleasure]
ref|XP_009356042.1|  PREDICTED: phosphoethanolamine N-methyltrans...    150   5e-66   Pyrus x bretschneideri [bai li]
ref|XP_008453479.1|  PREDICTED: phosphoethanolamine N-methyltrans...    152   8e-66   Cucumis melo [Oriental melon]
ref|XP_006346642.1|  PREDICTED: phosphoethanolamine N-methyltrans...    150   9e-66   Solanum tuberosum [potatoes]
ref|XP_010533969.1|  PREDICTED: phosphomethylethanolamine N-methy...    155   1e-65   Tarenaya hassleriana [spider flower]
gb|EPS65842.1|  hypothetical protein M569_08933                         149   2e-65   Genlisea aurea
ref|XP_010677350.1|  PREDICTED: phosphoethanolamine N-methyltrans...    157   2e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002322102.2|  hypothetical protein POPTR_0015s04540g             158   2e-65   
ref|XP_004252273.1|  PREDICTED: phosphomethylethanolamine N-methy...    148   2e-65   Solanum lycopersicum
ref|XP_010678114.1|  PREDICTED: phosphoethanolamine N-methyltrans...    154   3e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010461683.1|  PREDICTED: phosphomethylethanolamine N-methy...    153   3e-65   Camelina sativa [gold-of-pleasure]
gb|KJB30122.1|  hypothetical protein B456_005G132000                    154   4e-65   Gossypium raimondii
gb|KFK36082.1|  hypothetical protein AALP_AA4G075100                    153   4e-65   Arabis alpina [alpine rockcress]
ref|XP_006393387.1|  hypothetical protein EUTSA_v10011451mg             153   5e-65   
gb|KJB30117.1|  hypothetical protein B456_005G132000                    154   5e-65   Gossypium raimondii
gb|KJB30120.1|  hypothetical protein B456_005G132000                    154   5e-65   Gossypium raimondii
gb|KJB30118.1|  hypothetical protein B456_005G132000                    154   5e-65   Gossypium raimondii
ref|XP_010314226.1|  PREDICTED: phosphoethanolamine N-methyltrans...    148   7e-65   
sp|Q9M571.1|PEAMT_SPIOL  RecName: Full=Phosphoethanolamine N-meth...    152   8e-65   Spinacia oleracea
emb|CDX95799.1|  BnaC05g35500D                                          154   7e-64   
gb|KJB53040.1|  hypothetical protein B456_008G289900                    152   1e-63   Gossypium raimondii
gb|KJB53039.1|  hypothetical protein B456_008G289900                    152   1e-63   Gossypium raimondii
ref|XP_009145948.1|  PREDICTED: phosphoethanolamine N-methyltrans...    152   2e-63   Brassica rapa
ref|NP_001043957.1|  Os01g0695100                                       147   2e-63   
gb|EEE55232.1|  hypothetical protein OsJ_03109                          148   3e-63   Oryza sativa Japonica Group [Japonica rice]
emb|CDX92181.1|  BnaA05g22260D                                          150   6e-63   
gb|AAS57723.1|  phosphoethanolamine N-methyltransferase                 146   7e-63   Oryza sativa [red rice]
ref|XP_010097563.1|  hypothetical protein L484_017373                   145   1e-62   
ref|XP_006644536.1|  PREDICTED: phosphoethanolamine N-methyltrans...    149   2e-62   Oryza brachyantha
ref|XP_010465872.1|  PREDICTED: phosphoethanolamine N-methyltrans...    149   4e-62   Camelina sativa [gold-of-pleasure]
ref|NP_973993.1|  phosphoethanolamine N-methyltransferase 2             141   7e-62   Arabidopsis thaliana [mouse-ear cress]
gb|AAP83582.1|  phosphoethanolamine N-methyltransferase                 150   7e-62   Brassica napus [oilseed rape]
ref|NP_175293.1|  phosphoethanolamine N-methyltransferase 2             141   7e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010097561.1|  Phosphoethanolamine N-methyltransferase 1          155   2e-61   
ref|XP_006303987.1|  hypothetical protein CARUB_v10008968mg             141   2e-61   Capsella rubella
ref|XP_004137342.1|  PREDICTED: phosphoethanolamine N-methyltrans...    141   3e-61   Cucumis sativus [cucumbers]
ref|XP_010461752.1|  PREDICTED: phosphomethylethanolamine N-methy...    138   4e-61   Camelina sativa [gold-of-pleasure]
ref|XP_004166030.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoethan...    141   1e-60   
emb|CDX93681.1|  BnaA06g03670D                                          132   2e-58   
ref|XP_009147956.1|  PREDICTED: phosphomethylethanolamine N-methy...    132   2e-58   Brassica rapa
gb|KJB53038.1|  hypothetical protein B456_008G289900                    132   9e-58   Gossypium raimondii
gb|AAF79705.1|AC020889_13  T1N15.23                                     127   2e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CDY40594.1|  BnaC06g02100D                                          128   4e-57   Brassica napus [oilseed rape]
ref|XP_006406666.1|  hypothetical protein EUTSA_v10020595mg             130   7e-57   Eutrema salsugineum [saltwater cress]
ref|XP_002969650.1|  hypothetical protein SELMODRAFT_146547             143   7e-57   Selaginella moellendorffii
ref|XP_002970912.1|  hypothetical protein SELMODRAFT_270875             141   2e-56   Selaginella moellendorffii
emb|CAN75113.1|  hypothetical protein VITISV_043577                     122   6e-55   Vitis vinifera
ref|XP_010481025.1|  PREDICTED: phosphomethylethanolamine N-methy...    123   8e-55   
gb|KDO63824.1|  hypothetical protein CISIN_1g043471mg                   120   5e-52   Citrus sinensis [apfelsine]
gb|KJB30123.1|  hypothetical protein B456_005G132000                    120   2e-51   Gossypium raimondii
gb|ABK24808.1|  unknown                                                 115   9e-51   Picea sitchensis
gb|EAY75471.1|  hypothetical protein OsI_03371                          121   9e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_003619836.1|  Phosphoethanolamine N-methyltransferase            112   4e-49   Medicago truncatula
ref|XP_003619840.1|  Phosphoethanolamine N-methyltransferase            111   8e-49   
ref|XP_004512745.1|  PREDICTED: phosphoethanolamine N-methyltrans...    109   7e-47   Cicer arietinum [garbanzo]
ref|XP_004512744.1|  PREDICTED: phosphoethanolamine N-methyltrans...    109   7e-47   Cicer arietinum [garbanzo]
ref|XP_003528975.2|  PREDICTED: phosphoethanolamine N-methyltrans...    108   8e-47   
gb|AGM38074.1|  putative phosphoethanolamine N-methyltransferase        159   1e-45   Stenocereus gummosus
ref|XP_010774827.1|  PREDICTED: phosphoethanolamine N-methyltrans...    109   1e-45   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_004073222.1|  PREDICTED: phosphoethanolamine N-methyltrans...    110   1e-44   
ref|XP_007550439.1|  PREDICTED: phosphoethanolamine N-methyltrans...    109   3e-44   Poecilia formosa
ref|XP_009832411.1|  hypothetical protein H257_08283                    103   3e-44   Aphanomyces astaci
emb|CDO98349.1|  unnamed protein product                                165   4e-44   Coffea canephora [robusta coffee]
ref|XP_008324913.1|  PREDICTED: phosphoethanolamine N-methyltrans...    107   5e-44   Cynoglossus semilaevis [half-smooth tongue sole]
emb|CCA16454.1|  phosphoethanolamine Nmethyltransferase putative        105   5e-44   Albugo laibachii Nc14
ref|XP_002532097.1|  phosphoethanolamine n-methyltransferase, put...    164   6e-44   Ricinus communis
ref|XP_008324912.1|  PREDICTED: phosphoethanolamine N-methyltrans...    108   6e-44   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008324914.1|  PREDICTED: phosphoethanolamine N-methyltrans...    107   8e-44   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_004545582.1|  PREDICTED: phosphoethanolamine N-methyltrans...    109   8e-44   
ref|XP_004545581.1|  PREDICTED: phosphoethanolamine N-methyltrans...    109   8e-44   
ref|XP_005467627.1|  PREDICTED: phosphoethanolamine N-methyltrans...    109   9e-44   Oreochromis niloticus
ref|XP_003444639.1|  PREDICTED: phosphoethanolamine N-methyltrans...    109   9e-44   Oreochromis niloticus
ref|XP_005723168.1|  PREDICTED: phosphoethanolamine N-methyltrans...    109   1e-43   
ref|XP_005467629.1|  PREDICTED: phosphoethanolamine N-methyltrans...    109   1e-43   Oreochromis niloticus
ref|XP_005723167.1|  PREDICTED: phosphoethanolamine N-methyltrans...    109   1e-43   Pundamilia nyererei
ref|XP_005913450.1|  PREDICTED: phosphoethanolamine N-methyltrans...    109   1e-43   Haplochromis burtoni
ref|XP_005723169.1|  PREDICTED: phosphoethanolamine N-methyltrans...    109   1e-43   Pundamilia nyererei
ref|XP_005913451.1|  PREDICTED: phosphoethanolamine N-methyltrans...    109   1e-43   Haplochromis burtoni
ref|NP_001096276.2|  phosphoethanolamine methyltransferase              106   1e-43   Xenopus tropicalis [western clawed frog]
gb|AAI35513.1|  LOC100124841 protein                                    106   1e-43   Xenopus tropicalis [western clawed frog]
ref|NP_001070105.1|  phosphoethanolamine methyltransferase              108   2e-43   Danio rerio [leopard danio]
ref|XP_006781399.1|  PREDICTED: phosphoethanolamine N-methyltrans...    108   2e-43   Neolamprologus brichardi [lyretail cichlid]
ref|XP_003970259.1|  PREDICTED: phosphoethanolamine N-methyltrans...    105   2e-43   
emb|CBI26879.3|  unnamed protein product                                162   4e-43   Vitis vinifera
emb|CCI39434.1|  unnamed protein product                                102   6e-43   Albugo candida
ref|XP_010655650.1|  PREDICTED: phosphomethylethanolamine N-methy...    161   8e-43   Vitis vinifera
ref|XP_002284594.1|  PREDICTED: phosphoethanolamine N-methyltrans...    161   8e-43   Vitis vinifera
ref|XP_009385384.1|  PREDICTED: phosphoethanolamine N-methyltrans...    161   9e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_005806845.1|  PREDICTED: phosphoethanolamine N-methyltrans...    108   9e-43   Xiphophorus maculatus
ref|XP_008418601.1|  PREDICTED: phosphoethanolamine N-methyltrans...    105   2e-42   Poecilia reticulata
ref|XP_008418600.1|  PREDICTED: phosphoethanolamine N-methyltrans...    105   2e-42   Poecilia reticulata
gb|ELT87122.1|  hypothetical protein CAPTEDRAFT_189076                  100   3e-42   Capitella teleta
ref|NP_001167350.1|  phosphoethanolamine N-methyltransferase 3          104   3e-42   Salmo salar
ref|XP_010274723.1|  PREDICTED: phosphomethylethanolamine N-methy...    160   3e-42   Nelumbo nucifera [Indian lotus]
ref|XP_002887491.1|  predicted protein                                  160   3e-42   
ref|XP_005643867.1|  S-adenosyl-L-methionine-dependent methyltran...    120   4e-42   Coccomyxa subellipsoidea C-169
gb|EYU33965.1|  hypothetical protein MIMGU_mgv1a005263mg                159   4e-42   Erythranthe guttata [common monkey flower]
ref|XP_008278559.1|  PREDICTED: phosphoethanolamine N-methyltrans...    105   4e-42   Stegastes partitus
ref|XP_011453570.1|  PREDICTED: phosphoethanolamine N-methyltrans...    112   4e-42   Crassostrea gigas
ref|XP_010730439.1|  PREDICTED: phosphomethylethanolamine N-methy...    103   5e-42   
ref|XP_010730440.1|  PREDICTED: phosphomethylethanolamine N-methy...    103   5e-42   
ref|XP_008278560.1|  PREDICTED: phosphoethanolamine N-methyltrans...    105   5e-42   Stegastes partitus
ref|XP_011453569.1|  PREDICTED: phosphoethanolamine N-methyltrans...    112   5e-42   Crassostrea gigas
ref|XP_011453571.1|  PREDICTED: phosphoethanolamine N-methyltrans...    112   5e-42   Crassostrea gigas
ref|XP_002282182.1|  PREDICTED: phosphomethylethanolamine N-methy...    159   6e-42   Vitis vinifera
ref|XP_010263678.1|  PREDICTED: phosphoethanolamine N-methyltrans...    159   7e-42   Nelumbo nucifera [Indian lotus]
gb|KJB30119.1|  hypothetical protein B456_005G132000                    120   1e-41   Gossypium raimondii
emb|CAN64744.1|  hypothetical protein VITISV_041321                     158   1e-41   Vitis vinifera
ref|XP_006302164.1|  hypothetical protein CARUB_v10020173mg             158   1e-41   Capsella rubella
gb|ETP40953.1|  hypothetical protein F442_11791                         102   1e-41   Phytophthora parasitica P10297
ref|XP_010864863.1|  PREDICTED: phosphoethanolamine N-methyltrans...    103   2e-41   Esox lucius
ref|XP_007209942.1|  hypothetical protein PRUPE_ppa004742mg             157   2e-41   Prunus persica
ref|XP_002891445.1|  hypothetical protein ARALYDRAFT_473996             157   2e-41   
gb|AEY75253.1|  phosphoethanolamine N-methyltransferase                 157   2e-41   Atriplex canescens [shadscale]
gb|KFK41794.1|  hypothetical protein AALP_AA2G173000                    157   3e-41   Arabis alpina [alpine rockcress]
dbj|BAC57960.1|  phosphoethanolamine N-methyltransferase                157   3e-41   Tripolium pannonicum [sea starwort]
ref|NP_001056231.2|  Os05g0548900                                       150   4e-41   
ref|NP_001087172.1|  phosphoethanolamine methyltransferase              101   7e-41   Xenopus laevis [clawed frog]
ref|XP_010921205.1|  PREDICTED: phosphoethanolamine N-methyltrans...    155   8e-41   
ref|XP_010921197.1|  PREDICTED: phosphoethanolamine N-methyltrans...    155   1e-40   Elaeis guineensis
ref|XP_007228349.1|  PREDICTED: phosphoethanolamine N-methyltrans...    100   1e-40   
ref|XP_010921188.1|  PREDICTED: phosphoethanolamine N-methyltrans...    155   2e-40   
gb|KJB53041.1|  hypothetical protein B456_008G289900                    119   2e-40   Gossypium raimondii
ref|XP_002594089.1|  hypothetical protein BRAFLDRAFT_118790           99.0    2e-40   Branchiostoma floridae
gb|KDP23923.1|  hypothetical protein JCGZ_27083                         154   2e-40   Jatropha curcas
ref|XP_002898136.1|  phosphoethanolamine N-methyltransferase            100   2e-40   Phytophthora infestans T30-4
ref|XP_008360927.1|  PREDICTED: phosphoethanolamine N-methyltrans...    154   3e-40   
ref|XP_008393424.1|  PREDICTED: phosphoethanolamine N-methyltrans...    154   3e-40   
dbj|BAD80838.1|  phosphoethanolamine N-methyltransferase                154   3e-40   Atriplex nummularia
ref|XP_002441466.1|  hypothetical protein SORBIDRAFT_09g027360          154   6e-40   Sorghum bicolor [broomcorn]
ref|XP_002898137.1|  phosphoethanolamine N-methyltransferase, put...    100   6e-40   Phytophthora infestans T30-4
ref|XP_004969638.1|  PREDICTED: phosphoethanolamine N-methyltrans...    153   7e-40   Setaria italica
ref|XP_010519218.1|  PREDICTED: phosphoethanolamine N-methyltrans...    153   7e-40   Tarenaya hassleriana [spider flower]
ref|XP_004137500.1|  PREDICTED: phosphoethanolamine N-methyltrans...    153   7e-40   Cucumis sativus [cucumbers]
ref|XP_010519219.1|  PREDICTED: phosphoethanolamine N-methyltrans...    153   7e-40   Tarenaya hassleriana [spider flower]
ref|XP_004161835.1|  PREDICTED: phosphoethanolamine N-methyltrans...    154   8e-40   
ref|XP_002883100.1|  N-methyltransferase 1                              153   1e-39   
gb|AAM13092.1|  unknown protein                                         153   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188427.2|  phosphoethanolamine N-methyltransferase 1             153   1e-39   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB02720.1|  methyl transferase-like protein                        153   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008799222.1|  PREDICTED: phosphomethylethanolamine N-methy...    152   1e-39   
ref|XP_010921161.1|  PREDICTED: phosphoethanolamine N-methyltrans...    152   1e-39   Elaeis guineensis
ref|XP_008799219.1|  PREDICTED: phosphomethylethanolamine N-methy...    152   1e-39   Phoenix dactylifera
gb|KHG16117.1|  Phosphoethanolamine N-methyltransferase 1 -like p...    152   1e-39   Gossypium arboreum [tree cotton]
ref|XP_008799221.1|  PREDICTED: phosphomethylethanolamine N-methy...    152   1e-39   Phoenix dactylifera
ref|XP_010540184.1|  PREDICTED: phosphoethanolamine N-methyltrans...    152   2e-39   Tarenaya hassleriana [spider flower]
ref|XP_008464197.1|  PREDICTED: phosphoethanolamine N-methyltrans...    152   2e-39   Cucumis melo [Oriental melon]
ref|XP_005096335.1|  PREDICTED: phosphoethanolamine N-methyltrans...  98.6    3e-39   Aplysia californica
ref|XP_005096334.1|  PREDICTED: phosphoethanolamine N-methyltrans...  98.6    3e-39   Aplysia californica
gb|AFW78991.1|  hypothetical protein ZEAMMB73_932976                    149   4e-39   
gb|AER10512.1|  phosphoethanolamine N-methyltransferase                 151   4e-39   Pyrus betulifolia
gb|KFK39125.1|  hypothetical protein AALP_AA3G204100                    151   4e-39   Arabis alpina [alpine rockcress]
ref|XP_004137341.1|  PREDICTED: phosphoethanolamine N-methyltrans...    150   7e-39   Cucumis sativus [cucumbers]
emb|CDM83854.1|  unnamed protein product                                149   8e-39   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009012150.1|  hypothetical protein HELRODRAFT_183893             105   8e-39   Helobdella robusta
gb|EEC79642.1|  hypothetical protein OsI_20868                          150   9e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_006297517.1|  hypothetical protein CARUB_v10013541mg             150   9e-39   Capsella rubella
dbj|BAH01482.1|  unnamed protein product                                150   9e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009360079.1|  PREDICTED: phosphoethanolamine N-methyltrans...    150   1e-38   Pyrus x bretschneideri [bai li]
ref|XP_007036802.1|  S-adenosyl-L-methionine-dependent methyltran...    150   1e-38   
ref|XP_002456194.1|  hypothetical protein SORBIDRAFT_03g031950          150   1e-38   Sorghum bicolor [broomcorn]
ref|NP_001169597.1|  uncharacterized LOC100383478                       150   1e-38   Zea mays [maize]
ref|XP_009404071.1|  PREDICTED: phosphomethylethanolamine N-methy...    149   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010487709.1|  PREDICTED: phosphoethanolamine N-methyltrans...    149   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010487710.1|  PREDICTED: phosphoethanolamine N-methyltrans...    149   2e-38   Camelina sativa [gold-of-pleasure]
gb|EMT21187.1|  Phosphoethanolamine N-methyltransferase 1               149   3e-38   
gb|AGO59019.1|  heat responsive transcription factor protein            148   3e-38   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007209943.1|  hypothetical protein PRUPE_ppa004742mg             149   3e-38   
gb|EMT23240.1|  Phosphoethanolamine N-methyltransferase 1               149   3e-38   
gb|EMT23241.1|  Phosphoethanolamine N-methyltransferase 1               149   3e-38   
emb|CDM83845.1|  unnamed protein product                                149   4e-38   Triticum aestivum [Canadian hard winter wheat]
gb|AAL40895.1|  phosphoethanolamine methyltransferase                   149   4e-38   Triticum aestivum [Canadian hard winter wheat]
gb|ACV89824.1|  S-adenosyl-L-methionine:phosphoethanolamine N-met...    149   4e-38   Triticum aestivum [Canadian hard winter wheat]
gb|AAV67950.1|  putative phosphoethanolamine N-methyltransferase        148   4e-38   Zea mays [maize]
gb|EMS54147.1|  Phosphoethanolamine N-methyltransferase 1               149   4e-38   Triticum urartu
ref|XP_009061459.1|  hypothetical protein LOTGIDRAFT_219756           92.8    4e-38   Lottia gigantea
ref|XP_008675144.1|  PREDICTED: phosphoethanolamine N-methyltrans...    148   5e-38   
tpg|DAA57997.1|  TPA: putative phosphoethanolamine N-methyltransf...    148   5e-38   
ref|XP_008620240.1|  hypothetical protein SDRG_15834                  95.9    5e-38   Saprolegnia diclina VS20
ref|XP_001768934.1|  predicted protein                                  119   7e-38   
emb|CDY35847.1|  BnaC09g37790D                                          111   7e-38   Brassica napus [oilseed rape]
ref|XP_010506234.1|  PREDICTED: phosphoethanolamine N-methyltrans...    147   8e-38   Camelina sativa [gold-of-pleasure]
ref|XP_008620239.1|  hypothetical protein SDRG_15833                  95.1    8e-38   Saprolegnia diclina VS20
ref|XP_010506242.1|  PREDICTED: phosphoethanolamine N-methyltrans...    147   9e-38   Camelina sativa [gold-of-pleasure]
ref|XP_004961340.1|  PREDICTED: phosphoethanolamine N-methyltrans...    147   1e-37   Setaria italica
ref|XP_004166029.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoethan...    147   1e-37   
gb|KDO18852.1|  hypothetical protein SPRG_15851                       95.5    1e-37   Saprolegnia parasitica CBS 223.65
emb|CAG09731.1|  unnamed protein product                              96.7    1e-37   Tetraodon nigroviridis
ref|NP_001148925.1|  LOC100282545                                       146   2e-37   Zea mays [maize]
ref|XP_010231068.1|  PREDICTED: phosphomethylethanolamine N-methy...    146   3e-37   Brachypodium distachyon [annual false brome]
gb|AFW83642.1|  phosphoethanolamine N-methyltransferase                 146   3e-37   
ref|XP_003567962.1|  PREDICTED: phosphomethylethanolamine N-methy...    146   3e-37   Brachypodium distachyon [annual false brome]
ref|XP_006655550.1|  PREDICTED: phosphoethanolamine N-methyltrans...    145   4e-37   Oryza brachyantha
ref|XP_004969637.1|  PREDICTED: phosphoethanolamine N-methyltrans...    145   4e-37   Setaria italica
ref|XP_007036803.1|  S-adenosyl-L-methionine-dependent methyltran...    145   6e-37   
ref|XP_002456193.1|  hypothetical protein SORBIDRAFT_03g031940          145   6e-37   Sorghum bicolor [broomcorn]
gb|KDO18851.1|  hypothetical protein SPRG_15850                       93.2    6e-37   Saprolegnia parasitica CBS 223.65
gb|KDP23922.1|  hypothetical protein JCGZ_27082                         145   6e-37   Jatropha curcas
dbj|BAJ97525.1|  predicted protein                                      145   8e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003569614.1|  PREDICTED: phosphoethanolamine N-methyltrans...    145   8e-37   Brachypodium distachyon [annual false brome]
ref|XP_794381.2|  PREDICTED: phosphoethanolamine N-methyltransfer...  90.1    2e-36   
ref|XP_008799258.1|  PREDICTED: phosphomethylethanolamine N-methy...    143   3e-36   
ref|XP_001634828.1|  predicted protein                                92.4    1e-34   Nematostella vectensis
emb|CBY12280.1|  unnamed protein product                              89.0    2e-34   Oikopleura dioica
emb|CBY30945.1|  unnamed protein product                              89.0    1e-33   Oikopleura dioica
gb|KJB30121.1|  hypothetical protein B456_005G132000                    120   1e-33   Gossypium raimondii
emb|CDX72992.1|  BnaC06g34400D                                          102   4e-33   
ref|XP_001763293.1|  predicted protein                                  132   2e-32   
gb|ABX10444.1|  phosphoethanolamine N-methyltransferase                 125   5e-30   Gossypium hirsutum [American cotton]
ref|XP_006303561.1|  hypothetical protein CARUB_v10011038mg             125   5e-30   
gb|KHN10536.1|  Phosphoethanolamine N-methyltransferase                 125   7e-30   Glycine soja [wild soybean]
ref|XP_003525185.1|  PREDICTED: phosphoethanolamine N-methyltrans...    125   7e-30   
ref|XP_007160542.1|  hypothetical protein PHAVU_002G330400g             125   9e-30   Phaseolus vulgaris [French bean]
ref|XP_007209941.1|  hypothetical protein PRUPE_ppa004742mg             123   4e-29   
gb|ABK93894.1|  unknown                                                 114   8e-29   Populus trichocarpa [western balsam poplar]
gb|KFM82339.1|  Phosphoethanolamine N-methyltransferase               77.8    1e-28   Stegodyphus mimosarum
emb|CDQ99741.1|  unnamed protein product                              90.1    1e-28   Oncorhynchus mykiss
ref|XP_001614208.1|  phosphoethanolamine N-methyltransferase          77.8    5e-28   Plasmodium vivax
pdb|4IV0|A  Chain A, Crystal Structure Of N-methyl Transferase Fr...  77.8    6e-28   Plasmodium vivax Sal-1
pdb|4MWZ|A  Chain A, Crystal Structure Of N-methyl Transferase Fr...  77.8    6e-28   Plasmodium vivax Sal-1
ref|WP_027370921.1|  hypothetical protein                             79.3    6e-28   Desulfovermiculus halophilus
ref|XP_004223586.1|  phosphoethanolamine N-methyltransferase          78.2    1e-27   Plasmodium cynomolgi strain B
gb|AFK34318.1|  unknown                                                 114   1e-27   Lotus japonicus
ref|XP_008815737.1|  phosphoethanolamine N-methyltransferase          78.2    3e-27   Plasmodium inui San Antonio 1
ref|XP_008675146.1|  PREDICTED: phosphoethanolamine N-methyltrans...    117   4e-27   Zea mays [maize]
ref|XP_007152684.1|  hypothetical protein PHAVU_004G150500g             117   4e-27   Phaseolus vulgaris [French bean]
gb|KIZ00504.1|  hypothetical protein MNEG_7455                          111   4e-27   Monoraphidium neglectum
ref|XP_009525359.1|  hypothetical protein PHYSODRAFT_345888           77.0    7e-27   Phytophthora sojae
ref|XP_002259925.1|  phosphoethanolamine N-methyltransferase          75.9    2e-26   
pdb|4IV8|A  Chain A, Crystal Structure Of N-methyl Transferase Fr...  75.5    3e-26   
ref|WP_015250142.1|  methyltransferase family protein                 86.7    3e-26   
gb|AFK45429.1|  unknown                                                 113   6e-26   
ref|XP_004503268.1|  PREDICTED: phosphoethanolamine N-methyltrans...    114   7e-26   
gb|ETO16413.1|  hypothetical protein RFI_20925                        84.0    8e-26   
emb|CBY30905.1|  unnamed protein product                              73.6    8e-26   
ref|XP_003534138.1|  PREDICTED: phosphoethanolamine N-methyltrans...    113   9e-26   
ref|XP_003631125.1|  Phosphoethanolamine N-methyltransferase            113   1e-25   
ref|XP_010500398.1|  PREDICTED: phosphomethylethanolamine N-methy...    113   1e-25   
emb|CDY07952.1|  BnaC03g35710D                                          112   1e-25   
gb|AET05600.2|  phosphoethanolamine N-methyltransferase                 113   2e-25   
gb|ETL89749.1|  hypothetical protein L917_11367                       94.4    2e-25   
emb|CDX74572.1|  BnaA04g08170D                                          110   5e-25   
ref|XP_007160543.1|  hypothetical protein PHAVU_002G330400g             109   4e-24   
ref|XP_003631124.1|  Phosphoethanolamine N-methyltransferase            108   8e-24   
gb|KHN00145.1|  Phosphoethanolamine N-methyltransferase                 108   2e-23   
gb|ACF23047.1|  ST236                                                   100   2e-23   
gb|KEH21429.1|  phosphoethanolamine N-methyltransferase                 105   1e-22   
gb|KEH21430.1|  phosphoethanolamine N-methyltransferase                 104   1e-22   
emb|CDJ58552.1|  Sterol 24-C-methyltransferase, related               73.2    3e-22   
pdb|3UJ6|A  Chain A, Semet Phosphoethanolamine Methyltransferase ...  68.6    7e-22   
ref|XP_001350151.1|  phosphoethanolamine N-methyltransferase          68.9    7e-22   
gb|ETW47365.1|  hypothetical protein PFMALIP_04544                    68.9    7e-22   
pdb|3UJD|A  Chain A, Phosphoethanolamine Methyltransferase Mutant...  68.9    7e-22   
emb|CDJ43178.1|  hypothetical protein, conserved                      75.1    1e-21   
gb|ETW16777.1|  hypothetical protein PFFVO_04306                      68.9    1e-21   
ref|XP_008872791.1|  hypothetical protein H310_08714                    102   2e-21   
gb|EMT23242.1|  Putative phosphoethanolamine N-methyltransferase 2      100   2e-21   
emb|CDO66214.1|  phosphoethanolamine N-methyltransferase              68.9    3e-21   
gb|ETK83142.1|  hypothetical protein L915_11580                       94.7    5e-21   
emb|CDJ67597.1|  hypothetical protein, conserved                      69.3    7e-21   
pdb|4R6W|A  Chain A, Plasmodium Falciparum Phosphoethanolamine Me...  65.9    7e-21   
pdb|3UJC|A  Chain A, Phosphoethanolamine Methyltransferase Mutant...  65.5    9e-21   
ref|XP_006306318.1|  hypothetical protein CARUB_v10012188mg           69.3    3e-20   
emb|CDI77742.1|  hypothetical protein, conserved                      64.3    2e-19   
gb|ADV61410.1|  Methyltransferase type 11                             66.2    9e-19   
gb|KHN87001.1|  Phosphoethanolamine N-methyltransferase 1             62.8    2e-18   
ref|XP_007440631.1|  PREDICTED: phosphomethylethanolamine N-methy...  92.4    4e-18   
ref|XP_011399976.1|  Phosphoethanolamine N-methyltransferase          92.4    4e-18   
gb|EFX73213.1|  hypothetical protein DAPPUDRAFT_58148                 92.4    4e-18   
emb|CEF62382.1|  Hypothetical protein SRAE_1000065500                 58.9    9e-18   
emb|CBY31441.1|  unnamed protein product                              62.0    9e-17   
emb|CBY10458.1|  unnamed protein product                              62.0    1e-16   
gb|EGT43583.1|  CBN-PMT-2 protein                                     58.9    3e-16   
ref|NP_504248.1|  Protein PMT-2                                       60.5    3e-16   
pdb|4INE|A  Chain A, Crystal Structure Of N-methyl Transferase (p...  60.5    4e-16   
ref|XP_003115237.1|  CRE-PMT-2 protein                                59.3    8e-16   
ref|XP_005843496.1|  hypothetical protein CHLNCDRAFT_141021           78.2    1e-14   
ref|WP_030008425.1|  hypothetical protein                             55.8    2e-14   
gb|AGH25525.1|  phosphoethanolamine N-methyltransferase               75.9    2e-14   
gb|ETM43020.1|  hypothetical protein L914_11418                       70.1    2e-12   
gb|EYC15765.1|  hypothetical protein Y032_0036g3344                   75.9    2e-12   
emb|CEG03634.1|  unnamed protein product                              70.1    2e-12   
gb|EEH25635.1|  cyclopropane-fatty-acyl-phospholipid synthase         52.0    3e-12   
gb|KGS61388.1|  ubiE/COQ5 methyltransferase family protein            52.0    4e-12   
ref|WP_009948102.1|  MULTISPECIES: methyltransferase                  52.0    4e-12   
ref|WP_038733335.1|  methyltransferase                                52.0    4e-12   
ref|WP_010118738.1|  methyltransferase                                54.3    4e-12   
ref|WP_041190171.1|  methyltransferase                                52.0    4e-12   
ref|WP_038773359.1|  methyltransferase                                52.4    5e-12   
ref|WP_038742287.1|  methyltransferase                                52.4    5e-12   
ref|WP_038787099.1|  methyltransferase                                52.4    6e-12   
gb|EBA45191.1|  cyclopropane-fatty-acyl-phospholipid synthase         52.0    6e-12   
ref|WP_017844165.1|  methyltransferase                                52.4    6e-12   
ref|WP_038793751.1|  MULTISPECIES: methyltransferase                  52.0    6e-12   
gb|EET03909.1|  cyclopropane-fatty-acyl-phospholipid synthase         52.0    6e-12   
ref|WP_004531806.1|  MULTISPECIES: methyltransferase                  52.4    6e-12   
ref|WP_038727077.1|  methyltransferase                                52.0    6e-12   
ref|WP_011325999.1|  MULTISPECIES: methyltransferase                  52.4    6e-12   
ref|WP_010108956.1|  methyltransferase                                53.5    6e-12   
ref|WP_038779212.1|  methyltransferase                                52.0    6e-12   
ref|WP_004532962.1|  methyltransferase                                52.4    7e-12   
ref|WP_038749925.1|  methyltransferase                                52.0    7e-12   
ref|WP_038793743.1|  methyltransferase                                52.0    7e-12   
gb|EDO87536.1|  cyclopropane-fatty-acyl-phospholipid synthase         52.0    7e-12   
gb|ABN93730.1|  cyclopropane-fatty-acyl-phospholipid synthase         52.0    7e-12   
ref|WP_038799888.1|  methyltransferase                                52.0    7e-12   
gb|KGS76095.1|  ubiE/COQ5 methyltransferase family protein            52.0    7e-12   
gb|KGC36951.1|  ubiE/COQ5 methyltransferase family protein            52.0    7e-12   
gb|EES21972.1|  cyclopropane-fatty-acyl-phospholipid synthase         52.0    7e-12   
ref|WP_041191926.1|  methyltransferase                                51.6    9e-12   
ref|WP_038744912.1|  methyltransferase                                52.4    1e-11   
ref|WP_044253490.1|  hypothetical protein                             55.1    1e-11   
ref|WP_023696414.1|  MULTISPECIES: SAM-dependent methlyltransferase   53.9    2e-11   
ref|WP_044353071.1|  methyltransferase                                52.4    2e-11   
ref|WP_038755336.1|  methyltransferase                                52.4    2e-11   
gb|ABN86795.1|  cyclopropane-fatty-acyl-phospholipid synthase         52.4    2e-11   
ref|WP_023751672.1|  SAM-dependent methlyltransferase                 53.9    2e-11   
emb|CDJ34460.1|  Tocopherol o-methyltransferase, related              57.0    2e-11   
ref|WP_038749813.1|  methyltransferase                                52.0    2e-11   
ref|WP_023690119.1|  MULTISPECIES: SAM-dependent methlyltransferase   53.5    2e-11   
gb|ETN82894.1|  methyltransferase domain protein                      72.0    3e-11   
ref|WP_023816426.1|  MULTISPECIES: SAM-dependent methlyltransferase   52.0    3e-11   
ref|WP_023715007.1|  SAM-dependent methlyltransferase                 52.8    3e-11   
ref|WP_023806546.1|  SAM-dependent methlyltransferase                 52.8    4e-11   
ref|WP_004557577.1|  phosphoethanolamine N-methyltransferase          52.4    4e-11   
ref|WP_023683953.1|  MULTISPECIES: SAM-dependent methlyltransferase   52.8    4e-11   
ref|WP_038730130.1|  methyltransferase                                52.4    4e-11   
ref|WP_038739292.1|  MULTISPECIES: methyltransferase                  52.4    4e-11   
ref|WP_038775589.1|  methyltransferase                                52.4    4e-11   
gb|KIH55493.1|  methyltransferase domain protein                      71.2    4e-11   
ref|WP_031199857.1|  SAM-dependent methlyltransferase                 50.8    4e-11   
ref|WP_023737415.1|  MULTISPECIES: SAM-dependent methlyltransferase   51.2    5e-11   
ref|WP_023730784.1|  SAM-dependent methlyltransferase                 50.8    5e-11   
gb|AAM97038.1|  phosphoethanolamine N-methyltransferase, putative     69.3    2e-10   
gb|EYC15763.1|  hypothetical protein Y032_0036g3344                   69.7    2e-10   
ref|WP_037711497.1|  hypothetical protein                             48.1    4e-10   
gb|ETK83144.1|  hypothetical protein L915_11579                       68.2    4e-10   
gb|KHG05875.1|  Phosphoethanolamine N-methyltransferase 1 -like p...  66.6    5e-10   
ref|WP_031208770.1|  MULTISPECIES: SAM-dependent methlyltransferase   50.1    9e-10   
ref|WP_042734046.1|  hypothetical protein                             53.1    1e-09   
ref|WP_013892685.1|  SAM-dependent methlyltransferase                 49.3    1e-09   
ref|WP_023763768.1|  SAM-dependent methlyltransferase                 49.7    2e-09   
pdb|4KRH|A  Chain A, Semet Haemonchus Contortus Phosphoethanolami...  66.2    2e-09   
pdb|4KRI|A  Chain A, Haemonchus Contortus Phospholethanolamine N-...  66.2    2e-09   
emb|CDJ96940.1|  Methyltransferase type 11 domain containing protein  66.2    2e-09   
ref|WP_027031419.1|  SAM-dependent methlyltransferase                 48.9    2e-09   
ref|WP_006201234.1|  SAM-dependent methlyltransferase                 49.7    3e-09   
ref|WP_023776863.1|  SAM-dependent methlyltransferase                 49.3    3e-09   
ref|WP_015877778.1|  methyltransferase                                55.5    3e-09   
emb|CDX96485.1|  BnaA07g30960D                                        61.6    3e-09   
gb|KGT03169.1|  ubiE/COQ5 methyltransferase family protein            52.4    3e-09   
ref|XP_009106017.1|  PREDICTED: phosphoethanolamine N-methyltrans...  62.8    4e-09   
ref|WP_006328098.1|  Methyltransferase type 11                        48.9    5e-09   
ref|WP_019861572.1|  SAM-dependent methlyltransferase                 47.8    7e-09   
gb|AID32842.1|  methyltransferase domain protein                      47.8    8e-09   
ref|XP_006584908.1|  PREDICTED: phosphoethanolamine N-methyltrans...  60.1    1e-08   
ref|WP_027059070.1|  SAM-dependent methlyltransferase                 49.3    1e-08   
ref|WP_008873958.1|  Methyltransferase type 11                        45.1    2e-08   
ref|WP_020055656.1|  hypothetical protein                             48.9    2e-08   
ref|WP_032931948.1|  SAM-dependent methlyltransferase                 45.1    2e-08   
ref|WP_023720903.1|  SAM-dependent methlyltransferase                 47.4    2e-08   
ref|WP_027023426.1|  SAM-dependent methlyltransferase                 46.2    2e-08   
ref|XP_002433524.1|  hypothetical protein IscW_ISCW024094             58.5    4e-08   
ref|WP_027166568.1|  SAM-dependent methlyltransferase                 46.2    4e-08   
gb|ETO71741.1|  hypothetical protein F444_11962                       57.8    5e-08   
ref|WP_037268547.1|  SAM-dependent methlyltransferase                 49.7    1e-07   
ref|WP_042628692.1|  methyltransferase                                52.4    1e-07   
gb|EHK58080.1|  type 11 methyltransferase                             53.5    1e-07   
ref|WP_040585126.1|  SAM-dependent methlyltransferase                 53.5    2e-07   
ref|WP_038308171.1|  hypothetical protein                             51.2    2e-07   
ref|XP_002635479.1|  C. briggsae CBR-PMT-2 protein                    60.1    3e-07   
gb|EKD22724.1|  UbiE/COQ5 family methyltransferase                    57.8    5e-07   
ref|XP_002413140.1|  phosphoethanolamine N-methyltransferase, put...  56.2    7e-07   
ref|WP_009819402.1|  SAM-dependent methlyltransferase                 52.8    8e-07   
ref|WP_038032172.1|  SAM-dependent methyltransferase                  56.6    9e-07   
gb|ETN87599.1|  SAM-dependent methyltransferase                       56.6    9e-07   
ref|WP_018815183.1|  hypothetical protein                             57.8    1e-06   
ref|WP_041107317.1|  SAM-dependent methyltransferase                  57.4    2e-06   
ref|WP_041906306.1|  hypothetical protein                             54.3    2e-06   
ref|WP_043219017.1|  SAM-dependent methyltransferase                  56.6    3e-06   
ref|WP_020623667.1|  hypothetical protein                             56.6    3e-06   
gb|ADI22186.1|  SAM-dependent methyltransferases                      56.2    3e-06   
sp|Q9KJ21.1|SDMT_HALHR  RecName: Full=Sarcosine/dimethylglycine N...  47.0    3e-06   
ref|WP_030080389.1|  MULTISPECIES: hypothetical protein               56.6    3e-06   
ref|WP_034713070.1|  SAM-dependent methyltransferase                  56.2    3e-06   
gb|KIW31680.1|  hypothetical protein PV07_03289                       53.5    4e-06   
ref|WP_030735454.1|  hypothetical protein                             55.8    5e-06   
ref|WP_006606849.1|  type 11 methyltransferase                        51.6    5e-06   
ref|WP_037099126.1|  methyltransferase                                55.8    5e-06   
ref|WP_036346793.1|  hypothetical protein                             55.8    5e-06   
gb|EKD64845.1|  methyltransferase type 11                             55.8    5e-06   
ref|WP_022472517.1|  methylase involved in ubiquinone/menaquinone...  55.5    6e-06   
gb|ACY01395.1|  O-methyl transferase                                  51.2    7e-06   
ref|WP_028727891.1|  ubiquinone biosynthesis methyltransferase UbiE   55.1    7e-06   
ref|WP_030923435.1|  methyltransferase type 11                        54.7    8e-06   
ref|WP_024922895.1|  MULTISPECIES: SAM-dependent methlyltransferase   55.1    8e-06   
ref|WP_030463904.1|  methyltransferase type 11                        53.9    9e-06   
ref|WP_043325280.1|  hypothetical protein                             55.1    1e-05   
ref|WP_030503330.1|  hypothetical protein                             55.1    1e-05   
ref|WP_033217970.1|  methyltransferase type 11                        54.3    1e-05   
ref|WP_030881062.1|  methyltransferase type 11                        55.1    1e-05   
ref|WP_028305759.1|  methyltransferase                                54.7    1e-05   
ref|WP_035991846.1|  delta(24)-sterol C-methyltransferase             54.7    1e-05   
ref|WP_033039160.1|  methyltransferase type 11                        52.4    1e-05   
ref|WP_043999694.1|  delta(24)-sterol C-methyltransferase             52.0    1e-05   
ref|WP_029386413.1|  hypothetical protein                             54.7    1e-05   
ref|WP_040575199.1|  hypothetical protein                             53.1    2e-05   
ref|WP_026421232.1|  hypothetical protein                             49.7    2e-05   
ref|WP_026185928.1|  methyltransferase                                54.3    2e-05   
ref|WP_042519465.1|  MULTISPECIES: ubiquinone biosynthesis methyl...  53.9    2e-05   
ref|WP_044075131.1|  ubiquinone biosynthesis methyltransferase UbiE   53.9    2e-05   
emb|CCI14044.1|  Tocopherol O-methyltransferase, chloroplastic        52.0    2e-05   
ref|WP_022317354.1|  demethylmenaquinone methyltransferase            53.9    2e-05   
ref|WP_023734633.1|  SAM-dependent methlyltransferase                 54.3    2e-05   
ref|WP_043186512.1|  hypothetical protein                             52.4    2e-05   
ref|WP_027268740.1|  delta(24)-sterol C-methyltransferase             54.3    2e-05   
ref|WP_023756036.1|  MULTISPECIES: hypothetical protein               53.9    2e-05   
ref|WP_018745107.1|  hypothetical protein                             53.9    3e-05   
ref|WP_033256340.1|  methyltransferase type 11                        53.9    3e-05   
emb|CCI34341.1|  Tocopherol O-methyltransferase, chloroplastic        51.2    3e-05   
ref|WP_039900615.1|  delta(24)-sterol C-methyltransferase             51.2    3e-05   
ref|WP_023727283.1|  SAM-dependent methlyltransferase                 53.5    3e-05   
emb|CDN15041.1|  Gamma-tocopherol C-methyltransferase                 53.5    3e-05   
ref|WP_026404025.1|  methyltransferase type 11                        49.3    3e-05   
ref|WP_037222369.1|  delta(24)-sterol C-methyltransferase             53.5    3e-05   
ref|WP_002698863.1|  dimethylglycine methyltransferase                53.5    3e-05   
ref|WP_037156905.1|  methyltransferase                                53.5    3e-05   
gb|ADI22300.1|  SAM-dependent methyltransferases                      53.1    3e-05   
ref|WP_034360655.1|  methyltransferase                                53.5    3e-05   
ref|WP_023711680.1|  MULTISPECIES: SAM-dependent methlyltransferase   53.5    3e-05   
ref|WP_002792896.1|  delta(24)-sterol C-methyltransferase             50.1    3e-05   
ref|WP_031292663.1|  hypothetical protein                             52.8    3e-05   
ref|WP_040409144.1|  hypothetical protein                             52.0    4e-05   
ref|WP_042188136.1|  methyltransferase type 11                        53.1    4e-05   
emb|CEL17786.1|  Methyltransferase                                    53.1    4e-05   
ref|WP_008280274.1|  SAM-dependent methlyltransferase                 53.1    4e-05   
ref|WP_023754158.1|  MULTISPECIES: SAM-dependent methlyltransferase   53.1    4e-05   
ref|WP_034273121.1|  methyltransferase type 11                        52.8    4e-05   
ref|WP_040026629.1|  methyltransferase type 11                        53.5    4e-05   
ref|WP_020482492.1|  hypothetical protein                             50.1    4e-05   
ref|WP_026601338.1|  methyltransferase type 11                        50.4    4e-05   
gb|AHE14746.1|  StaMB-like methyltransferase                          53.1    4e-05   
ref|WP_027463342.1|  methyltransferase                                53.1    4e-05   
ref|WP_018399120.1|  hypothetical protein                             53.1    4e-05   
ref|WP_002752031.1|  delta(24)-sterol C-methyltransferase             49.7    4e-05   
dbj|GAL92517.1|  gamma-tocopherol methyltransferase                   51.2    5e-05   
ref|WP_040029422.1|  hypothetical protein                             53.1    5e-05   
ref|WP_027289649.1|  hypothetical protein                             53.1    5e-05   
ref|WP_038841911.1|  methyltransferase type 11                        53.1    5e-05   



>ref|XP_011072995.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Sesamum 
indicum]
Length=491

 Score =   168 bits (426),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PS EFA YIKQRGYDLHD + YGQMLRDAGF++VIAEDRTDQF+KVL+KEL+AV
Sbjct  387  CRNDGTPSTEFAEYIKQRGYDLHDVKAYGQMLRDAGFDEVIAEDRTDQFIKVLEKELNAV  446

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEKEAFIQDFSEEDY+DIVGGWK KL R+SSGEQRWGL
Sbjct  447  EKEKEAFIQDFSEEDYSDIVGGWKAKLVRSSSGEQRWGL  485


 Score =   125 bits (315),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKK YPD TFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLI+DYC+
Sbjct  329  KCAVEFEVADCTKKEYPDGTFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLISDYCR  388

Query  492  GLDLP  478
                P
Sbjct  389  NDGTP  393



>ref|XP_011084235.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Sesamum indicum]
Length=491

 Score =   167 bits (424),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + SG PS EFA YIKQRGYDLHD + YGQMLRDAGF +VIAEDRT+QF+KVL+KELDAV
Sbjct  387  CRSSGTPSAEFAGYIKQRGYDLHDVDTYGQMLRDAGFAEVIAEDRTEQFIKVLEKELDAV  446

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+KE FI+DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  447  EKDKETFIRDFSEEDYNDIVGGWKAKLVRSSSGEQRWGL  485


 Score =   125 bits (315),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKK YPD TFDVIYSRDTILHIQDKPALFRSFY+WLKPGGKVLI+DYC+
Sbjct  329  KCAVEFEVADCTKKEYPDGTFDVIYSRDTILHIQDKPALFRSFYRWLKPGGKVLISDYCR  388

Query  492  GLDLP  478
                P
Sbjct  389  SSGTP  393



>ref|XP_011084227.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Sesamum indicum]
Length=494

 Score =   167 bits (424),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + SG PS EFA YIKQRGYDLHD + YGQMLRDAGF +VIAEDRT+QF+KVL+KELDAV
Sbjct  390  CRSSGTPSAEFAGYIKQRGYDLHDVDTYGQMLRDAGFAEVIAEDRTEQFIKVLEKELDAV  449

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+KE FI+DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  450  EKDKETFIRDFSEEDYNDIVGGWKAKLVRSSSGEQRWGL  488


 Score =   125 bits (314),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKK YPD TFDVIYSRDTILHIQDKPALFRSFY+WLKPGGKVLI+DYC+
Sbjct  332  KCAVEFEVADCTKKEYPDGTFDVIYSRDTILHIQDKPALFRSFYRWLKPGGKVLISDYCR  391

Query  492  GLDLP  478
                P
Sbjct  392  SSGTP  396



>ref|XP_004299531.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Fragaria vesca subsp. vesca]
Length=500

 Score =   164 bits (415),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + +G PS EFA YIKQRGYDLHD + YGQML DAGF DV+AEDRTDQF++VL++EL+AV
Sbjct  396  CRSAGTPSAEFAEYIKQRGYDLHDVKAYGQMLTDAGFVDVVAEDRTDQFIRVLQRELNAV  455

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+KEAFI+DFSEEDYNDIVGGWK KL RT+SGEQ+WGL
Sbjct  456  EKDKEAFIKDFSEEDYNDIVGGWKAKLVRTNSGEQKWGL  494


 Score =   126 bits (317),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCT KTYPD +FDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYC+
Sbjct  338  KCAVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCR  397

Query  492  GLDLP  478
                P
Sbjct  398  SAGTP  402



>ref|XP_009782224.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=496

 Score =   166 bits (419),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 90/100 (90%), Gaps = 1/100 (1%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +++GP SEEFA YIKQRGYDLHD E YGQMLRDAGF +V+AEDRT+QF+KVL+KELD V
Sbjct  392  CKKAGPASEEFAGYIKQRGYDLHDVEAYGQMLRDAGFNEVVAEDRTEQFIKVLQKELDTV  451

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTR-TSSGEQRWGL  203
            EKE+E+FIQ+FSE+DYNDIVGGWK KL R TSSGEQRWGL
Sbjct  452  EKERESFIQEFSEKDYNDIVGGWKAKLIRSTSSGEQRWGL  491


 Score =   125 bits (313),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 56/60 (93%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTK TYP+ TFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLI+DYCK
Sbjct  334  KCAVEFEVADCTKTTYPEGTFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLISDYCK  393



>ref|NP_001234549.1| phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
 gb|AAG59894.1|AF328858_1 phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
Length=491

 Score =   163 bits (413),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +R+GP S+EF  YIKQRGYDLHD E YGQMLRDAGF +V+AEDRT+QF+KVL+KELD V
Sbjct  387  CKRAGPASKEFEGYIKQRGYDLHDVEAYGQMLRDAGFHEVVAEDRTEQFIKVLQKELDTV  446

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKE+E+FI +FSE+DYN+IVGGWK KL R+SSGEQRWGL
Sbjct  447  EKERESFIHEFSEQDYNEIVGGWKSKLIRSSSGEQRWGL  485


 Score =   126 bits (317),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 57/60 (95%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPALFRSFYKWL+PGGKVLI+DYCK
Sbjct  329  KCAVEFEVADCTKKTYPDCTFDVIYSRDTILHIQDKPALFRSFYKWLRPGGKVLISDYCK  388



>ref|XP_009776424.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
sylvestris]
Length=499

 Score =   162 bits (410),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  GP SEEFA YIKQRGYDLHD  EYGQMLRDAGF++VIAEDRT+QF+ VL+KEL+ V
Sbjct  395  CKSPGPASEEFAGYIKQRGYDLHDVAEYGQMLRDAGFDEVIAEDRTEQFINVLQKELNTV  454

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKE+++FIQ+FSE+DYN+IVGGWK KL R+SSGEQRWGL
Sbjct  455  EKERDSFIQEFSEQDYNEIVGGWKAKLIRSSSGEQRWGL  493


 Score =   127 bits (319),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 57/60 (95%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPALFRSFY+WLKPGGKVLI+DYCK
Sbjct  337  KCAVEFEVADCTKKTYPDGTFDVIYSRDTILHIQDKPALFRSFYRWLKPGGKVLISDYCK  396



>ref|XP_009614862.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=499

 Score =   162 bits (411),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  GP SEEFA YIKQRGYDLHD  EYGQMLRDAGF++VIAEDRT+QF+ VL+KEL+ V
Sbjct  395  CKSPGPASEEFAGYIKQRGYDLHDVAEYGQMLRDAGFDEVIAEDRTEQFINVLQKELNTV  454

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKE+++FIQ+FSE+DYN+IVGGWK KL R+SSGEQRWGL
Sbjct  455  EKERDSFIQEFSEQDYNEIVGGWKAKLIRSSSGEQRWGL  493


 Score =   126 bits (317),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 57/60 (95%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPALFRSFY WLKPGGKVLI+DYCK
Sbjct  337  KCAVEFEVADCTKKTYPDGTFDVIYSRDTILHIQDKPALFRSFYNWLKPGGKVLISDYCK  396



>ref|XP_006341528.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006341529.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Solanum tuberosum]
Length=491

 Score =   162 bits (409),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +R+GP S+EF  YIKQRGYDLHD E YGQMLRDAGF +V+AEDRT+QF++VL+KELD V
Sbjct  387  CKRAGPASKEFEGYIKQRGYDLHDVEAYGQMLRDAGFHEVVAEDRTEQFIEVLQKELDTV  446

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKE+E+FI +FSE+DYN+IVGGWK KL R+SSGEQRWGL
Sbjct  447  EKERESFIHEFSEQDYNEIVGGWKAKLIRSSSGEQRWGL  485


 Score =   126 bits (317),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 57/60 (95%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPALFRSFYKWL+PGGKVLI+DYCK
Sbjct  329  KCAVEFEVADCTKKTYPDCTFDVIYSRDTILHIQDKPALFRSFYKWLRPGGKVLISDYCK  388



>ref|XP_009757363.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=491

 Score =   162 bits (409),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +++G  SEEFA YIKQRGYDLHD E YGQMLRDAGF +V+AEDRT+QF+ VL+KELD V
Sbjct  387  CKKAGTASEEFAGYIKQRGYDLHDVEAYGQMLRDAGFNEVVAEDRTEQFIGVLQKELDTV  446

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKE+E+FI DFSE+DYN+IVGGWK KL R+SSGEQRWGL
Sbjct  447  EKERESFIHDFSEQDYNEIVGGWKAKLIRSSSGEQRWGL  485


 Score =   126 bits (317),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 57/60 (95%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKKTYPD  FDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLI+DYCK
Sbjct  329  KCAVEFEVADCTKKTYPDGAFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLISDYCK  388



>ref|XP_006843796.1| hypothetical protein AMTR_s00007p00250490 [Amborella trichopoda]
 gb|ERN05471.1| hypothetical protein AMTR_s00007p00250490 [Amborella trichopoda]
Length=489

 Score =   166 bits (421),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +RSGPPS EFA YIKQRGYDLHD E YGQMLRDAGF DV AEDRTDQF+KVL+KELDAV
Sbjct  385  CKRSGPPSPEFAEYIKQRGYDLHDVEAYGQMLRDAGFHDVTAEDRTDQFLKVLQKELDAV  444

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+K++FI DFSEEDY DIV GWK KL R+S GEQRWGL
Sbjct  445  EKDKDSFIGDFSEEDYFDIVNGWKAKLKRSSGGEQRWGL  483


 Score =   122 bits (305),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKKTYPD TFDV+YSRDTILHIQDKP+LFR+F+KWLKPGGKVLI+DYCK
Sbjct  327  KCAVEFEVADCTKKTYPDNTFDVMYSRDTILHIQDKPSLFRTFFKWLKPGGKVLISDYCK  386



>ref|XP_004241642.1| PREDICTED: phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
Length=494

 Score =   166 bits (421),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +++GP SE+FAAYIKQRGYDLHD E YGQMLRDAGF +VIA+DRT+QFM+VL+KELD V
Sbjct  390  CKKAGPASEDFAAYIKQRGYDLHDVEAYGQMLRDAGFNEVIADDRTEQFMQVLQKELDTV  449

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            E E+E FIQ+FSE+DYNDIVGGWK KL R+SSGEQRWGL
Sbjct  450  ENERELFIQEFSEQDYNDIVGGWKAKLVRSSSGEQRWGL  488


 Score =   122 bits (305),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCT KTYP+ +FDVIYSRDTILHIQDKPALFRSFYKWLKPGG+VLI+DYCK
Sbjct  332  KCAVEFEVADCTVKTYPEESFDVIYSRDTILHIQDKPALFRSFYKWLKPGGRVLISDYCK  391



>ref|XP_009595958.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=496

 Score =   167 bits (423),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 90/100 (90%), Gaps = 1/100 (1%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +R+GP SEEFA YIKQRGYDLHD E YGQMLRDAGF +V+AEDRT+QF+KVL+KELD V
Sbjct  392  CKRAGPASEEFAGYIKQRGYDLHDVEAYGQMLRDAGFNEVVAEDRTEQFIKVLQKELDTV  451

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTR-TSSGEQRWGL  203
            EKE+E+FIQ+FSE+DYNDIVGGWK KL R TSSGEQRWGL
Sbjct  452  EKERESFIQEFSEQDYNDIVGGWKAKLIRSTSSGEQRWGL  491


 Score =   120 bits (302),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTK TYP+ TFDVIYSRDTILHIQDK ALFRSFYKWLKPGGKVLI+DYCK
Sbjct  334  KCAVEFEVADCTKATYPEGTFDVIYSRDTILHIQDKLALFRSFYKWLKPGGKVLISDYCK  393



>ref|XP_006365411.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Solanum 
tuberosum]
Length=494

 Score =   166 bits (420),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             ++SGP SE+FA YIKQRGYDLHD E YGQMLRDAGF +VIAEDRT+QFMKVL+KELD V
Sbjct  390  CKKSGPASEDFAVYIKQRGYDLHDVEAYGQMLRDAGFNEVIAEDRTEQFMKVLQKELDIV  449

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            E E+E+FIQ+FSE+DY DIVGGWK KL R+SSGEQRWGL
Sbjct  450  ENERESFIQEFSEQDYYDIVGGWKAKLVRSSSGEQRWGL  488


 Score =   121 bits (304),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCT KTYP+ +FDVIYSRDTILHIQDKPALFRSFYKWLKPGG+VLI+DYCK
Sbjct  332  KCAVEFEVADCTVKTYPEESFDVIYSRDTILHIQDKPALFRSFYKWLKPGGRVLISDYCK  391



>ref|XP_011039130.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Populus 
euphratica]
Length=490

 Score =   164 bits (415),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +R+G PS EFA YIKQRGYDLHD E YGQMLRDAGF++VIAEDRTDQF +VL +EL+A+
Sbjct  386  CKRAGTPSPEFAEYIKQRGYDLHDVEAYGQMLRDAGFDEVIAEDRTDQFNQVLLRELNAI  445

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEK+ FI DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  446  EKEKDEFILDFSEEDYNDIVGGWKAKLIRSSSGEQRWGL  484


 Score =   123 bits (309),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT KTYPD TFDVIYSRDTILHIQDKPALFRSF+KWLKPGGKVLI+DYCK
Sbjct  328  KCSVEFEVADCTTKTYPDDTFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCK  387

Query  492  GLDLP  478
                P
Sbjct  388  RAGTP  392



>ref|XP_010033717.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Eucalyptus 
grandis]
 gb|KCW84063.1| hypothetical protein EUGRSUZ_B00946 [Eucalyptus grandis]
Length=491

 Score =   162 bits (411),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + +G PS EFAAYIKQRGYDLHD + YGQMLRDAGF +VIAEDRTDQF+KVL+KEL+AV
Sbjct  387  CKHAGTPSPEFAAYIKQRGYDLHDVKAYGQMLRDAGFAEVIAEDRTDQFIKVLEKELNAV  446

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+K+ FI DFSEEDYNDIVGGWK KL R+SS EQ WGL
Sbjct  447  EKDKDTFISDFSEEDYNDIVGGWKAKLMRSSSSEQCWGL  485


 Score =   124 bits (312),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK+YPD TFDVIYSRDTILHIQDKPALFRSF+KWLKPGGKVLI+DYCK
Sbjct  329  KCSVEFEVADCTKKSYPDNTFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCK  388

Query  492  GLDLP  478
                P
Sbjct  389  HAGTP  393



>ref|XP_008240154.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X2 [Prunus mume]
Length=485

 Score =   159 bits (403),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + +G PS EFA YIKQRGYDLHD + YGQML+DAGF++VIAEDRTDQF +VL++ELDAV
Sbjct  381  CRSAGTPSAEFAEYIKQRGYDLHDVQAYGQMLKDAGFDEVIAEDRTDQFKEVLQRELDAV  440

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+K+AFIQDFSEEDY+DIVGGWK KL R  SGEQ+WGL
Sbjct  441  EKDKDAFIQDFSEEDYDDIVGGWKAKLIRADSGEQKWGL  479


 Score =   127 bits (319),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCT+KTYPD TFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLI+DYC+
Sbjct  323  KCAVEFEVADCTQKTYPDDTFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLISDYCR  382

Query  492  GLDLP  478
                P
Sbjct  383  SAGTP  387



>ref|XP_008240152.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X1 [Prunus mume]
Length=491

 Score =   159 bits (402),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + +G PS EFA YIKQRGYDLHD + YGQML+DAGF++VIAEDRTDQF +VL++ELDAV
Sbjct  387  CRSAGTPSAEFAEYIKQRGYDLHDVQAYGQMLKDAGFDEVIAEDRTDQFKEVLQRELDAV  446

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+K+AFIQDFSEEDY+DIVGGWK KL R  SGEQ+WGL
Sbjct  447  EKDKDAFIQDFSEEDYDDIVGGWKAKLIRADSGEQKWGL  485


 Score =   127 bits (318),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCT+KTYPD TFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLI+DYC+
Sbjct  329  KCAVEFEVADCTQKTYPDDTFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLISDYCR  388

Query  492  GLDLP  478
                P
Sbjct  389  SAGTP  393



>gb|EYU24136.1| hypothetical protein MIMGU_mgv1a005261mg [Erythranthe guttata]
Length=491

 Score =   160 bits (404),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + +G  S +F  YIKQRGYDLHD E YGQMLRDAGF+DVIAEDRT+QFM VL+KEL+AV
Sbjct  387  CKNAGASSADFTEYIKQRGYDLHDVEAYGQMLRDAGFDDVIAEDRTNQFMTVLEKELNAV  446

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+KE FI+DFS+EDY+DIVGGWK KL RTSSGEQRWGL
Sbjct  447  EKDKETFIRDFSQEDYDDIVGGWKSKLVRTSSGEQRWGL  485


 Score =   126 bits (316),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 57/60 (95%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKK YPD TFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLI+DYCK
Sbjct  329  KCAVEFEVADCTKKDYPDGTFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLISDYCK  388



>gb|AFW04224.1| phosphoethanolamine N-methyl transferase [Suaeda maritima]
Length=494

 Score =   164 bits (416),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +++GPPS EFAAYIKQRGYDLHD +EYGQML+DAGF DV+AEDRT+QF++VL+KEL+ V
Sbjct  390  CKKAGPPSPEFAAYIKQRGYDLHDVKEYGQMLKDAGFVDVLAEDRTEQFIRVLRKELETV  449

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEK+ FI DFSEEDYNDIVGGW  KL RT+ GEQRWGL
Sbjct  450  EKEKDVFISDFSEEDYNDIVGGWNDKLRRTAKGEQRWGL  488


 Score =   121 bits (303),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTK  YPD +FDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLI+DYCK
Sbjct  332  KCAVEFEVADCTKINYPDNSFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLISDYCK  391

Query  492  GLDLP  478
                P
Sbjct  392  KAGPP  396



>dbj|BAC57432.1| phosphoethanolamine N-methyltransferase [Suaeda japonica]
Length=494

 Score =   164 bits (416),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +++GPPS EFAAYIKQRGYDLHD +EYGQML+DAGF DV+AEDRT+QF++VL+KEL+ V
Sbjct  390  CKKAGPPSPEFAAYIKQRGYDLHDVKEYGQMLKDAGFVDVLAEDRTEQFIRVLRKELETV  449

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEK+ FI DFSEEDYNDIVGGW  KL RT+ GEQRWGL
Sbjct  450  EKEKDVFISDFSEEDYNDIVGGWNDKLRRTAKGEQRWGL  488


 Score =   121 bits (303),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTK  YPD +FDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLI+DYCK
Sbjct  332  KCAVEFEVADCTKINYPDNSFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLISDYCK  391



>ref|XP_009616694.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=491

 Score =   159 bits (401),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +++G  SEEFA YIKQRGYDLHD E YGQMLRDAGF +V+AEDRT+QF+ VL+KELD V
Sbjct  387  CKKAGTASEEFAGYIKQRGYDLHDVEAYGQMLRDAGFNEVVAEDRTEQFVGVLQKELDTV  446

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKE+++FI +FSE+DYN+IVGGWK KL R+SSGEQRWGL
Sbjct  447  EKERKSFIHEFSEQDYNEIVGGWKAKLIRSSSGEQRWGL  485


 Score =   127 bits (318),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 57/60 (95%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKKTYPD  FDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLI+DYCK
Sbjct  329  KCAVEFEVADCTKKTYPDGAFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLISDYCK  388



>pir||H96762 hypothetical protein F6D5.1 [imported] - Arabidopsis thaliana
 gb|AAG51806.1|AC079676_1 phosphoethanolamine N-methyltransferase, putative; 6854-3993 
[Arabidopsis thaliana]
Length=555

 Score =   161 bits (407),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS +FA YIK+RGYDLHD + YGQMLRDAGFE+VIAEDRTDQFMKVLK+ELDAVEKEKE 
Sbjct  457  PSPDFAIYIKKRGYDLHDVQAYGQMLRDAGFEEVIAEDRTDQFMKVLKRELDAVEKEKEE  516

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY DI+GGWK KL R+SSGEQ+WGL
Sbjct  517  FISDFSKEDYEDIIGGWKSKLLRSSSGEQKWGL  549


 Score =   124 bits (310),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPALFR FYKWLKPGGKVLITDYC+
Sbjct  393  KCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPALFRRFYKWLKPGGKVLITDYCR  452

Query  492  GLDLP  478
                P
Sbjct  453  SPKTP  457



>gb|ABG57185.1| phosphoethanolamine N-methyltransferase [Salicornia europaea]
Length=494

 Score =   166 bits (420),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +++GPPS EFA+YIKQRGYDLHD +EYGQML+DAGF DVIAEDRTDQF++VL+KEL+ V
Sbjct  390  CKKAGPPSPEFASYIKQRGYDLHDVKEYGQMLKDAGFIDVIAEDRTDQFIRVLQKELETV  449

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEK+ FI DFSEEDYNDIVGGW  KL RT+ GEQRWGL
Sbjct  450  EKEKDEFISDFSEEDYNDIVGGWNAKLQRTAKGEQRWGL  488


 Score =   117 bits (294),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKKTYPD++F VIYSRDTILHIQDKP LFR+FYKWLKPG KVLI+DYCK
Sbjct  332  KCAVEFEVADCTKKTYPDSSFGVIYSRDTILHIQDKPELFRTFYKWLKPGDKVLISDYCK  391



>emb|CBI26877.3| unnamed protein product [Vitis vinifera]
Length=484

 Score =   164 bits (414),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +RSGPPS EF AYI QRGYDLHD E YGQML+DAGF++VIAEDRTDQF++VL+KE+D++
Sbjct  378  CKRSGPPSPEFEAYIGQRGYDLHDVEAYGQMLKDAGFDEVIAEDRTDQFIEVLQKEMDSI  437

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEK+ FI DFSEEDY DIVGGWK KL R+S GEQRWGL
Sbjct  438  EKEKDKFISDFSEEDYKDIVGGWKSKLVRSSMGEQRWGL  476


 Score =   120 bits (301),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 57/57 (100%), Gaps = 0/57 (0%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            VEFEVADCTKKTYPD+TFDVIYSRDTILHIQDKPALFRSF+KWLKPGGKVLI+DYCK
Sbjct  323  VEFEVADCTKKTYPDSTFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCK  379



>gb|ABK42071.1| phosphoethanolamine N-methyltransferase [Suaeda liaotungensis]
Length=494

 Score =   162 bits (411),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +++GPPS EFAAYIKQRGYDLHD +EYGQML+DAGF DV+AEDRT+QF++VL+KEL+ V
Sbjct  390  CKKAGPPSPEFAAYIKQRGYDLHDVKEYGQMLKDAGFVDVLAEDRTEQFIRVLRKELETV  449

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEK+ FI DFSEEDYN+IVGGW  KL RT+ GEQRWGL
Sbjct  450  EKEKDVFISDFSEEDYNEIVGGWNDKLRRTAKGEQRWGL  488


 Score =   121 bits (303),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTK  YPD +FDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLI+DYCK
Sbjct  332  KCAVEFEVADCTKINYPDNSFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLISDYCK  391



>ref|NP_974139.2| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 gb|AEE35480.1| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
Length=504

 Score =   160 bits (406),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS +FA YIK+RGYDLHD + YGQMLRDAGFE+VIAEDRTDQFMKVLK+ELDAVEKEKE 
Sbjct  406  PSPDFAIYIKKRGYDLHDVQAYGQMLRDAGFEEVIAEDRTDQFMKVLKRELDAVEKEKEE  465

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY DI+GGWK KL R+SSGEQ+WGL
Sbjct  466  FISDFSKEDYEDIIGGWKSKLLRSSSGEQKWGL  498


 Score =   123 bits (308),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPALFR FYKWLKPGGKVLITDYC+
Sbjct  342  KCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPALFRRFYKWLKPGGKVLITDYCR  401

Query  492  GLDLP  478
                P
Sbjct  402  SPKTP  406



>ref|NP_177501.2| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 sp|Q9C6B9.2|PEAM3_ARATH RecName: Full=Phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 gb|AEE35481.1| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
Length=490

 Score =   160 bits (405),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS +FA YIK+RGYDLHD + YGQMLRDAGFE+VIAEDRTDQFMKVLK+ELDAVEKEKE 
Sbjct  392  PSPDFAIYIKKRGYDLHDVQAYGQMLRDAGFEEVIAEDRTDQFMKVLKRELDAVEKEKEE  451

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY DI+GGWK KL R+SSGEQ+WGL
Sbjct  452  FISDFSKEDYEDIIGGWKSKLLRSSSGEQKWGL  484


 Score =   123 bits (308),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPALFR FYKWLKPGGKVLITDYC+
Sbjct  328  KCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPALFRRFYKWLKPGGKVLITDYCR  387

Query  492  GLDLP  478
                P
Sbjct  388  SPKTP  392



>ref|XP_010655490.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Vitis vinifera]
 ref|XP_010655528.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Vitis vinifera]
Length=468

 Score =   163 bits (413),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +RSGPPS EF AYI QRGYDLHD E YGQML+DAGF++VIAEDRTDQF++VL+KE+D++
Sbjct  362  CKRSGPPSPEFEAYIGQRGYDLHDVEAYGQMLKDAGFDEVIAEDRTDQFIEVLQKEMDSI  421

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEK+ FI DFSEEDY DIVGGWK KL R+S GEQRWGL
Sbjct  422  EKEKDKFISDFSEEDYKDIVGGWKSKLVRSSMGEQRWGL  460


 Score =   120 bits (300),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 57/57 (100%), Gaps = 0/57 (0%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            VEFEVADCTKKTYPD+TFDVIYSRDTILHIQDKPALFRSF+KWLKPGGKVLI+DYCK
Sbjct  307  VEFEVADCTKKTYPDSTFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCK  363



>ref|XP_011014101.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Populus euphratica]
Length=490

 Score =   159 bits (402),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + +G PS EFA YIKQRGYDLHD E YGQMLRDAGF++VIAED TDQF +VL +EL+A+
Sbjct  386  CKHAGTPSPEFAEYIKQRGYDLHDVEAYGQMLRDAGFDEVIAEDLTDQFNQVLLRELNAI  445

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEK+ FI DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  446  EKEKDEFILDFSEEDYNDIVGGWKAKLIRSSSGEQRWGL  484


 Score =   123 bits (309),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT KTYPD TFDVIYSRDTILHIQDKPALFRSF+KWLKPGGKVLI+DYCK
Sbjct  328  KCSVEFEVADCTTKTYPDDTFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCK  387

Query  492  GLDLP  478
                P
Sbjct  388  HAGTP  392



>gb|AAG52075.1|AC012679_13 putative S-adenosyl-methionine-sterol-C-methyltransferase, 5' 
partial; 1-1344 [Arabidopsis thaliana]
Length=295

 Score =   160 bits (404),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS +FA YIK+RGYDLHD + YGQMLRDAGFE+VIAEDRTDQFMKVLK+ELDAVEKEKE 
Sbjct  197  PSPDFAIYIKKRGYDLHDVQAYGQMLRDAGFEEVIAEDRTDQFMKVLKRELDAVEKEKEE  256

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY DI+GGWK KL R+SSGEQ+WGL
Sbjct  257  FISDFSKEDYEDIIGGWKSKLLRSSSGEQKWGL  289


 Score =   122 bits (306),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPALFR FYKWLKPGGKVLITDYC+
Sbjct  133  KCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPALFRRFYKWLKPGGKVLITDYCR  192

Query  492  GLDLP  478
                P
Sbjct  193  SPKTP  197



>ref|XP_006451624.1| hypothetical protein CICLE_v10010749mg [Citrus clementina]
 ref|XP_006490770.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Citrus sinensis]
 gb|ESR64864.1| hypothetical protein CICLE_v10010749mg [Citrus clementina]
Length=492

 Score =   161 bits (407),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -3

Query  487  GPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEK  308
            G PS EF+ YIKQRGYDLHD + YGQML+DAGF D+IAEDRT+QF++VL++ELDA+EK+K
Sbjct  392  GTPSVEFSEYIKQRGYDLHDVKSYGQMLKDAGFVDIIAEDRTEQFVQVLQRELDAIEKDK  451

Query  307  EAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            +AFI+DFSEEDYNDIVGGWK KL RTS+GEQRWGL
Sbjct  452  DAFIKDFSEEDYNDIVGGWKAKLIRTSAGEQRWGL  486


 Score =   121 bits (303),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKKTYP+ +FDVIYSRDTILHIQDKPALF+SF+KWLKPGG VLI+DYCK
Sbjct  330  KCSVEFEVADCTKKTYPENSFDVIYSRDTILHIQDKPALFKSFFKWLKPGGTVLISDYCK  389

Query  492  GLDLP  478
                P
Sbjct  390  SFGTP  394



>dbj|BAE99185.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
Length=504

 Score =   160 bits (406),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS +FA YIK+RGYDLHD + YGQMLRDAGFE+VIAEDRTDQFMKVLK+ELDAVEKEKE 
Sbjct  406  PSPDFAIYIKKRGYDLHDVQAYGQMLRDAGFEEVIAEDRTDQFMKVLKRELDAVEKEKEE  465

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY DI+GGWK KL R+SSGEQ+WGL
Sbjct  466  FISDFSKEDYEDIIGGWKSKLLRSSSGEQKWGL  498


 Score =   121 bits (304),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPALFR FYKWLKPGGKVLI DYC+
Sbjct  342  KCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPALFRRFYKWLKPGGKVLIADYCR  401

Query  492  GLDLP  478
                P
Sbjct  402  SPKTP  406



>ref|XP_002317876.2| hypothetical protein POPTR_0012s044901g, partial [Populus trichocarpa]
 gb|EEE96096.2| hypothetical protein POPTR_0012s044901g, partial [Populus trichocarpa]
Length=356

 Score =   159 bits (403),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + +G PS EFA YIKQRGYDLHD + YGQMLRDAGF++VIAEDRTDQF +VL +EL A+
Sbjct  252  CKCAGTPSPEFAEYIKQRGYDLHDVKAYGQMLRDAGFDEVIAEDRTDQFNQVLLRELKAI  311

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEK+ FI DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  312  EKEKDEFIHDFSEEDYNDIVGGWKAKLIRSSSGEQRWGL  350


 Score =   122 bits (306),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT KTYPD TFDVIYSRDTILHIQDKPALFRSF+KWLKPGGKVLI+DYCK
Sbjct  194  KCSVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCK  253

Query  492  GLDLP  478
                P
Sbjct  254  CAGTP  258



>ref|XP_010428286.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X2 [Camelina sativa]
Length=492

 Score =   158 bits (400),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS +FA YIKQRGYDLHD + YGQML+DAGFE+VIAEDRTDQFMKVLK+ELDAVEKEK+ 
Sbjct  394  PSPDFANYIKQRGYDLHDVQTYGQMLKDAGFEEVIAEDRTDQFMKVLKRELDAVEKEKDE  453

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  454  FISDFSQEDYEDIVGGWNSKLLRSSSGEQKWGL  486


 Score =   123 bits (309),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPALFR+FYKWLKPGGK+LITDYC+
Sbjct  330  KCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPALFRTFYKWLKPGGKILITDYCR  389

Query  492  GLDLP  478
                P
Sbjct  390  SPKTP  394



>ref|XP_006376720.1| hypothetical protein POPTR_0012s044901g, partial [Populus trichocarpa]
 gb|ERP54517.1| hypothetical protein POPTR_0012s044901g, partial [Populus trichocarpa]
Length=355

 Score =   159 bits (403),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + +G PS EFA YIKQRGYDLHD + YGQMLRDAGF++VIAEDRTDQF +VL +EL A+
Sbjct  251  CKCAGTPSPEFAEYIKQRGYDLHDVKAYGQMLRDAGFDEVIAEDRTDQFNQVLLRELKAI  310

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEK+ FI DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  311  EKEKDEFIHDFSEEDYNDIVGGWKAKLIRSSSGEQRWGL  349


 Score =   122 bits (306),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT KTYPD TFDVIYSRDTILHIQDKPALFRSF+KWLKPGGKVLI+DYCK
Sbjct  193  KCSVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCK  252

Query  492  GLDLP  478
                P
Sbjct  253  CAGTP  257



>gb|AFZ78648.1| methyl transferase [Populus tomentosa]
Length=485

 Score =   159 bits (401),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -3

Query  490  SGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKE  311
            +G PS EFA YIKQRGYDLHD + YGQMLRDAGF++V+AEDRTDQF KVL++EL+A+EK+
Sbjct  384  AGTPSPEFAEYIKQRGYDLHDVKAYGQMLRDAGFDEVVAEDRTDQFNKVLQRELNAIEKD  443

Query  310  KEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            K+ FI DFSE DYNDIVGGWK KL R+SSGEQRWGL
Sbjct  444  KDEFIHDFSEGDYNDIVGGWKAKLIRSSSGEQRWGL  479


 Score =   123 bits (308),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT KTYPD TFDVIYSRDTILHIQDKPALFRSF+KWLKPGGKVLI+DYCK
Sbjct  323  KCSVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCK  382

Query  492  GLDLP  478
                P
Sbjct  383  CAGTP  387



>ref|XP_010428285.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X1 [Camelina sativa]
Length=504

 Score =   158 bits (400),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS +FA YIKQRGYDLHD + YGQML+DAGFE+VIAEDRTDQFMKVLK+ELDAVEKEK+ 
Sbjct  406  PSPDFANYIKQRGYDLHDVQTYGQMLKDAGFEEVIAEDRTDQFMKVLKRELDAVEKEKDE  465

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  466  FISDFSQEDYEDIVGGWNSKLLRSSSGEQKWGL  498


 Score =   123 bits (308),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPALFR+FYKWLKPGGK+LITDYC+
Sbjct  342  KCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPALFRTFYKWLKPGGKILITDYCR  401

Query  492  GLDLP  478
                P
Sbjct  402  SPKTP  406



>ref|XP_006490771.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Citrus sinensis]
Length=489

 Score =   160 bits (406),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -3

Query  487  GPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEK  308
            G PS EF+ YIKQRGYDLHD + YGQML+DAGF D+IAEDRT+QF++VL++ELDA+EK+K
Sbjct  389  GTPSVEFSEYIKQRGYDLHDVKSYGQMLKDAGFVDIIAEDRTEQFVQVLQRELDAIEKDK  448

Query  307  EAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            +AFI+DFSEEDYNDIVGGWK KL RTS+GEQRWGL
Sbjct  449  DAFIKDFSEEDYNDIVGGWKAKLIRTSAGEQRWGL  483


 Score =   121 bits (303),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKKTYP+ +FDVIYSRDTILHIQDKPALF+SF+KWLKPGG VLI+DYCK
Sbjct  327  KCSVEFEVADCTKKTYPENSFDVIYSRDTILHIQDKPALFKSFFKWLKPGGTVLISDYCK  386

Query  492  GLDLP  478
                P
Sbjct  387  SFGTP  391



>ref|XP_011008809.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X2 [Populus euphratica]
Length=490

 Score =   158 bits (400),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -3

Query  490  SGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKE  311
            SG PS EFA YIKQRGYDLHD + YGQMLRDAGF++V+AEDRTDQF K+L++EL+A+EK+
Sbjct  389  SGTPSPEFAEYIKQRGYDLHDVKAYGQMLRDAGFDEVVAEDRTDQFNKLLQRELNAIEKD  448

Query  310  KEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            K+ FI DFSE DYNDIVGGWK KL R+SSGEQRWGL
Sbjct  449  KDEFIHDFSEGDYNDIVGGWKAKLIRSSSGEQRWGL  484


 Score =   122 bits (307),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT KTYPD TFDVIYSRDTILHIQDKPALFRSF+KWLKPGGKVLI+DYCK
Sbjct  328  KCSVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCK  387



>ref|XP_011008808.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X1 [Populus euphratica]
Length=506

 Score =   159 bits (401),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -3

Query  490  SGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKE  311
            SG PS EFA YIKQRGYDLHD + YGQMLRDAGF++V+AEDRTDQF K+L++EL+A+EK+
Sbjct  405  SGTPSPEFAEYIKQRGYDLHDVKAYGQMLRDAGFDEVVAEDRTDQFNKLLQRELNAIEKD  464

Query  310  KEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            K+ FI DFSE DYNDIVGGWK KL R+SSGEQRWGL
Sbjct  465  KDEFIHDFSEGDYNDIVGGWKAKLIRSSSGEQRWGL  500


 Score =   122 bits (306),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT KTYPD TFDVIYSRDTILHIQDKPALFRSF+KWLKPGGKVLI+DYCK
Sbjct  344  KCSVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCK  403



>emb|CDY11100.1| BnaC06g23520D [Brassica napus]
Length=506

 Score =   157 bits (396),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS +FA YIKQRGYDLHD + YGQML+DAGF++VIAEDRTDQFMKVLK+ELDAVEKEK+ 
Sbjct  408  PSPDFANYIKQRGYDLHDVQAYGQMLKDAGFDEVIAEDRTDQFMKVLKRELDAVEKEKDE  467

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  468  FISDFSKEDYEDIVGGWNSKLLRSSSGEQKWGL  500


 Score =   124 bits (311),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPALFR+FYKWLKPGGKVLITDYC+
Sbjct  344  KCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPALFRTFYKWLKPGGKVLITDYCR  403

Query  492  GLDLP  478
                P
Sbjct  404  SPKTP  408



>emb|CDX68222.1| BnaA07g22620D [Brassica napus]
Length=506

 Score =   157 bits (396),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS +FA YIKQRGYDLHD + YGQML+DAGF++VIAEDRTDQFMKVLK+ELDAVEKEK+ 
Sbjct  408  PSPDFANYIKQRGYDLHDVQAYGQMLKDAGFDEVIAEDRTDQFMKVLKRELDAVEKEKDD  467

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  468  FISDFSKEDYEDIVGGWNSKLLRSSSGEQKWGL  500


 Score =   124 bits (310),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPALFR+FYKWLKPGGKVLITDYC+
Sbjct  344  KCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPALFRTFYKWLKPGGKVLITDYCR  403

Query  492  GLDLP  478
                P
Sbjct  404  SPKTP  408



>ref|XP_009104804.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 [Brassica 
rapa]
Length=506

 Score =   157 bits (396),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS +FA YIKQRGYDLHD + YGQML+DAGF++VIAEDRTDQFMKVLK+ELDAVEKEK+ 
Sbjct  408  PSPDFANYIKQRGYDLHDVQAYGQMLKDAGFDEVIAEDRTDQFMKVLKRELDAVEKEKDD  467

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  468  FISDFSKEDYEDIVGGWNSKLLRSSSGEQKWGL  500


 Score =   124 bits (311),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPALFR+FYKWLKPGGKVLITDYC+
Sbjct  344  KCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPALFRTFYKWLKPGGKVLITDYCR  403

Query  492  GLDLP  478
                P
Sbjct  404  SPKTP  408



>ref|XP_006390538.1| hypothetical protein EUTSA_v10018431mg [Eutrema salsugineum]
 gb|ESQ27824.1| hypothetical protein EUTSA_v10018431mg [Eutrema salsugineum]
Length=504

 Score =   156 bits (395),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS +FA YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQFMKVLK+ELDAVEKEK+ 
Sbjct  406  PSPDFANYIKQRGYDLHDVQAYGQMLKDAGFDDVIAEDRTDQFMKVLKRELDAVEKEKKE  465

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY +IVGGW  KL R+SSGEQ+WGL
Sbjct  466  FISDFSKEDYEEIVGGWNSKLLRSSSGEQKWGL  498


 Score =   124 bits (310),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPALFR+FYKWLKPGGKVLITDYC+
Sbjct  342  KCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPALFRTFYKWLKPGGKVLITDYCR  401

Query  492  GLDLP  478
                P
Sbjct  402  SPKTP  406



>ref|XP_008364653.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Malus 
domestica]
Length=492

 Score =   150 bits (380),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -3

Query  490  SGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKE  311
            +G PSE FA YIKQRGYDLHD + YGQML+DAGF++VIAEDRTDQF  VL++EL  VEK+
Sbjct  391  AGTPSENFADYIKQRGYDLHDVKAYGQMLKDAGFDEVIAEDRTDQFKAVLERELAXVEKD  450

Query  310  KEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            K++F+QDFS+EDY+DIVGGWK KL R  SGEQ+WGL
Sbjct  451  KDSFVQDFSQEDYDDIVGGWKAKLIRVDSGEQKWGL  486


 Score =   129 bits (325),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLI+DYC+
Sbjct  330  KCAVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLISDYCR  389

Query  492  GLDLPQKNL  466
                P +N 
Sbjct  390  CAGTPSENF  398



>gb|AGI56231.1| phosphoethanolamine N-methyltransferase [Lycium barbarum]
Length=498

 Score =   153 bits (386),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P SEE A YIKQRGYDLHD   YGQMLRDAGF++VIAEDRT QF+ VL+KEL+ VEKE++
Sbjct  400  PASEELAGYIKQRGYDLHDVAAYGQMLRDAGFDEVIAEDRTAQFINVLQKELNTVEKERD  459

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            +FIQ+FSE+DYN+IVG WK KL R+SSGEQRWGL
Sbjct  460  SFIQEFSEQDYNEIVGSWKAKLIRSSSGEQRWGL  493


 Score =   127 bits (319),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 57/60 (95%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLI+DYC+
Sbjct  337  KCAVEFEVADCTKKTYPDGTFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLISDYCR  396



>ref|XP_010686587.1| PREDICTED: phosphoethanolamine N-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   159 bits (401),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + SGPPS EFA YIKQRGYDLHD E YGQML+DAGF DVIA+D+TDQF++VL+KELD++
Sbjct  390  CKSSGPPSAEFAMYIKQRGYDLHDVEAYGQMLKDAGFVDVIAQDKTDQFIQVLQKELDSL  449

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEK+ FI DFSE DYNDIV GWK KL RT  GEQRWGL
Sbjct  450  EKEKDKFIADFSEGDYNDIVDGWKAKLIRTKVGEQRWGL  488


 Score =   121 bits (303),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKK YP+ +FDVIYSRDTILHIQDKPALFR+FYKWLKPGGKVLI+DYCK
Sbjct  332  KCAVEFEVADCTKKPYPEQSFDVIYSRDTILHIQDKPALFRNFYKWLKPGGKVLISDYCK  391

Query  492  GLDLP  478
                P
Sbjct  392  SSGPP  396



>dbj|BAE07178.1| phosphoethanolamine N-methyltransferase [Beta vulgaris]
Length=494

 Score =   159 bits (401),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + SGPPS EFA YIKQRGYDLHD E YGQML+DAGF DVIA+D+TDQF++VL+KELD++
Sbjct  390  CKSSGPPSAEFAMYIKQRGYDLHDVEAYGQMLKDAGFVDVIAQDKTDQFIQVLQKELDSL  449

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEK+ FI DFSE DYNDIV GWK KL RT  GEQRWGL
Sbjct  450  EKEKDKFIADFSEGDYNDIVDGWKAKLIRTKVGEQRWGL  488


 Score =   120 bits (302),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKK YP+ +FDVIYSRDTILHIQDKPALFR+FYKWLKPGGKVLI+DYCK
Sbjct  332  KCAVEFEVADCTKKPYPEQSFDVIYSRDTILHIQDKPALFRNFYKWLKPGGKVLISDYCK  391

Query  492  GLDLP  478
                P
Sbjct  392  SSGPP  396



>ref|XP_010416170.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Camelina 
sativa]
Length=490

 Score =   156 bits (395),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS +FA YIKQRGYDLHD + YGQML+DAGFE+VIAEDRTDQF+KVLK+ELDAVEKEK+ 
Sbjct  392  PSPDFANYIKQRGYDLHDVQTYGQMLKDAGFEEVIAEDRTDQFVKVLKRELDAVEKEKDE  451

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI+DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  452  FIRDFSKEDYEDIVGGWNSKLLRSSSGEQKWGL  484


 Score =   123 bits (308),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPALFR+FYKWLKPGGK+LITDYC+
Sbjct  328  KCSVEFEVADCTKKEYPDKTFDVIYSRDTILHIQDKPALFRTFYKWLKPGGKILITDYCR  387

Query  492  GLDLP  478
                P
Sbjct  388  SPKTP  392



>ref|XP_010471422.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Camelina sativa]
Length=490

 Score =   155 bits (393),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS +FA YIKQRGYDLHD + YGQML+DAGFE+VIAED TDQFMKVLK+ELDAVEKEK+ 
Sbjct  392  PSPDFANYIKQRGYDLHDVQTYGQMLKDAGFEEVIAEDSTDQFMKVLKRELDAVEKEKDE  451

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  452  FISDFSKEDYEDIVGGWNSKLLRSSSGEQKWGL  484


 Score =   123 bits (308),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPALFR+FYKWLKPGGK+LITDYC+
Sbjct  328  KCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPALFRTFYKWLKPGGKILITDYCR  387

Query  492  GLDLP  478
                P
Sbjct  388  SPKTP  392



>ref|XP_010471421.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Camelina sativa]
Length=504

 Score =   155 bits (393),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS +FA YIKQRGYDLHD + YGQML+DAGFE+VIAED TDQFMKVLK+ELDAVEKEK+ 
Sbjct  406  PSPDFANYIKQRGYDLHDVQTYGQMLKDAGFEEVIAEDSTDQFMKVLKRELDAVEKEKDE  465

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  466  FISDFSKEDYEDIVGGWNSKLLRSSSGEQKWGL  498


 Score =   123 bits (308),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPALFR+FYKWLKPGGK+LITDYC+
Sbjct  342  KCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPALFRTFYKWLKPGGKILITDYCR  401

Query  492  GLDLP  478
                P
Sbjct  402  SPKTP  406



>ref|XP_009356042.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=492

 Score =   150 bits (378),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  490  SGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKE  311
            +G P E FA YIKQRGYDLHD + YGQML+DAGF++VIAEDRTDQF  VL +EL AVEK+
Sbjct  391  AGTPLENFADYIKQRGYDLHDVKAYGQMLKDAGFDEVIAEDRTDQFKAVLARELAAVEKD  450

Query  310  KEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            K++F+QDFS+EDY+DIVGGWK KL R  SGEQ+WGL
Sbjct  451  KDSFVQDFSQEDYDDIVGGWKAKLIRVDSGEQKWGL  486


 Score =   129 bits (323),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLI+DYC+
Sbjct  330  KCAVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLISDYCR  389

Query  492  GLDLPQKNL  466
                P +N 
Sbjct  390  CAGTPLENF  398



>ref|XP_008453479.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
melo]
Length=500

 Score =   152 bits (383),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS EFA YIKQRGYDLHD + Y +ML +AGF +V+AEDRTDQFM VL+KEL+ VEKEKEA
Sbjct  400  PSPEFAEYIKQRGYDLHDIKSYAKMLEEAGFSNVVAEDRTDQFMSVLQKELNIVEKEKEA  459

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFSEEDYNDIVGGWK KL R   GEQ+WGL
Sbjct  460  FIHDFSEEDYNDIVGGWKAKLNRCWCGEQKWGL  492


 Score =   126 bits (316),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKK YPD TFDVIYSRDTILHIQDKPALFRSFYKW+KPGGK+LI+DYCK
Sbjct  336  KCAVEFEVADCTKKVYPDNTFDVIYSRDTILHIQDKPALFRSFYKWVKPGGKILISDYCK  395

Query  492  GLDLP  478
              ++P
Sbjct  396  SGEVP  400



>ref|XP_006346642.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Solanum 
tuberosum]
Length=500

 Score =   150 bits (380),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P S+EF+ YIKQRGYDLHD   YGQML+DA F++VIAEDRT+QF+ VL+KEL+ VEKE++
Sbjct  401  PASDEFSEYIKQRGYDLHDVATYGQMLKDASFDEVIAEDRTEQFINVLQKELNTVEKERD  460

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            +FIQ+FSE+DYN+IVGGWK KL R+SSGEQRWGL
Sbjct  461  SFIQEFSEQDYNEIVGGWKAKLLRSSSGEQRWGL  494


 Score =   127 bits (318),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 57/60 (95%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPALFRSFY+WLKPGGKVLI+DYCK
Sbjct  338  KCAVEFEVADCTKKTYPDGTFDVIYSRDTILHIQDKPALFRSFYRWLKPGGKVLISDYCK  397



>ref|XP_010533969.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Tarenaya 
hassleriana]
Length=491

 Score =   155 bits (393),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS EFA YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQFM+VL++ELD VE EKE 
Sbjct  393  PSLEFAEYIKQRGYDLHDVQAYGQMLKDAGFDDVIAEDRTDQFMQVLQRELDKVEMEKEE  452

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI+DFSEEDY+DIVGGWK KL R++SGEQ+WGL
Sbjct  453  FIRDFSEEDYDDIVGGWKAKLERSASGEQKWGL  485


 Score =   121 bits (304),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLI+DYC+
Sbjct  329  KCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLISDYCR  388

Query  492  GLDLP  478
                P
Sbjct  389  SAKTP  393



>gb|EPS65842.1| hypothetical protein M569_08933, partial [Genlisea aurea]
Length=487

 Score =   149 bits (377),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS EFA YIK+RGYDLHD E YGQMLRDAGF++V AEDRT+QF+ VLKKE+DAVEK+KE 
Sbjct  389  PSAEFAGYIKERGYDLHDVEAYGQMLRDAGFDEVTAEDRTEQFVNVLKKEVDAVEKDKER  448

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI +FS+EDY++IVGGWK KL+R+  GEQRWGL
Sbjct  449  FIDNFSKEDYDEIVGGWKSKLSRSCGGEQRWGL  481


 Score =   127 bits (319),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             CAVEFEVADCTKK YPDA+FDVIYSRDTILHI DKP+LF+SFYKWLKPGGKVLI+DYCK
Sbjct  325  NCAVEFEVADCTKKHYPDASFDVIYSRDTILHIHDKPSLFKSFYKWLKPGGKVLISDYCK  384

Query  492  GLDLP  478
            G+D P
Sbjct  385  GVDAP  389



>ref|XP_010677350.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=449

 Score =   157 bits (396),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + +G  S EFA YIKQRGYDLHD + YGQMLRDAGF++VIAEDRTDQF KVL++EL+AV
Sbjct  342  CRSAGTASPEFAEYIKQRGYDLHDVQAYGQMLRDAGFDEVIAEDRTDQFSKVLERELNAV  401

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEKE FI DFSEEDY+ IVGGWK KL R SSGEQRWGL
Sbjct  402  EKEKERFITDFSEEDYDAIVGGWKSKLVRVSSGEQRWGL  440


 Score =   119 bits (299),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             CAVEFEVADCT  TYPD  FDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLI+DYC+
Sbjct  284  NCAVEFEVADCTTITYPDNAFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLISDYCR  343



>ref|XP_002322102.2| hypothetical protein POPTR_0015s04540g [Populus trichocarpa]
 gb|EEF06229.2| hypothetical protein POPTR_0015s04540g [Populus trichocarpa]
Length=516

 Score =   158 bits (399),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -3

Query  487  GPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEK  308
            G PS EFA YIKQRGYDLHD + YGQMLRDAGF++V+AEDRTDQF KVL++EL+A+EK+K
Sbjct  416  GTPSPEFAEYIKQRGYDLHDVKAYGQMLRDAGFDEVVAEDRTDQFNKVLQRELNAIEKDK  475

Query  307  EAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            + FI DFSE DYNDIVGGWK KL R+SSGEQRWGL
Sbjct  476  DEFIHDFSEGDYNDIVGGWKAKLIRSSSGEQRWGL  510


 Score =   118 bits (296),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            K +VEFEVADCT KTYPD TFDVIYSRDTILHIQDKPALFRSF+KWLKPGGKVLI+DYCK
Sbjct  354  KYSVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCK  413



>ref|XP_004252273.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X1 [Solanum lycopersicum]
Length=500

 Score =   148 bits (374),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P S++F+ YIKQRGYDLHD   YGQML+DAGF++VIAEDRT+QF+ VL+KEL+ VEKE++
Sbjct  401  PASDKFSEYIKQRGYDLHDVATYGQMLKDAGFDEVIAEDRTEQFINVLQKELNTVEKERD  460

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            +FI +FSE+DYN+IVGGW  KL R+SSGEQRWGL
Sbjct  461  SFIHEFSEQDYNEIVGGWTAKLLRSSSGEQRWGL  494


 Score =   128 bits (321),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 58/60 (97%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLI+DYCK
Sbjct  338  KCAVEFEVADCTKKTYPDGTFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLISDYCK  397



>ref|XP_010678114.1| PREDICTED: phosphoethanolamine N-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   154 bits (389),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            PPS EFA YIKQRGYDLHD E YGQML+DAGF DVIA+D+TDQF++VL+KELD++EKEK+
Sbjct  395  PPSPEFAMYIKQRGYDLHDVEAYGQMLKDAGFVDVIAKDKTDQFIQVLQKELDSLEKEKD  454

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FI DFSE DYNDIV GWK KL RT  GEQRWGL
Sbjct  455  KFIADFSEGDYNDIVDGWKAKLIRTKVGEQRWGL  488


 Score =   122 bits (305),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKKTYP+ +FDVIYSRDTILHIQDKPALFR+FY+WLKPGGKVLI+DYCK
Sbjct  332  KCAVEFEVADCTKKTYPEQSFDVIYSRDTILHIQDKPALFRNFYEWLKPGGKVLISDYCK  391

Query  492  GLDLP  478
                P
Sbjct  392  SARPP  396



>ref|XP_010461683.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=492

 Score =   153 bits (387),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS EFA YIKQRGYDLHD + YG+ML++AGFEDVIAEDRTDQF++VL++EL+ VE+EKE 
Sbjct  394  PSPEFAEYIKQRGYDLHDVQAYGKMLKEAGFEDVIAEDRTDQFVQVLRRELEKVEREKEE  453

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDYNDIVGGW  KL RT+SGEQ+WGL
Sbjct  454  FISDFSQEDYNDIVGGWTAKLERTASGEQKWGL  486


 Score =   122 bits (306),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLITDYC+
Sbjct  330  NCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLITDYCR  389

Query  492  GLDLP  478
              + P
Sbjct  390  SAETP  394



>gb|KJB30122.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=491

 Score =   154 bits (390),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + S  PS EFAAYIKQRGYDLHD + YGQML DAGF+ ++AEDRTDQF++VL++EL+ V
Sbjct  386  CKSSKTPSTEFAAYIKQRGYDLHDVKSYGQMLEDAGFDVILAEDRTDQFLQVLQRELNQV  445

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEK+AFI DFS+EDY++IVGGWK KL R+SSGEQRWGL
Sbjct  446  EKEKDAFISDFSKEDYDEIVGGWKAKLIRSSSGEQRWGL  484


 Score =   121 bits (303),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD +FDVIYSRDTILHI DKPALFRSFYKWLKPGGK+LI+DYCK
Sbjct  328  KCSVEFEVADCTKKVYPDNSFDVIYSRDTILHIHDKPALFRSFYKWLKPGGKLLISDYCK  387

Query  492  GLDLP  478
                P
Sbjct  388  SSKTP  392



>gb|KFK36082.1| hypothetical protein AALP_AA4G075100 [Arabis alpina]
Length=492

 Score =   153 bits (387),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS  FA YIKQRGYDLHD + YGQML+DAGF DVIAEDRTDQF++VL++EL+ VEKEKE 
Sbjct  394  PSPIFAEYIKQRGYDLHDVQAYGQMLKDAGFVDVIAEDRTDQFVQVLRRELERVEKEKEE  453

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFSEEDYNDIVGGWK KL R++SGEQ+WGL
Sbjct  454  FISDFSEEDYNDIVGGWKSKLERSTSGEQKWGL  486


 Score =   122 bits (305),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPALF++F+KWLKPGGKVLITDYC+
Sbjct  330  KCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALFKTFFKWLKPGGKVLITDYCR  389

Query  492  GLDLP  478
              + P
Sbjct  390  NAETP  394



>ref|XP_006393387.1| hypothetical protein EUTSA_v10011451mg [Eutrema salsugineum]
 gb|ESQ30673.1| hypothetical protein EUTSA_v10011451mg [Eutrema salsugineum]
Length=475

 Score =   153 bits (387),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS  FA YIKQRGYDLHD + YGQML+DAGFEDVIAEDRTDQF++VL++EL+ VEKEK+ 
Sbjct  377  PSPIFAEYIKQRGYDLHDVQAYGQMLKDAGFEDVIAEDRTDQFVQVLRRELERVEKEKDE  436

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFSEEDYN+IVGGWK KL R++SGEQ+WGL
Sbjct  437  FINDFSEEDYNEIVGGWKAKLERSTSGEQKWGL  469


 Score =   122 bits (305),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPALF++F+KWLKPGGKVLITDYC+
Sbjct  313  KCSVEFEVADCTTKTYPDHSFDVIYSRDTILHIQDKPALFKTFFKWLKPGGKVLITDYCR  372

Query  492  GLDLP  478
              + P
Sbjct  373  NAETP  377



>gb|KJB30117.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=494

 Score =   154 bits (390),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + S  PS EFAAYIKQRGYDLHD + YGQML DAGF+ ++AEDRTDQF++VL++EL+ V
Sbjct  389  CKSSKTPSTEFAAYIKQRGYDLHDVKSYGQMLEDAGFDVILAEDRTDQFLQVLQRELNQV  448

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEK+AFI DFS+EDY++IVGGWK KL R+SSGEQRWGL
Sbjct  449  EKEKDAFISDFSKEDYDEIVGGWKAKLIRSSSGEQRWGL  487


 Score =   121 bits (303),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD +FDVIYSRDTILHI DKPALFRSFYKWLKPGGK+LI+DYCK
Sbjct  331  KCSVEFEVADCTKKVYPDNSFDVIYSRDTILHIHDKPALFRSFYKWLKPGGKLLISDYCK  390

Query  492  GLDLP  478
                P
Sbjct  391  SSKTP  395



>gb|KJB30120.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=465

 Score =   154 bits (390),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + S  PS EFAAYIKQRGYDLHD + YGQML DAGF+ ++AEDRTDQF++VL++EL+ V
Sbjct  360  CKSSKTPSTEFAAYIKQRGYDLHDVKSYGQMLEDAGFDVILAEDRTDQFLQVLQRELNQV  419

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEK+AFI DFS+EDY++IVGGWK KL R+SSGEQRWGL
Sbjct  420  EKEKDAFISDFSKEDYDEIVGGWKAKLIRSSSGEQRWGL  458


 Score =   120 bits (302),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD +FDVIYSRDTILHI DKPALFRSFYKWLKPGGK+LI+DYCK
Sbjct  302  KCSVEFEVADCTKKVYPDNSFDVIYSRDTILHIHDKPALFRSFYKWLKPGGKLLISDYCK  361

Query  492  GLDLP  478
                P
Sbjct  362  SSKTP  366



>gb|KJB30118.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=363

 Score =   154 bits (390),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + S  PS EFAAYIKQRGYDLHD + YGQML DAGF+ ++AEDRTDQF++VL++EL+ V
Sbjct  258  CKSSKTPSTEFAAYIKQRGYDLHDVKSYGQMLEDAGFDVILAEDRTDQFLQVLQRELNQV  317

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEK+AFI DFS+EDY++IVGGWK KL R+SSGEQRWGL
Sbjct  318  EKEKDAFISDFSKEDYDEIVGGWKAKLIRSSSGEQRWGL  356


 Score =   120 bits (302),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD +FDVIYSRDTILHI DKPALFRSFYKWLKPGGK+LI+DYCK
Sbjct  200  KCSVEFEVADCTKKVYPDNSFDVIYSRDTILHIHDKPALFRSFYKWLKPGGKLLISDYCK  259

Query  492  GLDLP  478
                P
Sbjct  260  SSKTP  264



>ref|XP_010314226.1| PREDICTED: phosphoethanolamine N-methyltransferase isoform X2 
[Solanum lycopersicum]
Length=388

 Score =   148 bits (373),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P S++F+ YIKQRGYDLHD   YGQML+DAGF++VIAEDRT+QF+ VL+KEL+ VEKE++
Sbjct  289  PASDKFSEYIKQRGYDLHDVATYGQMLKDAGFDEVIAEDRTEQFINVLQKELNTVEKERD  348

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            +FI +FSE+DYN+IVGGW  KL R+SSGEQRWGL
Sbjct  349  SFIHEFSEQDYNEIVGGWTAKLLRSSSGEQRWGL  382


 Score =   127 bits (318),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 58/60 (97%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLI+DYCK
Sbjct  226  KCAVEFEVADCTKKTYPDGTFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLISDYCK  285



>sp|Q9M571.1|PEAMT_SPIOL RecName: Full=Phosphoethanolamine N-methyltransferase [Spinacia 
oleracea]
 gb|AAF61950.1|AF237633_1 phosphoethanolamine N-methyltransferase [Spinacia oleracea]
Length=494

 Score =   152 bits (384),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + +G PS EFAAYI+QRGYDLHD + YG+ML+DAGF +VIAE+RTDQF++VL+KELDA+
Sbjct  390  CKSAGTPSAEFAAYIRQRGYDLHDVKAYGKMLKDAGFVEVIAENRTDQFIQVLQKELDAL  449

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            E+EK+ FI DFSEEDYNDIV GWK KL RT+ GEQ+WGL
Sbjct  450  EQEKDDFIDDFSEEDYNDIVDGWKAKLVRTTEGEQQWGL  488


 Score =   122 bits (306),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKK YP+ +FDVIYSRDTILHIQDKPALFRSF+KWLKPGGKVLI+DYCK
Sbjct  332  KCAVEFEVADCTKKDYPENSFDVIYSRDTILHIQDKPALFRSFHKWLKPGGKVLISDYCK  391

Query  492  GLDLP  478
                P
Sbjct  392  SAGTP  396



>emb|CDX95799.1| BnaC05g35500D [Brassica napus]
Length=481

 Score =   154 bits (388),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + S  PS EF+ YIKQRGYDLHD + YGQML+DAGF DVIAEDRTDQFM+VL++EL+ V
Sbjct  377  CKSSETPSPEFSEYIKQRGYDLHDVQAYGQMLKDAGFNDVIAEDRTDQFMQVLRRELERV  436

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEKE FI DFS+EDY DIVGGWK KL R++SGEQ+WGL
Sbjct  437  EKEKEEFISDFSKEDYEDIVGGWKAKLERSASGEQKWGL  475


 Score =   118 bits (295),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCT K YP+ +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLI+DYCK
Sbjct  319  NCSVEFEVADCTTKHYPENSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLISDYCK  378

Query  492  GLDLP  478
              + P
Sbjct  379  SSETP  383



>gb|KJB53040.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=489

 Score =   152 bits (383),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + +G  S EFA YIKQRGYDLHD + YGQML DAGF+ VIAEDRTDQF++VL++ELD V
Sbjct  385  CKSAGASSPEFAEYIKQRGYDLHDVKAYGQMLTDAGFDQVIAEDRTDQFIQVLQRELDKV  444

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+K+ FI DFS+EDY+DIVGGWK KL RT SGEQRWGL
Sbjct  445  EKDKDTFITDFSQEDYDDIVGGWKAKLIRTRSGEQRWGL  483


 Score =   119 bits (297),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPALFR FYKWLKPGGKVLI+DYCK
Sbjct  327  NCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALFRYFYKWLKPGGKVLISDYCK  386



>gb|KJB53039.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=488

 Score =   152 bits (383),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + +G  S EFA YIKQRGYDLHD + YGQML DAGF+ VIAEDRTDQF++VL++ELD V
Sbjct  384  CKSAGASSPEFAEYIKQRGYDLHDVKAYGQMLTDAGFDQVIAEDRTDQFIQVLQRELDKV  443

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+K+ FI DFS+EDY+DIVGGWK KL RT SGEQRWGL
Sbjct  444  EKDKDTFITDFSQEDYDDIVGGWKAKLIRTRSGEQRWGL  482


 Score =   119 bits (297),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPALFR FYKWLKPGGKVLI+DYCK
Sbjct  326  NCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALFRYFYKWLKPGGKVLISDYCK  385



>ref|XP_009145948.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Brassica 
rapa]
Length=492

 Score =   152 bits (384),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + S  PS EF+ YIKQRGYDLHD + YGQML++AGF DVIAEDRTDQFM+VL++EL+ V
Sbjct  388  CKSSETPSPEFSEYIKQRGYDLHDVQAYGQMLKEAGFNDVIAEDRTDQFMQVLRRELERV  447

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEKE FI DFS+EDY DIVGGWK KL R++SGEQ+WGL
Sbjct  448  EKEKEEFISDFSKEDYEDIVGGWKAKLERSASGEQKWGL  486


 Score =   118 bits (295),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCT K YP+ +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLI+DYCK
Sbjct  330  NCSVEFEVADCTTKHYPENSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLISDYCK  389

Query  492  GLDLP  478
              + P
Sbjct  390  SSETP  394



>ref|NP_001043957.1| Os01g0695100 [Oryza sativa Japonica Group]
 dbj|BAF05871.1| Os01g0695100 [Oryza sativa Japonica Group]
Length=499

 Score =   147 bits (372),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = -3

Query  487  GPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEK  308
            G PSEEFAAYIKQRGYDLHD   YGQML +AGF DVIAEDRTDQF+ VL++EL  VEK K
Sbjct  400  GKPSEEFAAYIKQRGYDLHDVRAYGQMLENAGFHDVIAEDRTDQFLDVLERELAKVEKNK  459

Query  307  EAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
              F+ DFS+EDY+ IV GWK KL R+S+GEQRWGL
Sbjct  460  NEFVSDFSQEDYDAIVNGWKAKLQRSSAGEQRWGL  494


 Score =   122 bits (305),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKKTYPD TFDVIYSRDTILHIQDKP+LF+SF+KWLKPGGKVLI+DYCK
Sbjct  338  KCSVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPSLFKSFFKWLKPGGKVLISDYCK  397



>gb|EEE55232.1| hypothetical protein OsJ_03109 [Oryza sativa Japonica Group]
Length=509

 Score =   148 bits (373),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = -3

Query  487  GPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEK  308
            G PSEEFAAYIKQRGYDLHD   YGQML +AGF DVIAEDRTDQF+ VL++EL  VEK K
Sbjct  410  GKPSEEFAAYIKQRGYDLHDVRAYGQMLENAGFHDVIAEDRTDQFLDVLERELAKVEKNK  469

Query  307  EAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
              F+ DFS+EDY+ IV GWK KL R+S+GEQRWGL
Sbjct  470  NEFVSDFSQEDYDAIVNGWKAKLQRSSAGEQRWGL  504


 Score =   122 bits (305),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKKTYPD TFDVIYSRDTILHIQDKP+LF+SF+KWLKPGGKVLI+DYCK
Sbjct  348  KCSVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPSLFKSFFKWLKPGGKVLISDYCK  407



>emb|CDX92181.1| BnaA05g22260D [Brassica napus]
Length=464

 Score =   150 bits (380),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + S  PS EF+ YIKQRGYDLHD + YGQML++AGF DVIA+DRTDQFM+VL++EL+ V
Sbjct  360  CKSSETPSPEFSEYIKQRGYDLHDVQAYGQMLKEAGFNDVIADDRTDQFMQVLRRELERV  419

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEKE FI DFS+EDY DIVGGWK KL R++SGEQ+WGL
Sbjct  420  EKEKEEFISDFSKEDYEDIVGGWKAKLERSASGEQKWGL  458


 Score =   117 bits (294),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCT K YP+ +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLI+DYCK
Sbjct  302  NCSVEFEVADCTTKHYPENSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLISDYCK  361

Query  492  GLDLP  478
              + P
Sbjct  362  SSETP  366



>gb|AAS57723.1| phosphoethanolamine N-methyltransferase [Oryza sativa]
Length=499

 Score =   146 bits (368),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = -3

Query  487  GPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEK  308
            G PSEEFAAYIKQRGYDLHD   YGQML +AGF DVIAEDRTDQF+ VL++EL  VEK  
Sbjct  400  GKPSEEFAAYIKQRGYDLHDVRAYGQMLENAGFHDVIAEDRTDQFLDVLERELAKVEKNN  459

Query  307  EAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
              F+ DFS+EDY+ IV GWK KL R+S+GEQRWGL
Sbjct  460  NEFVSDFSQEDYDAIVNGWKAKLQRSSAGEQRWGL  494


 Score =   122 bits (305),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKKTYPD TFDVIYSRDTILHIQDKP+LF+SF+KWLKPGGKVLI+DYCK
Sbjct  338  KCSVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPSLFKSFFKWLKPGGKVLISDYCK  397



>ref|XP_010097563.1| hypothetical protein L484_017373 [Morus notabilis]
 gb|EXB69095.1| hypothetical protein L484_017373 [Morus notabilis]
Length=503

 Score =   145 bits (365),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             Q +G PS EFA YIKQRGYDLHD E YGQMLRDAGFE+VIAEDRT QF++VL++EL  +
Sbjct  392  CQSAGTPSPEFAKYIKQRGYDLHDVEAYGQMLRDAGFEEVIAEDRTGQFIEVLQRELSVI  451

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEK  FI DFSEEDY DIVGGWK KL RT+S   R  +
Sbjct  452  EKEKNEFISDFSEEDYYDIVGGWKAKLIRTTSVAARLSV  490


 Score =   122 bits (306),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKKTYP+ +FDVIYSRDTILHI DKPALFRSFYKWLKPGGKVLI+DYC+
Sbjct  334  KCSVEFEVADCTKKTYPENSFDVIYSRDTILHIDDKPALFRSFYKWLKPGGKVLISDYCQ  393

Query  492  GLDLP  478
                P
Sbjct  394  SAGTP  398



>ref|XP_006644536.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Oryza 
brachyantha]
Length=499

 Score =   149 bits (377),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = -3

Query  487  GPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEK  308
            G PSEEFAAYIKQRGYDLHD + YG+ML +AGF DV+AEDRTDQF+ VL++EL  VEK K
Sbjct  400  GKPSEEFAAYIKQRGYDLHDVKAYGKMLENAGFHDVVAEDRTDQFLNVLQRELAEVEKNK  459

Query  307  EAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
              F+ DFS+EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  460  NEFVSDFSQEDYDDIVNGWKAKLQRSSAGEQRWGL  494


 Score =   117 bits (292),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -1

Query  669  CAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            C+VEFEVADCT KTYPD TFDVIYSRDTILHIQDKP+LF+SF+ WLKPGGKVLI+DYCK
Sbjct  339  CSVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPSLFKSFFNWLKPGGKVLISDYCK  397



>ref|XP_010465872.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Camelina 
sativa]
Length=491

 Score =   149 bits (375),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS EF+ YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQF +VL++EL++VEKEKE 
Sbjct  393  PSVEFSEYIKQRGYDLHDVQAYGQMLKDAGFKDVIAEDRTDQFTQVLRRELESVEKEKEE  452

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  453  FISDFSKEDYDDIVGGWKAKLERCASDEQKWGL  485


 Score =   116 bits (291),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCT K YPD +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLI+DYC+
Sbjct  329  NCSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLISDYCR  388

Query  492  GLDLP  478
                P
Sbjct  389  SPKTP  393



>ref|NP_973993.1| phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
 sp|Q944H0.2|PEAM2_ARATH RecName: Full=Phosphomethylethanolamine N-methyltransferase; 
Short=AtPMEAMT; AltName: Full=Phosphoethanolamine N-methyltransferase 
2 [Arabidopsis thaliana]
 gb|AEE32323.1| putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis 
thaliana]
Length=491

 Score =   141 bits (356),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS EFA YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQF++VL++EL+ VEKEKE 
Sbjct  393  PSPEFAEYIKQRGYDLHDVQAYGQMLKDAGFDDVIAEDRTDQFVQVLRRELEKVEKEKEE  452

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFSEEDYNDIVGGW  KL RT+SGEQ+WGL
Sbjct  453  FISDFSEEDYNDIVGGWSAKLERTASGEQKWGL  485


 Score =   123 bits (309),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLITDYC+
Sbjct  329  KCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLITDYCR  388

Query  492  GLDLP  478
              + P
Sbjct  389  SAETP  393



>gb|AAP83582.1| phosphoethanolamine N-methyltransferase [Brassica napus]
Length=491

 Score =   150 bits (378),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + S  PS EF+ YIKQRGYDLHD + YGQML+ AGF DVIA+DRTDQFM+VL++EL+ V
Sbjct  387  CKSSETPSPEFSEYIKQRGYDLHDVQAYGQMLKXAGFNDVIADDRTDQFMQVLRRELERV  446

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEKE FI DFS+EDY DIVGGWK KL R++SGEQ+WGL
Sbjct  447  EKEKEEFISDFSKEDYEDIVGGWKAKLERSASGEQKWGL  485


 Score =   115 bits (287),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCT K YP+ + DVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLI+DYCK
Sbjct  329  NCSVEFEVADCTTKHYPENSXDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLISDYCK  388

Query  492  GLDLP  478
              + P
Sbjct  389  SSETP  393



>ref|NP_175293.1| phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
 gb|AAL16223.1|AF428454_1 At1g48600/T1N15_20 [Arabidopsis thaliana]
 gb|AAL36222.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
 gb|AAM91745.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
 gb|AEE32324.1| putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis 
thaliana]
Length=475

 Score =   141 bits (356),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS EFA YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQF++VL++EL+ VEKEKE 
Sbjct  377  PSPEFAEYIKQRGYDLHDVQAYGQMLKDAGFDDVIAEDRTDQFVQVLRRELEKVEKEKEE  436

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFSEEDYNDIVGGW  KL RT+SGEQ+WGL
Sbjct  437  FISDFSEEDYNDIVGGWSAKLERTASGEQKWGL  469


 Score =   123 bits (309),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLITDYC+
Sbjct  313  KCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLITDYCR  372

Query  492  GLDLP  478
              + P
Sbjct  373  SAETP  377



>ref|XP_010097561.1| Phosphoethanolamine N-methyltransferase 1 [Morus notabilis]
 gb|EXB69093.1| Phosphoethanolamine N-methyltransferase 1 [Morus notabilis]
Length=519

 Score =   155 bits (391),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PS EF  YIKQR YDLHD E YGQMLR AGFEDV+AEDRTDQF++VL++ELD V
Sbjct  415  CKSPGTPSVEFVKYIKQREYDLHDVEAYGQMLRAAGFEDVVAEDRTDQFIQVLQRELDVV  474

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+K+ FI DFSEEDYN+IVGGWK KL R++SGEQRWGL
Sbjct  475  EKDKDEFIADFSEEDYNEIVGGWKAKLIRSTSGEQRWGL  513


 Score =   108 bits (270),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 60/88 (68%), Gaps = 23/88 (26%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHI-----------------------QDKP  562
            KC+VEFEVADCTKK YP+++FDVIYSRDTILHI                       QDKP
Sbjct  334  KCSVEFEVADCTKKEYPESSFDVIYSRDTILHIQYSTLLLVPVAQVLLHMTFEPPPQDKP  393

Query  561  ALFRSFYKWLKPGGKVLITDYCKGLDLP  478
            ALFRSF+KWLKPGGKVLI+DYCK    P
Sbjct  394  ALFRSFFKWLKPGGKVLISDYCKSPGTP  421



>ref|XP_006303987.1| hypothetical protein CARUB_v10008968mg [Capsella rubella]
 gb|EOA36885.1| hypothetical protein CARUB_v10008968mg [Capsella rubella]
Length=491

 Score =   141 bits (355),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS EFA YIKQRGYDLHD + YG+ML+DAGFEDVIAEDRTDQF++VL++EL+ VEKEKE 
Sbjct  393  PSPEFAEYIKQRGYDLHDVQAYGKMLKDAGFEDVIAEDRTDQFVEVLRRELEKVEKEKEE  452

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFSEEDYNDIVGGW  KL RT+SGEQ+WGL
Sbjct  453  FINDFSEEDYNDIVGGWSAKLERTASGEQKWGL  485


 Score =   122 bits (305),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLITDYC+
Sbjct  329  NCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLITDYCR  388

Query  492  GLDLP  478
              + P
Sbjct  389  SAETP  393



>ref|XP_004137342.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
sativus]
 gb|KGN63873.1| hypothetical protein Csa_1G025050 [Cucumis sativus]
Length=468

 Score =   141 bits (356),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + +G  S EFA YIKQRGYDLHD + YGQM+ DAGF +V++EDRT+QF++VL++EL+AV
Sbjct  363  CRNAGTSSPEFAEYIKQRGYDLHDVKAYGQMIEDAGFGEVVSEDRTNQFIQVLQQELEAV  422

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            E++K+ FI DFSEE YNDIV GWK KL R+ SGEQRWGL
Sbjct  423  EEQKDRFILDFSEEGYNDIVCGWKAKLNRSLSGEQRWGL  461


 Score =   121 bits (304),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = -1

Query  669  CAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            C+VEFEVADCTKKTYPD TFDVIYSRDTILHIQDKP+LFRSFYKWLKPGGK+ ITDYC+
Sbjct  306  CSVEFEVADCTKKTYPDHTFDVIYSRDTILHIQDKPSLFRSFYKWLKPGGKLFITDYCR  364



>ref|XP_010461752.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Camelina 
sativa]
Length=492

 Score =   138 bits (348),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS EFA YIKQRGYDLHD + YG+ML++AGFEDVIAEDRTDQF++VL++EL+ VEKEKE 
Sbjct  394  PSPEFAEYIKQRGYDLHDVQAYGKMLKEAGFEDVIAEDRTDQFVQVLRRELEKVEKEKEE  453

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDYNDIVGGW  KL RT+SGEQ+WGL
Sbjct  454  FISDFSQEDYNDIVGGWTAKLERTASGEQKWGL  486


 Score =   123 bits (309),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLITDYC+
Sbjct  330  KCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLITDYCR  389

Query  492  GLDLP  478
              + P
Sbjct  390  SAETP  394



>ref|XP_004166030.1| PREDICTED: LOW QUALITY PROTEIN: phosphoethanolamine N-methyltransferase 
1-like [Cucumis sativus]
Length=468

 Score =   141 bits (355),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + +G  S EFA YIKQRGYDLHD + YGQM+ DAGF +V++EDRT+QF++VL++EL+AV
Sbjct  363  CRNAGTSSPEFAEYIKQRGYDLHDVKAYGQMIEDAGFGEVVSEDRTNQFIQVLQQELEAV  422

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            E++K+ FI DFSEE YNDIV GWK KL R+ SGEQRWGL
Sbjct  423  EEQKDRFILDFSEEGYNDIVCGWKAKLNRSLSGEQRWGL  461


 Score =   119 bits (299),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -1

Query  669  CAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            C+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKP+LFRSFYKWLKPGGK+ ITDYC+
Sbjct  306  CSVEFEVADCTKKXYPDHTFDVIYSRDTILHIQDKPSLFRSFYKWLKPGGKLFITDYCR  364



>emb|CDX93681.1| BnaA06g03670D [Brassica napus]
Length=473

 Score =   132 bits (332),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 80/93 (86%), Gaps = 2/93 (2%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS  FA YIKQRGYDLHD + YGQML+DAGFEDVIAEDRTDQF++VL++EL+ VEKEKE 
Sbjct  377  PSPTFAEYIKQRGYDLHDVQAYGQMLKDAGFEDVIAEDRTDQFVQVLRRELEKVEKEKEE  436

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFSEEDYNDIVGGWK KL R  S EQ+WGL
Sbjct  437  FISDFSEEDYNDIVGGWKAKLER--SDEQKWGL  467


 Score =   121 bits (304),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPALF+SF+KWLKPGG+VLITDYCK
Sbjct  313  NCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALFKSFFKWLKPGGRVLITDYCK  372

Query  492  GLDLP  478
              + P
Sbjct  373  SAETP  377



>ref|XP_009147956.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Brassica 
rapa]
Length=489

 Score =   132 bits (332),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 80/93 (86%), Gaps = 2/93 (2%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS  FA YIKQRGYDLHD + YGQML+DAGFEDVIAEDRTDQF++VL++EL+ VEKEKE 
Sbjct  393  PSPTFAEYIKQRGYDLHDVQAYGQMLKDAGFEDVIAEDRTDQFVQVLRRELEKVEKEKEE  452

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFSEEDYNDIVGGWK KL R  S EQ+WGL
Sbjct  453  FISDFSEEDYNDIVGGWKAKLER--SDEQKWGL  483


 Score =   121 bits (304),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPALF+SF+KWLKPGG+VLITDYCK
Sbjct  329  NCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALFKSFFKWLKPGGRVLITDYCK  388

Query  492  GLDLP  478
              + P
Sbjct  389  SAETP  393



>gb|KJB53038.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=480

 Score =   132 bits (332),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 76/99 (77%), Gaps = 9/99 (9%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + +G  S EFA YIKQRGYDLHD + YGQ         VIAEDRTDQF++VL++ELD V
Sbjct  385  CKSAGASSPEFAEYIKQRGYDLHDVKAYGQ---------VIAEDRTDQFIQVLQRELDKV  435

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+K+ FI DFS+EDY+DIVGGWK KL RT SGEQRWGL
Sbjct  436  EKDKDTFITDFSQEDYDDIVGGWKAKLIRTRSGEQRWGL  474


 Score =   119 bits (297),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPALFR FYKWLKPGGKVLI+DYCK
Sbjct  327  NCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALFRYFYKWLKPGGKVLISDYCK  386



>gb|AAF79705.1|AC020889_13 T1N15.23 [Arabidopsis thaliana]
Length=374

 Score =   127 bits (318),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 83/122 (68%), Gaps = 29/122 (24%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS EFA YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQF++VL++EL+ VEKEKE 
Sbjct  247  PSPEFAEYIKQRGYDLHDVQAYGQMLKDAGFDDVIAEDRTDQFVQVLRRELEKVEKEKEE  306

Query  301  FIQDFSE-----------------------------EDYNDIVGGWKLKLTRTSSGEQRW  209
            FI DFSE                             EDYNDIVGGW  KL RT+SGEQ+W
Sbjct  307  FISDFSEVKTFLTTNSFEQNTCLLCSHIDHKILLLQEDYNDIVGGWSAKLERTASGEQKW  366

Query  208  GL  203
            GL
Sbjct  367  GL  368


 Score =   123 bits (309),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLITDYC+
Sbjct  183  KCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLITDYCR  242

Query  492  GLDLP  478
              + P
Sbjct  243  SAETP  247



>emb|CDY40594.1| BnaC06g02100D [Brassica napus]
Length=473

 Score =   128 bits (322),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 79/93 (85%), Gaps = 2/93 (2%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS  FA YIKQRGYDLHD + YGQML+DAGFE VIAEDRTDQF++VL++EL+ VEKEKE 
Sbjct  377  PSPVFAEYIKQRGYDLHDVQAYGQMLKDAGFEYVIAEDRTDQFIQVLRRELEKVEKEKEE  436

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFSEEDYNDIVGGWK KL R  S EQ+WGL
Sbjct  437  FISDFSEEDYNDIVGGWKAKLER--SDEQKWGL  467


 Score =   120 bits (301),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPALF++F+KWLKPGG+VLITDYCK
Sbjct  313  NCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALFKAFFKWLKPGGRVLITDYCK  372

Query  492  GLDLP  478
              + P
Sbjct  373  SAETP  377



>ref|XP_006406666.1| hypothetical protein EUTSA_v10020595mg [Eutrema salsugineum]
 gb|ESQ48119.1| hypothetical protein EUTSA_v10020595mg [Eutrema salsugineum]
Length=491

 Score =   130 bits (326),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS EF+ YIKQRGYDLHD + YGQML+D GF DVIAEDRTDQFM+VL++EL+ VE+EKE 
Sbjct  393  PSPEFSEYIKQRGYDLHDVQAYGQMLKDVGFSDVIAEDRTDQFMQVLRRELERVEREKEE  452

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY+DIVGGWK KL R +SGEQ+WGL
Sbjct  453  FISDFSKEDYDDIVGGWKAKLERVASGEQKWGL  485


 Score =   118 bits (296),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT K YPD +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLI+DYC+
Sbjct  329  KCSVEFEVADCTTKQYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLISDYCR  388

Query  492  GLDLP  478
                P
Sbjct  389  SPKTP  393



>ref|XP_002969650.1| hypothetical protein SELMODRAFT_146547 [Selaginella moellendorffii]
 gb|EFJ29738.1| hypothetical protein SELMODRAFT_146547 [Selaginella moellendorffii]
Length=495

 Score =   143 bits (360),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -3

Query  478  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  299
            S EF  YIK+RGYDLHD + YGQMLRDAGF DV+AEDRTDQF+++L KELDAVE+ K++F
Sbjct  397  SAEFLEYIKKRGYDLHDVDHYGQMLRDAGFVDVVAEDRTDQFVRILTKELDAVERNKKSF  456

Query  298  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            +QDFSEEDY DIV GWK KL R   G Q+WGL
Sbjct  457  LQDFSEEDYEDIVHGWKSKLVRCGQGHQKWGL  488


 Score =   105 bits (261),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC VEFEVADCT+K +P  +FDVIYSRDTILHIQDKPALF     WLKPGGK+LITDYC+
Sbjct  332  KCFVEFEVADCTEKNFPAESFDVIYSRDTILHIQDKPALFARLLSWLKPGGKLLITDYCR  391

Query  492  GLD  484
              D
Sbjct  392  SKD  394



>ref|XP_002970912.1| hypothetical protein SELMODRAFT_270875 [Selaginella moellendorffii]
 gb|EFJ28238.1| hypothetical protein SELMODRAFT_270875 [Selaginella moellendorffii]
Length=495

 Score =   141 bits (355),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = -3

Query  478  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  299
            S EF  YIK+RGYDLHD + YGQMLRDAGF DV+AEDRTDQF+++L KELD VE+ K++F
Sbjct  397  SAEFLEYIKKRGYDLHDVDHYGQMLRDAGFVDVVAEDRTDQFVRILTKELDTVERNKKSF  456

Query  298  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            +QDFSEEDY DIV GWK KL R   G Q+WGL
Sbjct  457  LQDFSEEDYEDIVQGWKSKLVRCGQGHQKWGL  488


 Score =   105 bits (262),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC VEFEVADCT+K +P  +FDVIYSRDTILHIQDKPALF     WLKPGGK+LITDYC+
Sbjct  332  KCFVEFEVADCTEKNFPAESFDVIYSRDTILHIQDKPALFARLLSWLKPGGKLLITDYCR  391

Query  492  GLD  484
              D
Sbjct  392  SRD  394



>emb|CAN75113.1| hypothetical protein VITISV_043577 [Vitis vinifera]
Length=431

 Score =   122 bits (305),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 70/99 (71%), Gaps = 7/99 (7%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +RSGPPS EF AYI QRGYDLHD E YGQML+DAGF++VIAEDRTDQ    +   +D  
Sbjct  332  CKRSGPPSPEFEAYIGQRGYDLHDVEAYGQMLKDAGFDEVIAEDRTDQPXSEVLFNIDIX  391

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
                   I   S+EDY DIVGGWK KL R+S GEQRWGL
Sbjct  392  -------ILIPSQEDYKDIVGGWKSKLVRSSMGEQRWGL  423


 Score =   119 bits (299),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 57/57 (100%), Gaps = 0/57 (0%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            VEFEVADCTKKTYPD+TFDVIYSRDTILHIQDKPALFRSF+KWLKPGGKVLI+DYCK
Sbjct  277  VEFEVADCTKKTYPDSTFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCK  333



>ref|XP_010481025.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=427

 Score =   123 bits (309),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = -3

Query  502  LLQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDA  323
              + +G PS E AAY+++R YDLH  + YG ML++AGFEDVIAEDRTDQF +VL++EL+ 
Sbjct  322  FCRSAGTPSLEVAAYMERRRYDLHGVQAYGNMLKEAGFEDVIAEDRTDQFAQVLRRELEK  381

Query  322  VEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            V+ EKE +I DFSE DYNDIV  W  KL + +S E +WGL
Sbjct  382  VKNEKEEYISDFSEGDYNDIVRVWTAKLRKAASDELKWGL  421


 Score =   118 bits (295),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT KTYPD +FDVIYSRDT LH+QDKPALFR F+KWLKPGGK+LITD+C+
Sbjct  265  KCSVEFEVADCTTKTYPDNSFDVIYSRDTFLHVQDKPALFRKFFKWLKPGGKILITDFCR  324

Query  492  GLDLP  478
                P
Sbjct  325  SAGTP  329



>gb|KDO63824.1| hypothetical protein CISIN_1g043471mg [Citrus sinensis]
Length=485

 Score =   120 bits (302),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKKTYP+ +FDVIYSRDTILHIQDKPALF+SF+KWLKPGG VLI+DYCK
Sbjct  330  KCSVEFEVADCTKKTYPENSFDVIYSRDTILHIQDKPALFKSFFKWLKPGGTVLISDYCK  389

Query  492  GLDLP  478
                P
Sbjct  390  SFGTP  394


 Score =   111 bits (277),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = -3

Query  487  GPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEK  308
            G PS EF+ YIKQRGYDLHD + YGQML+DAGF D+IAEDRT+QF++VL++ELDA+EK+K
Sbjct  392  GTPSVEFSEYIKQRGYDLHDVKSYGQMLKDAGFVDIIAEDRTEQFVQVLQRELDAIEKDK  451

Query  307  EAFIQDFSE  281
            +AFI+DFSE
Sbjct  452  DAFIKDFSE  460



>gb|KJB30123.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=464

 Score =   120 bits (302),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD +FDVIYSRDTILHI DKPALFRSFYKWLKPGGK+LI+DYCK
Sbjct  331  KCSVEFEVADCTKKVYPDNSFDVIYSRDTILHIHDKPALFRSFYKWLKPGGKLLISDYCK  390

Query  492  GLDLP  478
                P
Sbjct  391  SSKTP  395


 Score =   109 bits (272),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + S  PS EFAAYIKQRGYDLHD + YGQML DAGF+ ++AEDRTDQF++VL++EL+ V
Sbjct  389  CKSSKTPSTEFAAYIKQRGYDLHDVKSYGQMLEDAGFDVILAEDRTDQFLQVLQRELNQV  448

Query  319  EKEKEAFIQDFSE  281
            EKEK+AFI DFS+
Sbjct  449  EKEKDAFISDFSK  461



>gb|ABK24808.1| unknown [Picea sitchensis]
Length=472

 Score =   115 bits (288),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            +CAVEFEV+DCTKK YP+ TFDVIYSRDTILHIQDKP LF+ FYKWLKPGG++LI+DYCK
Sbjct  327  QCAVEFEVSDCTKKEYPEGTFDVIYSRDTILHIQDKPVLFQKFYKWLKPGGRLLISDYCK  386


 Score =   112 bits (280),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 3/80 (4%)
 Frame = -3

Query  487  GPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEK  308
            G  S EF AYIKQRGYDLHD + YGQMLRDAGF+DV+AEDRTDQF+K+L+KEL + EK+K
Sbjct  389  GTASLEFHAYIKQRGYDLHDVDAYGQMLRDAGFDDVVAEDRTDQFIKILQKELSSAEKDK  448

Query  307  EAFIQDFSEEDYN---DIVG  257
            +AFI+DFSE   N    IVG
Sbjct  449  DAFIRDFSEVSLNSNLSIVG  468



>gb|EAY75471.1| hypothetical protein OsI_03371 [Oryza sativa Indica Group]
Length=456

 Score =   121 bits (303),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKKTYPD TFDVIYSRDTILHIQDKP+LF+SF+KWLKPGGKVLI+DYCK
Sbjct  313  KCSVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPSLFKSFFKWLKPGGKVLISDYCK  372


 Score =   106 bits (265),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 62/95 (65%), Gaps = 18/95 (19%)
 Frame = -3

Query  487  GPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEK  308
            G PSEEFAAYIKQRGYDLHD   YGQ                  F+ VL++EL  VEK K
Sbjct  375  GKPSEEFAAYIKQRGYDLHDVRAYGQ------------------FLDVLERELAKVEKNK  416

Query  307  EAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
              F+ DFS+EDY+ IV GWK KL R+S+GEQRWGL
Sbjct  417  NEFVSDFSQEDYDAIVNGWKAKLQRSSAGEQRWGL  451



>ref|XP_003619836.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
 gb|AES76054.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=497

 Score =   112 bits (280),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            K AVEFE  DCTKK+YPD TFDVIYSRDT+LHI+DKP LFRSFYKWLKPGG +LITDYCK
Sbjct  335  KYAVEFECVDCTKKSYPDKTFDVIYSRDTLLHIKDKPTLFRSFYKWLKPGGTLLITDYCK  394

Query  492  GL  487
             +
Sbjct  395  SV  396


 Score =   110 bits (274),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = -3

Query  487  GPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEK  308
            G  S E+A YIK+RGY +HD + Y QML +AGF+DVIA D+T+ F+K L+ EL+A+E +K
Sbjct  397  GSLSVEYAEYIKKRGYYIHDMKAYFQMLENAGFDDVIAVDQTNLFLKTLQMELNALENKK  456

Query  307  EAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
              FI DFSE+DYN+IV  WK K  R  +GEQ WGL
Sbjct  457  VDFIDDFSEDDYNEIVERWKAKQMRGVAGEQIWGL  491



>ref|XP_003619840.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=419

 Score =   111 bits (277),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            K AVEFE  DCTKK+YPD TFDVIYSRDT+LHI+DKP LFRSFYKWLKPGG +LITDYCK
Sbjct  257  KYAVEFECVDCTKKSYPDKTFDVIYSRDTLLHIKDKPTLFRSFYKWLKPGGTLLITDYCK  316

Query  492  GL  487
             +
Sbjct  317  SV  318


 Score =   110 bits (274),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = -3

Query  487  GPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEK  308
            G  S E+A YIK+RGY +HD + Y QML +AGF+DVIA D+T+ F+K L+ EL+A+E +K
Sbjct  319  GSLSVEYAEYIKKRGYYIHDMKAYFQMLENAGFDDVIAVDQTNLFLKTLQMELNALENKK  378

Query  307  EAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
              FI DFSE+DYN+IV  WK K  R  +GEQ WGL
Sbjct  379  VDFIDDFSEDDYNEIVERWKAKQMRGVAGEQIWGL  413



>ref|XP_004512745.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Cicer arietinum]
Length=496

 Score =   109 bits (273),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            K AVEFE  DCTKKTYP+ TFDVIY+RDT+LHI+DKP LFRSFYKWLKPGG +LI+DYCK
Sbjct  334  KYAVEFECVDCTKKTYPEKTFDVIYTRDTLLHIKDKPTLFRSFYKWLKPGGTLLISDYCK  393

Query  492  GL  487
             +
Sbjct  394  SV  395


 Score =   105 bits (261),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = -3

Query  487  GPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEK  308
            G  S E+A YIK+RGY +HD   Y QML +AGF+ VI +D+T+ F+K L+KEL+++E +K
Sbjct  396  GNLSIEYAEYIKKRGYYIHDMNAYCQMLENAGFDYVIDQDQTNLFLKTLQKELNSLENKK  455

Query  307  EAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
              FI +FSE+DYN+IV  WK K  R  +GEQ WGL
Sbjct  456  VDFINEFSEDDYNEIVERWKAKKMRGEAGEQIWGL  490



>ref|XP_004512744.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Cicer arietinum]
Length=497

 Score =   109 bits (273),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            K AVEFE  DCTKKTYP+ TFDVIY+RDT+LHI+DKP LFRSFYKWLKPGG +LI+DYCK
Sbjct  335  KYAVEFECVDCTKKTYPEKTFDVIYTRDTLLHIKDKPTLFRSFYKWLKPGGTLLISDYCK  394

Query  492  GL  487
             +
Sbjct  395  SV  396


 Score =   105 bits (261),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = -3

Query  487  GPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEK  308
            G  S E+A YIK+RGY +HD   Y QML +AGF+ VI +D+T+ F+K L+KEL+++E +K
Sbjct  397  GNLSIEYAEYIKKRGYYIHDMNAYCQMLENAGFDYVIDQDQTNLFLKTLQKELNSLENKK  456

Query  307  EAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
              FI +FSE+DYN+IV  WK K  R  +GEQ WGL
Sbjct  457  VDFINEFSEDDYNEIVERWKAKKMRGEAGEQIWGL  491



>ref|XP_003528975.2| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
 gb|KHN44632.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=531

 Score =   108 bits (271),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC VEFE ADCTKKT+P  TFDVIYSRDT+LHI+DKP+LFRSFYKWLK GG +LITDYCK
Sbjct  370  KCCVEFECADCTKKTFPVNTFDVIYSRDTLLHIKDKPSLFRSFYKWLKRGGTLLITDYCK  429


 Score =   105 bits (263),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = -3

Query  487  GPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEK  308
            G  S  +A YIK+ GY +HD + Y +ML +AGF+DV+AEDRT+ FMK L++EL+A+  +K
Sbjct  432  GSLSLGYAEYIKKGGYYIHDMKTYCRMLENAGFDDVVAEDRTNLFMKTLQQELNALHSKK  491

Query  307  EAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            + FI DFSEEDYN+I   WK K  R + GEQ W L
Sbjct  492  DDFIDDFSEEDYNEITERWKAKQMRGADGEQIWSL  526



>gb|AGM38074.1| putative phosphoethanolamine N-methyltransferase, partial [Stenocereus 
gummosus]
Length=111

 Score =   159 bits (401),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +++G  S EFA YIKQRGYDLHD +EYGQMLRDAGF++VIAEDRTDQF++VL++ELD+V
Sbjct  7    CKKAGQTSPEFAQYIKQRGYDLHDVQEYGQMLRDAGFDEVIAEDRTDQFIRVLQRELDSV  66

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEK+AFI DFS EDYNDIV GWK KL R+++GEQRWGL
Sbjct  67   EKEKDAFISDFSMEDYNDIVDGWKAKLVRSTAGEQRWGL  105



>ref|XP_010774827.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Notothenia 
coriiceps]
Length=438

 Score =   109 bits (273),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = -3

Query  478  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  299
            +  F AY+KQRGY LH   +YGQ +++AGF +V +EDRT QF++V+K EL   E  ++ F
Sbjct  341  TPAFQAYVKQRGYVLHTPSQYGQFIQEAGFCNVRSEDRTAQFIQVIKTELQRAELIRDEF  400

Query  298  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            IQ+FSEEDY  IV GW+ KL R++SG+QRWGL
Sbjct  401  IQEFSEEDYLAIVKGWREKLERSNSGDQRWGL  432


 Score =   100 bits (250),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V+FEVAD TK+++PDA+FDVIYSRDTILHI+DK ALF+ F+ WLKPGGK+LI+DYC G
Sbjct  278  SVQFEVADATKRSFPDASFDVIYSRDTILHIEDKLALFKRFHSWLKPGGKLLISDYCCG  336



>ref|XP_004073222.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Oryzias 
latipes]
Length=485

 Score =   110 bits (275),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P S+ F +Y+KQRGY L+   +YG+ +++AGF +V AEDRT QF++V+K EL   E  KE
Sbjct  386  PWSQAFESYVKQRGYILYTPAQYGKFIQEAGFCEVRAEDRTSQFIQVIKDELKKAEAIKE  445

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FIQ+FSEEDY  +V GWK KL R+++G+QRWGL
Sbjct  446  EFIQEFSEEDYLAVVNGWKEKLERSNTGDQRWGL  479


 Score = 97.1 bits (240),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            V+FEVAD TK+T+P+ +FDV+YSRDTILHI DK ALFR F+ WLKPGG++LI+DYC G
Sbjct  326  VQFEVADATKRTFPEGSFDVVYSRDTILHIDDKLALFRRFHSWLKPGGQLLISDYCCG  383



>ref|XP_007550439.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Poecilia 
formosa]
Length=492

 Score =   109 bits (272),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P +  F AY+KQRGY L+   EYG+ +++AGF +V  EDRT QF++V++ EL   E  KE
Sbjct  393  PWTPVFEAYVKQRGYILYTPSEYGKFIQEAGFCNVRVEDRTAQFIQVIQTELQRAEDIKE  452

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FIQ+FSEEDY+ IV GW+ KL R+ SG+QRWGL
Sbjct  453  EFIQEFSEEDYSAIVNGWREKLDRSKSGDQRWGL  486


 Score = 97.1 bits (240),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V+FEVAD TK+T+P+ +FDVIYSRDTILHI DK ALF+ F+ WLKPGG++LI+DYC G
Sbjct  332  SVQFEVADATKRTFPEGSFDVIYSRDTILHIDDKVALFKRFHSWLKPGGQLLISDYCCG  390



>ref|XP_009832411.1| hypothetical protein H257_08283 [Aphanomyces astaci]
 gb|ETV78074.1| hypothetical protein H257_08283 [Aphanomyces astaci]
Length=507

 Score =   103 bits (258),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P S+ F AY+  RGY L    +YG +L  AGF DV+AEDRT+ F  VL+ EL      ++
Sbjct  408  PQSDRFQAYVASRGYHLLSPSQYGGVLTAAGFADVVAEDRTEHFTNVLEAELARTVANRD  467

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FI   SE+DY DIVGGW+ KLTR + G+Q+WGL
Sbjct  468  EFIAQTSEKDYQDIVGGWESKLTRCADGDQKWGL  501


 Score =   102 bits (253),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKGLD  484
            VEFEV D T K YP  +FDVIYSRDTILHIQDK  LF  FY+WLKPGG+VLI+DYC+G D
Sbjct  348  VEFEVCDATTKEYPAGSFDVIYSRDTILHIQDKLGLFEKFYRWLKPGGRVLISDYCRG-D  406

Query  483  LPQKN  469
             PQ +
Sbjct  407  QPQSD  411



>emb|CDO98349.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +R+GPPS++F  YIKQRGYDLHD E YGQML+DAGF++VIAEDRT QF+ VL+KEL+ V
Sbjct  387  CKRAGPPSDDFVKYIKQRGYDLHDVEAYGQMLKDAGFDEVIAEDRTHQFINVLQKELELV  446

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK++EAFI DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  447  EKDREAFISDFSEEDYNDIVGGWKAKLLRSSSGEQRWGL  485


 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            +C+VEFEVADCTKKTYPD +FDVIYSRDTILHIQDKPALF+SFYKWLKPGG VLI+DYCK
Sbjct  329  RCSVEFEVADCTKKTYPDGSFDVIYSRDTILHIQDKPALFKSFYKWLKPGGTVLISDYCK  388

Query  492  GLDLPQKNLQRILSK  448
                P  +  + + +
Sbjct  389  RAGPPSDDFVKYIKQ  403



>ref|XP_008324913.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Cynoglossus semilaevis]
Length=491

 Score =   107 bits (268),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P + EF AY+K+RGY L+   +YG+++ +AGF +V A DRT+QF++VLK EL   +  K 
Sbjct  392  PWNPEFEAYVKKRGYILYTPSQYGKVIEEAGFRNVQATDRTEQFIQVLKTELQRAQAMKT  451

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FIQ+FSEEDY  IV GW  KL R++SG QRWGL
Sbjct  452  QFIQEFSEEDYFAIVNGWSDKLKRSNSGAQRWGL  485


 Score = 97.8 bits (242),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V+FEVAD TK+T+P+ +FDVIYSRDTILHI DK ALF+ F+ WLKPGGK+LI+DYC G
Sbjct  331  SVQFEVADATKRTFPEGSFDVIYSRDTILHIDDKLALFQRFHSWLKPGGKLLISDYCCG  389



>emb|CCA16454.1| phosphoethanolamine Nmethyltransferase putative [Albugo laibachii 
Nc14]
Length=494

 Score =   105 bits (263),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            P+  FA Y++ RGY L   E YG +L +AGF +VIAEDRT QFM +L++ELD     K+ 
Sbjct  396  PTNRFADYVQGRGYHLLTVEAYGALLTEAGFRNVIAEDRTRQFMNILREELDRTVSSKDE  455

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FIQ+ S +D+N IV GW+ KL R   G+QRWG 
Sbjct  456  FIQETSNDDFNAIVKGWEAKLIRCDEGDQRWGF  488


 Score = 99.8 bits (247),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKGLD  484
            VEFE+ D T + +PD +FDVIYSRDTILHIQDK  LF+ F++WL+PGG+VLITDYC+G  
Sbjct  335  VEFEICDATTREFPDESFDVIYSRDTILHIQDKTTLFQRFFRWLRPGGRVLITDYCRGGK  394

Query  483  LP  478
             P
Sbjct  395  RP  396



>ref|XP_002532097.1| phosphoethanolamine n-methyltransferase, putative [Ricinus communis]
 gb|EEF30287.1| phosphoethanolamine n-methyltransferase, putative [Ricinus communis]
Length=492

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + +G PS EFA YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQF +VLK+ELD +
Sbjct  388  CKSAGTPSSEFAEYIKQRGYDLHDVKAYGQMLKDAGFDDVIAEDRTDQFNQVLKRELDVI  447

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEK+ FI DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  448  EKEKDEFIHDFSEEDYNDIVGGWKAKLIRSSSGEQRWGL  486


 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKKTYPD +FDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLI+DYCK
Sbjct  330  KCAVEFEVADCTKKTYPDNSFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLISDYCK  389

Query  492  GLDLPQKNLQRILSK  448
                P       + +
Sbjct  390  SAGTPSSEFAEYIKQ  404



>ref|XP_008324912.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Cynoglossus semilaevis]
Length=495

 Score =   108 bits (269),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P + EF AY+K+RGY L+   +YG+++ +AGF +V A DRT+QF++VLK EL   +  K 
Sbjct  396  PWNPEFEAYVKKRGYILYTPSQYGKVIEEAGFRNVQATDRTEQFIQVLKTELQRAQAMKT  455

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FIQ+FSEEDY  IV GW  KL R++SG QRWGL
Sbjct  456  QFIQEFSEEDYFAIVNGWSDKLKRSNSGAQRWGL  489


 Score = 97.1 bits (240),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            V+FEVAD TK+T+P+ +FDVIYSRDTILHI DK ALF+ F+ WLKPGGK+LI+DYC G
Sbjct  336  VQFEVADATKRTFPEGSFDVIYSRDTILHIDDKLALFQRFHSWLKPGGKLLISDYCCG  393



>ref|XP_008324914.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
 ref|XP_008324916.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
 ref|XP_008324917.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
Length=488

 Score =   107 bits (268),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P + EF AY+K+RGY L+   +YG+++ +AGF +V A DRT+QF++VLK EL   +  K 
Sbjct  389  PWNPEFEAYVKKRGYILYTPSQYGKVIEEAGFRNVQATDRTEQFIQVLKTELQRAQAMKT  448

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FIQ+FSEEDY  IV GW  KL R++SG QRWGL
Sbjct  449  QFIQEFSEEDYFAIVNGWSDKLKRSNSGAQRWGL  482


 Score = 97.1 bits (240),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            V+FEVAD TK+T+P+ +FDVIYSRDTILHI DK ALF+ F+ WLKPGGK+LI+DYC G
Sbjct  329  VQFEVADATKRTFPEGSFDVIYSRDTILHIDDKLALFQRFHSWLKPGGKLLISDYCCG  386



>ref|XP_004545582.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Maylandia zebra]
Length=491

 Score =   109 bits (273),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P +  F AY+KQRGY L+   EYG+ +++AGF  V AEDRT QF++V+K EL   E  K+
Sbjct  392  PWTPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKVRAEDRTAQFIEVIKTELQRAEVIKD  451

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FI++FSEEDY +IV GWK KL R++SG+QRWGL
Sbjct  452  EFIKEFSEEDYFEIVNGWKEKLERSNSGDQRWGL  485


 Score = 95.1 bits (235),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V FEVAD TK+T+P+ +FDVIYSRDTILHI DK ALF+ F+ WLKPGG++LI+DYC G
Sbjct  331  SVRFEVADATKRTFPEDSFDVIYSRDTILHIDDKLALFKRFHSWLKPGGQLLISDYCCG  389



>ref|XP_004545581.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Maylandia zebra]
Length=492

 Score =   109 bits (273),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P +  F AY+KQRGY L+   EYG+ +++AGF  V AEDRT QF++V+K EL   E  K+
Sbjct  393  PWTPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKVRAEDRTAQFIEVIKTELQRAEVIKD  452

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FI++FSEEDY +IV GWK KL R++SG+QRWGL
Sbjct  453  EFIKEFSEEDYFEIVNGWKEKLERSNSGDQRWGL  486


 Score = 95.1 bits (235),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V FEVAD TK+T+P+ +FDVIYSRDTILHI DK ALF+ F+ WLKPGG++LI+DYC G
Sbjct  332  SVRFEVADATKRTFPEDSFDVIYSRDTILHIDDKLALFKRFHSWLKPGGQLLISDYCCG  390



>ref|XP_005467627.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Oreochromis niloticus]
 ref|XP_005467628.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Oreochromis niloticus]
Length=492

 Score =   109 bits (273),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P +  F AY+KQRGY L+   EYG+ +++AGF  V AEDRT QF++V+K EL   E  K+
Sbjct  393  PWTPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKVRAEDRTAQFIEVIKTELQRAEAIKD  452

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FI++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  453  EFIKEFSEEDYFAIVNGWKEKLERSTSGDQRWGL  486


 Score = 95.1 bits (235),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V FEVAD TK+T+P+ +FDVIYSRDTILHI DK ALF+ F+ WLKPGG++LI+DYC G
Sbjct  332  SVRFEVADATKRTFPEDSFDVIYSRDTILHIDDKLALFKRFHSWLKPGGQLLISDYCCG  390



>ref|XP_003444639.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Oreochromis niloticus]
Length=493

 Score =   109 bits (273),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P +  F AY+KQRGY L+   EYG+ +++AGF  V AEDRT QF++V+K EL   E  K+
Sbjct  394  PWTPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKVRAEDRTAQFIEVIKTELQRAEAIKD  453

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FI++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  454  EFIKEFSEEDYFAIVNGWKEKLERSTSGDQRWGL  487


 Score = 94.7 bits (234),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V FEVAD TK+T+P+ +FDVIYSRDTILHI DK ALF+ F+ WLKPGG++LI+DYC G
Sbjct  333  SVRFEVADATKRTFPEDSFDVIYSRDTILHIDDKLALFKRFHSWLKPGGQLLISDYCCG  391



>ref|XP_005723168.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Pundamilia nyererei]
Length=491

 Score =   109 bits (272),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P +  F AY+KQRGY L+   EYG+ +++AGF  V AEDRT QF++V+K EL   E  K+
Sbjct  392  PWTPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKVRAEDRTAQFIEVIKTELQRAEAIKD  451

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FI++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  452  EFIKEFSEEDYFAIVNGWKEKLERSNSGDQRWGL  485


 Score = 95.1 bits (235),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V FEVAD TK+T+P+ +FDVIYSRDTILHI DK ALF+ F+ WLKPGG++LI+DYC G
Sbjct  331  SVRFEVADATKRTFPEDSFDVIYSRDTILHIDDKLALFKRFHSWLKPGGQLLISDYCCG  389



>ref|XP_005467629.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X4 [Oreochromis niloticus]
Length=485

 Score =   109 bits (273),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P +  F AY+KQRGY L+   EYG+ +++AGF  V AEDRT QF++V+K EL   E  K+
Sbjct  386  PWTPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKVRAEDRTAQFIEVIKTELQRAEAIKD  445

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FI++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  446  EFIKEFSEEDYFAIVNGWKEKLERSTSGDQRWGL  479


 Score = 94.7 bits (234),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V FEVAD TK+T+P+ +FDVIYSRDTILHI DK ALF+ F+ WLKPGG++LI+DYC G
Sbjct  325  SVRFEVADATKRTFPEDSFDVIYSRDTILHIDDKLALFKRFHSWLKPGGQLLISDYCCG  383



>ref|XP_005723167.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Pundamilia nyererei]
Length=492

 Score =   109 bits (272),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P +  F AY+KQRGY L+   EYG+ +++AGF  V AEDRT QF++V+K EL   E  K+
Sbjct  393  PWTPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKVRAEDRTAQFIEVIKTELQRAEAIKD  452

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FI++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  453  EFIKEFSEEDYFAIVNGWKEKLERSNSGDQRWGL  486


 Score = 95.1 bits (235),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V FEVAD TK+T+P+ +FDVIYSRDTILHI DK ALF+ F+ WLKPGG++LI+DYC G
Sbjct  332  SVRFEVADATKRTFPEDSFDVIYSRDTILHIDDKLALFKRFHSWLKPGGQLLISDYCCG  390



>ref|XP_005913450.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Haplochromis burtoni]
Length=492

 Score =   109 bits (272),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P +  F AY+KQRGY L+   EYG+ +++AGF  V AEDRT QF++V+K EL   E  K+
Sbjct  393  PWTPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKVRAEDRTAQFIEVIKTELQRAEAIKD  452

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FI++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  453  EFIKEFSEEDYFAIVNGWKEKLERSNSGDQRWGL  486


 Score = 95.1 bits (235),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V FEVAD TK+T+P+ +FDVIYSRDTILHI DK ALF+ F+ WLKPGG++LI+DYC G
Sbjct  332  SVRFEVADATKRTFPEDSFDVIYSRDTILHIDDKLALFKRFHSWLKPGGQLLISDYCCG  390



>ref|XP_005723169.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Pundamilia nyererei]
Length=485

 Score =   109 bits (272),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P +  F AY+KQRGY L+   EYG+ +++AGF  V AEDRT QF++V+K EL   E  K+
Sbjct  386  PWTPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKVRAEDRTAQFIEVIKTELQRAEAIKD  445

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FI++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  446  EFIKEFSEEDYFAIVNGWKEKLERSNSGDQRWGL  479


 Score = 94.7 bits (234),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V FEVAD TK+T+P+ +FDVIYSRDTILHI DK ALF+ F+ WLKPGG++LI+DYC G
Sbjct  325  SVRFEVADATKRTFPEDSFDVIYSRDTILHIDDKLALFKRFHSWLKPGGQLLISDYCCG  383



>ref|XP_005913451.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Haplochromis burtoni]
Length=485

 Score =   109 bits (272),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P +  F AY+KQRGY L+   EYG+ +++AGF  V AEDRT QF++V+K EL   E  K+
Sbjct  386  PWTPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKVRAEDRTAQFIEVIKTELQRAEAIKD  445

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FI++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  446  EFIKEFSEEDYFAIVNGWKEKLERSNSGDQRWGL  479


 Score = 94.7 bits (234),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V FEVAD TK+T+P+ +FDVIYSRDTILHI DK ALF+ F+ WLKPGG++LI+DYC G
Sbjct  325  SVRFEVADATKRTFPEDSFDVIYSRDTILHIDDKLALFKRFHSWLKPGGQLLISDYCCG  383



>ref|NP_001096276.2| phosphoethanolamine methyltransferase [Xenopus (Silurana) tropicalis]
Length=494

 Score =   106 bits (264),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P S  F  Y+KQRGY L+  +EYGQ L  AGF +V A+DRT+QF+ VL KEL   +  K+
Sbjct  390  PWSPVFQEYVKQRGYILYTPQEYGQFLEKAGFVNVQAQDRTEQFVNVLNKELGRTQDIKK  449

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FI+ FSEEDYN I+ GWK K  R S G+QRWGL
Sbjct  450  EFIESFSEEDYNYIIDGWKEKQHRCSLGDQRWGL  483


 Score = 97.8 bits (242),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            V+FE+ D TK+++ +A+FDV+YSRDTILHI DK ALFR FY WLKPGGK+LITDYC G
Sbjct  330  VQFEIGDATKRSFSEASFDVVYSRDTILHINDKEALFRRFYTWLKPGGKLLITDYCCG  387



>gb|AAI35513.1| LOC100124841 protein [Xenopus (Silurana) tropicalis]
Length=486

 Score =   106 bits (264),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P S  F  Y+KQRGY L+  +EYGQ L  AGF +V A+DRT+QF+ VL KEL   +  K+
Sbjct  382  PWSPVFQEYVKQRGYILYTPQEYGQFLEKAGFVNVQAQDRTEQFVNVLNKELGRTQDIKK  441

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FI+ FSEEDYN I+ GWK K  R S G+QRWGL
Sbjct  442  EFIESFSEEDYNYIIDGWKEKQHRCSLGDQRWGL  475


 Score = 97.4 bits (241),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            V+FE+ D TK+++ +A+FDV+YSRDTILHI DK ALFR FY WLKPGGK+LITDYC G
Sbjct  322  VQFEIGDATKRSFSEASFDVVYSRDTILHINDKEALFRRFYTWLKPGGKLLITDYCCG  379



>ref|NP_001070105.1| phosphoethanolamine methyltransferase [Danio rerio]
 gb|AAI24222.1| Zgc:153034 [Danio rerio]
Length=489

 Score =   108 bits (271),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P S  F  Y+KQRGY L+  + YGQ LR+ GF +V AEDRT+QF++V+K EL   E+ K+
Sbjct  390  PWSPAFQDYVKQRGYILYTPQRYGQFLREVGFSNVRAEDRTEQFIQVIKSELQRAEEMKD  449

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FIQ+FS+ED++ IV GW  KL R  +G+QRWGL
Sbjct  450  EFIQEFSKEDFDAIVSGWTEKLQRCETGDQRWGL  483


 Score = 95.1 bits (235),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            V+FEV+D TK+ +PDA FDV+YSRDTILHI+DK  LF +FY W+KPGGK+LI+DYC G
Sbjct  330  VQFEVSDATKRRFPDAAFDVVYSRDTILHIRDKLHLFTNFYSWMKPGGKLLISDYCCG  387



>ref|XP_006781399.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Neolamprologus 
brichardi]
Length=492

 Score =   108 bits (271),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P +  F AY+KQRGY L+   EYG+ +++AGF  V AEDRT QF++V+K EL   E  K+
Sbjct  393  PWTPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKVRAEDRTAQFIEVIKTELQRAEAIKD  452

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             F+++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  453  EFVKEFSEEDYFAIVNGWKEKLGRSNSGDQRWGL  486


 Score = 94.7 bits (234),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V FEVAD TK+T+P+ +FDVIYSRDTILHI DK ALF+ F+ WLKPGG++LI+DYC G
Sbjct  332  SVRFEVADATKRTFPEDSFDVIYSRDTILHIDDKLALFKRFHSWLKPGGQLLISDYCCG  390



>ref|XP_003970259.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Takifugu 
rubripes]
Length=484

 Score =   105 bits (263),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P +  F  Y+KQRGY L+   +YG+ L +AGF +V+AEDRT QF++V++ EL+  E  ++
Sbjct  385  PWTPVFETYVKQRGYILYTPPQYGKFLTEAGFCNVLAEDRTAQFIQVIETELERAEAIRK  444

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FI++FS+EDY  IV GWK KL R+ SG+QRWGL
Sbjct  445  EFIEEFSDEDYLAIVNGWKEKLARSKSGDQRWGL  478


 Score = 97.8 bits (242),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V+FEVAD TK+ +PD +FDVIYSRDTILHI +KPALF+ F+ WLKPGG++LI+DYC G
Sbjct  324  SVQFEVADATKRMFPDCSFDVIYSRDTILHIDNKPALFKRFHSWLKPGGQLLISDYCCG  382



>emb|CBI26879.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +R+GPPS EF  YI+QRGYDLHD + YGQML+DAGF +VIAEDRT+QF+KVL++E+DAV
Sbjct  371  CKRAGPPSPEFQEYIEQRGYDLHDVKAYGQMLKDAGFCEVIAEDRTEQFIKVLQREMDAV  430

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K+ FIQDFSEEDYN+IVGGWK KL R+SSGEQRWGL
Sbjct  431  EKNKDEFIQDFSEEDYNEIVGGWKSKLNRSSSGEQRWGL  469


 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC VEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPALF+SF+KWLKPGGKVLITDYCK
Sbjct  313  KCLVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPALFKSFFKWLKPGGKVLITDYCK  372

Query  492  GLDLPQKNLQRILSK  448
                P    Q  + +
Sbjct  373  RAGPPSPEFQEYIEQ  387



>emb|CCI39434.1| unnamed protein product [Albugo candida]
Length=494

 Score =   102 bits (253),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            P+  FA Y++ RGY L   + YG +L +AGF +V AEDRT QFM +L++ELD     K+ 
Sbjct  396  PTNRFADYVQGRGYHLLTVDAYGALLTEAGFCNVSAEDRTSQFMSILREELDRTVSSKDE  455

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FIQD S++D+N IV GW+ KL R   G+Q+WG 
Sbjct  456  FIQDTSKDDFNAIVKGWEAKLIRCEEGDQKWGF  488


 Score = 99.8 bits (247),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            K  VEFE+ D T + +PD +FDVIYSRDTILHIQDK  LF  F++WL+PGG+VLITDYC+
Sbjct  332  KLDVEFEICDATTREFPDQSFDVIYSRDTILHIQDKKTLFERFFRWLRPGGRVLITDYCR  391

Query  492  GLDLP  478
            G   P
Sbjct  392  GGKRP  396



>ref|XP_010655650.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Vitis vinifera]
Length=494

 Score =   161 bits (408),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +R+GPPS EF  YI+QRGYDLHD + YGQML+DAGF +VIAEDRT+QF+KVL++E+DAV
Sbjct  390  CKRAGPPSPEFQEYIEQRGYDLHDVKAYGQMLKDAGFCEVIAEDRTEQFIKVLQREMDAV  449

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K+ FIQDFSEEDYN+IVGGWK KL R+SSGEQRWGL
Sbjct  450  EKNKDEFIQDFSEEDYNEIVGGWKSKLNRSSSGEQRWGL  488


 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC VEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPALF+SF+KWLKPGGKVLITDYCK
Sbjct  332  KCLVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPALFKSFFKWLKPGGKVLITDYCK  391

Query  492  GLDLPQKNLQRILSK  448
                P    Q  + +
Sbjct  392  RAGPPSPEFQEYIEQ  406



>ref|XP_002284594.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Vitis vinifera]
Length=490

 Score =   161 bits (408),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +R+GPPS EF  YI+QRGYDLHD + YGQML+DAGF +VIAEDRT+QF+KVL++E+DAV
Sbjct  386  CKRAGPPSPEFQEYIEQRGYDLHDVKAYGQMLKDAGFCEVIAEDRTEQFIKVLQREMDAV  445

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K+ FIQDFSEEDYN+IVGGWK KL R+SSGEQRWGL
Sbjct  446  EKNKDEFIQDFSEEDYNEIVGGWKSKLNRSSSGEQRWGL  484


 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC VEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPALF+SF+KWLKPGGKVLITDYCK
Sbjct  328  KCLVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPALFKSFFKWLKPGGKVLITDYCK  387

Query  492  GLDLPQKNLQRILSK  448
                P    Q  + +
Sbjct  388  RAGPPSPEFQEYIEQ  402



>ref|XP_009385384.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Musa 
acuminata subsp. malaccensis]
Length=497

 Score =   161 bits (408),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             ++SG PSE+FAAYIKQRGYDLHD ++YGQMLRDAGF +VIAEDRT+QF++VL+KELDAV
Sbjct  393  CKKSGTPSEDFAAYIKQRGYDLHDVDDYGQMLRDAGFHEVIAEDRTNQFLEVLQKELDAV  452

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+KEAFI DFS+EDY++IV GWK KL R+ +GEQRWGL
Sbjct  453  EKDKEAFIHDFSQEDYDEIVSGWKAKLKRSWTGEQRWGL  491


 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKKTYPD TFDVIYSRDTILHIQDKP+LF+ F+KWLKPGGKVLI+DYCK
Sbjct  335  KCSVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPSLFKGFFKWLKPGGKVLISDYCK  394

Query  492  GLDLPQKNL  466
                P ++ 
Sbjct  395  KSGTPSEDF  403



>ref|XP_005806845.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Xiphophorus 
maculatus]
Length=492

 Score =   108 bits (269),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P +  F AY+KQRGY L+   EYG+ +++AGF +V  EDRT QF++V++ EL   E  KE
Sbjct  393  PWTPVFEAYVKQRGYILYTPSEYGKFIQEAGFCNVRVEDRTAQFIQVIQTELQRAEDIKE  452

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FIQ+FSEEDY+ IV GW+ KL R+ SG+QRWGL
Sbjct  453  EFIQEFSEEDYSAIVDGWREKLDRSKSGDQRWGL  486


 Score = 93.2 bits (230),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V+FEVAD TK+T+P+  FDVIYSRDTILHI DK  LF+ F+ WLKPGG++LI+DYC G
Sbjct  332  SVQFEVADATKRTFPEGLFDVIYSRDTILHIDDKLDLFKRFHSWLKPGGQLLISDYCCG  390



>ref|XP_008418601.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Poecilia reticulata]
Length=491

 Score =   105 bits (262),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P +  F AY+KQRGY L+   EYG+ +++AGF +V  EDRT QF++V++ EL   E  K+
Sbjct  392  PWTPVFEAYVKQRGYILYTPSEYGKFVQEAGFCNVRVEDRTAQFIEVIQTELQRAEDIKD  451

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FIQ+FSEEDY  IV GW+ KL R+ SG+QRWGL
Sbjct  452  EFIQEFSEEDYLAIVNGWREKLDRSKSGDQRWGL  485


 Score = 95.1 bits (235),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V+FEVAD TK+ +P+ +FDVIYSRDTILHI DK ALF+ F+ WLKPGG++LI+DYC G
Sbjct  331  SVQFEVADATKRMFPEGSFDVIYSRDTILHIDDKLALFKRFHSWLKPGGQLLISDYCCG  389



>ref|XP_008418600.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Poecilia reticulata]
Length=492

 Score =   105 bits (262),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P +  F AY+KQRGY L+   EYG+ +++AGF +V  EDRT QF++V++ EL   E  K+
Sbjct  393  PWTPVFEAYVKQRGYILYTPSEYGKFVQEAGFCNVRVEDRTAQFIEVIQTELQRAEDIKD  452

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FIQ+FSEEDY  IV GW+ KL R+ SG+QRWGL
Sbjct  453  EFIQEFSEEDYLAIVNGWREKLDRSKSGDQRWGL  486


 Score = 95.1 bits (235),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V+FEVAD TK+ +P+ +FDVIYSRDTILHI DK ALF+ F+ WLKPGG++LI+DYC G
Sbjct  332  SVQFEVADATKRMFPEGSFDVIYSRDTILHIDDKLALFKRFHSWLKPGGQLLISDYCCG  390



>gb|ELT87122.1| hypothetical protein CAPTEDRAFT_189076 [Capitella teleta]
Length=501

 Score =   100 bits (249),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYC  496
            +C V+FEVAD TK+ YP+ +FDV+YSRDTILHI+DK +LF SF+KWLKPGG++LI+DYC
Sbjct  339  ECHVQFEVADATKRDYPENSFDVVYSRDTILHIKDKKSLFASFFKWLKPGGRLLISDYC  397


 Score = 99.4 bits (246),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 62/92 (67%), Gaps = 0/92 (0%)
 Frame = -3

Query  478  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  299
            S  F +Y+ QRGY L   ++YG++L   GF  V+AEDRT+QF+ VLK EL   E  K+ F
Sbjct  404  SPAFTSYVAQRGYILLSPKQYGKVLEGVGFVKVLAEDRTNQFVNVLKNELTKFEPMKDEF  463

Query  298  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            +++FS+ DY+ IV GW  KL R   G+QRWGL
Sbjct  464  VKEFSQADYDAIVTGWNDKLYRCGLGDQRWGL  495



>ref|NP_001167350.1| phosphoethanolamine N-methyltransferase 3 [Salmo salar]
 gb|ACN11445.1| phosphoethanolamine N-methyltransferase 3 [Salmo salar]
Length=495

 Score =   104 bits (260),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P + +F  Y+KQRGY L+   +YG+ L+ AGF +V AEDRT QFM+V++ EL+     K+
Sbjct  396  PWTPQFQEYVKQRGYILYTPPQYGKFLQQAGFSNVRAEDRTAQFMQVIQTELERAAAMKD  455

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FI++FSEEDY  IV GW  KL R  +G+QRWGL
Sbjct  456  EFIKEFSEEDYLAIVNGWSDKLKRCKTGDQRWGL  489


 Score = 95.1 bits (235),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V FEVAD TK+ +P+A+FDV+YSRDTILHI +K ALF+ F+ WLKPGG+VLI+DYC G
Sbjct  335  SVHFEVADATKREFPEASFDVVYSRDTILHIDEKLALFKRFHSWLKPGGQVLISDYCCG  393



>ref|XP_010274723.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Nelumbo nucifera]
Length=489

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +R+G PS+EFA YI+QRGY LHD E YGQML+DAGF++VIAEDRT+QF++VL++ELDAV
Sbjct  386  CKRAGSPSKEFAQYIEQRGYGLHDVEAYGQMLKDAGFKEVIAEDRTNQFIEVLQRELDAV  445

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK +EAFI DFSEEDY++IVGGWK KL R+SSGEQRWGL
Sbjct  446  EKAREAFIHDFSEEDYDEIVGGWKAKLVRSSSGEQRWGL  484


 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPALF+SF+KWLKPGGKVLI+DYCK
Sbjct  328  KCSVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPALFKSFFKWLKPGGKVLISDYCK  387

Query  492  GLDLPQKNLQRILSK  448
                P K   + + +
Sbjct  388  RAGSPSKEFAQYIEQ  402



>ref|XP_002887491.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63750.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=490

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS +FA YIKQRGYDLHD + YGQMLRDAGFE+V AEDRTDQFMKVLK+ELDAVEKEKE 
Sbjct  392  PSSDFANYIKQRGYDLHDVQAYGQMLRDAGFEEVTAEDRTDQFMKVLKRELDAVEKEKEE  451

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY DI+GGWK KL R+SSGEQ+WGL
Sbjct  452  FISDFSKEDYEDIIGGWKSKLLRSSSGEQKWGL  484


 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD  FDVIYSRDTILHIQDKPALFR+FYKWLKPGGKVLITDYC+
Sbjct  328  KCSVEFEVADCTKKEYPDNIFDVIYSRDTILHIQDKPALFRTFYKWLKPGGKVLITDYCR  387

Query  492  GLDLPQKNLQRILSK  448
                P  +    + +
Sbjct  388  SPKTPSSDFANYIKQ  402



>ref|XP_005643867.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE19323.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=498

 Score =   120 bits (301),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = -3

Query  487  GPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEK  308
            G PS++FAAYI QRGYDLH  ++YG+ML  AGF DV AEDRT QF   LKKE++A E  +
Sbjct  397  GSPSDKFAAYIAQRGYDLHSVDDYGRMLTKAGFVDVKAEDRTWQFEACLKKEVEAAEAGR  456

Query  307  EAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            E F++DFS  D++ IV GW+ KL R   GEQRWGL
Sbjct  457  EEFVRDFSAADHDAIVSGWRDKLVRVGEGEQRWGL  491


 Score = 78.6 bits (192),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -1

Query  669  CAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
             +V FE+AD T       ++DV+YSRDTILHI DKPALF+ F   LKPGG++LI+DYC+ 
Sbjct  336  SSVSFEIADITTCEMAKESYDVVYSRDTILHIHDKPALFKRFLDVLKPGGRLLISDYCRA  395

Query  489  LDLPQ  475
               P 
Sbjct  396  PGSPS  400



>gb|EYU33965.1| hypothetical protein MIMGU_mgv1a005263mg [Erythranthe guttata]
Length=491

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PS EFA YIKQRGYDLHD + Y QML DAGF++VIAEDRTDQF+KVL+KELDAV
Sbjct  387  CRNVGSPSAEFAEYIKQRGYDLHDVKAYSQMLGDAGFDEVIAEDRTDQFIKVLEKELDAV  446

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+KE FI+DFSEEDYN+IVGGWK KL R+SSGEQRWGL
Sbjct  447  EKDKEEFIRDFSEEDYNEIVGGWKAKLVRSSSGEQRWGL  485


 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             CAVEFEVADCTKK YPD TFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLI+DYC+
Sbjct  329  NCAVEFEVADCTKKEYPDGTFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLISDYCR  388

Query  492  GLDLPQKNLQRILSK  448
             +  P       + +
Sbjct  389  NVGSPSAEFAEYIKQ  403



>ref|XP_008278559.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Stegastes partitus]
Length=510

 Score =   105 bits (261),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P +  F AY+KQRGY L+   +YG+ +++AGF +V A+DRT  F++V+K EL   E  K+
Sbjct  411  PWTPAFEAYVKQRGYVLYTPTQYGKFIQEAGFSNVRADDRTGHFIQVIKTELQRAEAIKD  470

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             +I++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  471  DYIKEFSEEDYFAIVNGWKEKLERSNSGDQRWGL  504


 Score = 94.0 bits (232),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V+FEV+D TK+ +P+ +FDVIYSRDTILHI DK ALF+ F+ WLKPGG++LI+DYC G
Sbjct  350  SVQFEVSDATKRMFPEGSFDVIYSRDTILHIDDKLALFKRFHSWLKPGGQLLISDYCCG  408



>ref|XP_011453570.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Crassostrea gigas]
Length=499

 Score =   112 bits (281),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -3

Query  478  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  299
            SE+F AY+KQRGY+L   E+YG++L  AGF +V A+DRTD F++ L+KEL   E  K+ F
Sbjct  400  SEQFKAYVKQRGYNLLSPEQYGKVLEKAGFVNVKADDRTDLFVESLEKELVRTETIKDDF  459

Query  298  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            I++FS++DY+DIVGGWK KL RT++G+QRWG+
Sbjct  460  IKEFSQKDYDDIVGGWKDKLVRTATGDQRWGV  491


 Score = 85.9 bits (211),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYC  496
            V+FEVAD TK+ YPD  FDV+YSRDTILHI+DK  LF+ FY+ LKPGG++LI+DY 
Sbjct  338  VQFEVADATKRVYPDNYFDVVYSRDTILHIKDKLDLFQRFYRCLKPGGRLLISDYA  393



>ref|XP_010730439.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Larimichthys crocea]
Length=506

 Score =   103 bits (256),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P +  F AY+KQRGY L+   +YG+ L +AGF +V AEDRT QF++V++ EL   E  K+
Sbjct  407  PWTPVFEAYVKQRGYILYTPSQYGKFLEEAGFCNVRAEDRTAQFIQVIETELQRAEAIKD  466

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             F + FSEEDY  I+ GW+ KL R++SG+QRWGL
Sbjct  467  EFTEQFSEEDYFAIINGWREKLGRSNSGDQRWGL  500


 Score = 95.5 bits (236),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V+FEVAD TK+T+P+ +FDVIYSRDTILHI DK ALF+ F+ WLKPGG++LI+DYC G
Sbjct  346  SVQFEVADATKRTFPEDSFDVIYSRDTILHIDDKLALFKRFHSWLKPGGQLLISDYCCG  404



>ref|XP_010730440.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Larimichthys crocea]
Length=500

 Score =   103 bits (256),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P +  F AY+KQRGY L+   +YG+ L +AGF +V AEDRT QF++V++ EL   E  K+
Sbjct  401  PWTPVFEAYVKQRGYILYTPSQYGKFLEEAGFCNVRAEDRTAQFIQVIETELQRAEAIKD  460

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             F + FSEEDY  I+ GW+ KL R++SG+QRWGL
Sbjct  461  EFTEQFSEEDYFAIINGWREKLGRSNSGDQRWGL  494


 Score = 95.5 bits (236),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V+FEVAD TK+T+P+ +FDVIYSRDTILHI DK ALF+ F+ WLKPGG++LI+DYC G
Sbjct  340  SVQFEVADATKRTFPEDSFDVIYSRDTILHIDDKLALFKRFHSWLKPGGQLLISDYCCG  398



>ref|XP_008278560.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Stegastes partitus]
 ref|XP_008278561.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Stegastes partitus]
Length=492

 Score =   105 bits (261),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P +  F AY+KQRGY L+   +YG+ +++AGF +V A+DRT  F++V+K EL   E  K+
Sbjct  393  PWTPAFEAYVKQRGYVLYTPTQYGKFIQEAGFSNVRADDRTGHFIQVIKTELQRAEAIKD  452

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             +I++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  453  DYIKEFSEEDYFAIVNGWKEKLERSNSGDQRWGL  486


 Score = 94.0 bits (232),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -1

Query  669  CAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
             +V+FEV+D TK+ +P+ +FDVIYSRDTILHI DK ALF+ F+ WLKPGG++LI+DYC G
Sbjct  331  TSVQFEVSDATKRMFPEGSFDVIYSRDTILHIDDKLALFKRFHSWLKPGGQLLISDYCCG  390



>ref|XP_011453569.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Crassostrea gigas]
 gb|EKC31484.1| Putative phosphoethanolamine N-methyltransferase 3 [Crassostrea 
gigas]
Length=506

 Score =   112 bits (281),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -3

Query  478  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  299
            SE+F AY+KQRGY+L   E+YG++L  AGF +V A+DRTD F++ L+KEL   E  K+ F
Sbjct  407  SEQFKAYVKQRGYNLLSPEQYGKVLEKAGFVNVKADDRTDLFVESLEKELVRTETIKDDF  466

Query  298  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            I++FS++DY+DIVGGWK KL RT++G+QRWG+
Sbjct  467  IKEFSQKDYDDIVGGWKDKLVRTATGDQRWGV  498


 Score = 85.9 bits (211),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYC  496
            V+FEVAD TK+ YPD  FDV+YSRDTILHI+DK  LF+ FY+ LKPGG++LI+DY 
Sbjct  345  VQFEVADATKRVYPDNYFDVVYSRDTILHIKDKLDLFQRFYRCLKPGGRLLISDYA  400



>ref|XP_011453571.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Crassostrea gigas]
 ref|XP_011453572.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Crassostrea gigas]
Length=489

 Score =   112 bits (281),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -3

Query  478  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  299
            SE+F AY+KQRGY+L   E+YG++L  AGF +V A+DRTD F++ L+KEL   E  K+ F
Sbjct  390  SEQFKAYVKQRGYNLLSPEQYGKVLEKAGFVNVKADDRTDLFVESLEKELVRTETIKDDF  449

Query  298  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            I++FS++DY+DIVGGWK KL RT++G+QRWG+
Sbjct  450  IKEFSQKDYDDIVGGWKDKLVRTATGDQRWGV  481


 Score = 85.9 bits (211),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYC  496
            V+FEVAD TK+ YPD  FDV+YSRDTILHI+DK  LF+ FY+ LKPGG++LI+DY 
Sbjct  328  VQFEVADATKRVYPDNYFDVVYSRDTILHIKDKLDLFQRFYRCLKPGGRLLISDYA  383



>ref|XP_002282182.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Vitis 
vinifera]
 emb|CBI15568.3| unnamed protein product [Vitis vinifera]
Length=491

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +R+GPPS EF+ YIKQRGYDLHD E YG+MLRDAGF +VIAEDRTDQF++VL++EL+AV
Sbjct  387  CKRAGPPSSEFSEYIKQRGYDLHDVEAYGEMLRDAGFIEVIAEDRTDQFLQVLQRELNAV  446

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            E  K  F+QDFSE+DYN+IV GWK KL R+SSGEQRWGL
Sbjct  447  ETNKNEFVQDFSEDDYNEIVDGWKAKLMRSSSGEQRWGL  485


 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK+YPD TFDVIYSRDTILHIQDKPALF+SF+KWLKPGGKVLI+DYCK
Sbjct  329  KCSVEFEVADCTKKSYPDNTFDVIYSRDTILHIQDKPALFKSFFKWLKPGGKVLISDYCK  388

Query  492  GLDLPQKNLQRILSK  448
                P       + +
Sbjct  389  RAGPPSSEFSEYIKQ  403



>ref|XP_010263678.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nelumbo 
nucifera]
Length=489

 Score =   159 bits (401),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +R+G PS+EFA YI+QRGYDLHD E YGQMLRDAGF++V AEDRTDQF+KVL++ELDAV
Sbjct  386  CKRAGSPSKEFAEYIEQRGYDLHDVEAYGQMLRDAGFKEVNAEDRTDQFIKVLQRELDAV  445

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK +  FI DFSEEDYN+IVGGWK KL R+S GEQRWGL
Sbjct  446  EKARGTFIYDFSEEDYNEIVGGWKAKLVRSSMGEQRWGL  484


 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC VEFEVADCTKK YP+ TFDVIYSRDTILHI+DKPALF+SF+KWLKPGGKVLI+DYCK
Sbjct  328  KCLVEFEVADCTKKAYPNNTFDVIYSRDTILHIKDKPALFKSFFKWLKPGGKVLISDYCK  387

Query  492  GLDLPQKNLQRILSK  448
                P K     + +
Sbjct  388  RAGSPSKEFAEYIEQ  402



>gb|KJB30119.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=443

 Score =   120 bits (302),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD +FDVIYSRDTILHI DKPALFRSFYKWLKPGGK+LI+DYCK
Sbjct  331  KCSVEFEVADCTKKVYPDNSFDVIYSRDTILHIHDKPALFRSFYKWLKPGGKLLISDYCK  390

Query  492  GLDLPQ  475
                P 
Sbjct  391  SSKTPS  396


 Score = 76.6 bits (187),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQ  356
             + S  PS EFAAYIKQRGYDLHD + YGQML DAGF+ ++AEDRTDQ
Sbjct  389  CKSSKTPSTEFAAYIKQRGYDLHDVKSYGQMLEDAGFDVILAEDRTDQ  436



>emb|CAN64744.1| hypothetical protein VITISV_041321 [Vitis vinifera]
Length=490

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +R+GPPS EF+ YIKQRGYDLH+ E YG+MLRDAGF +VIAEDRTDQF++VL +EL+AV
Sbjct  386  CKRAGPPSSEFSEYIKQRGYDLHBVEAYGEMLRDAGFIEVIAEDRTDQFLQVLXRELNAV  445

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            E  K  F+QDFSE+DYN+IV GWK KL R+SSGEQRWGL
Sbjct  446  ETNKNEFVQDFSEDDYNEIVDGWKAKLMRSSSGEQRWGL  484


 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK+YPD TFDVIYSRDTILHIQDKPALF+SF+KWLKPGGKVLI+DYCK
Sbjct  328  KCSVEFEVADCTKKSYPDNTFDVIYSRDTILHIQDKPALFKSFFKWLKPGGKVLISDYCK  387

Query  492  GLDLPQKNLQRILSK  448
                P       + +
Sbjct  388  RAGPPSSEFSEYIKQ  402



>ref|XP_006302164.1| hypothetical protein CARUB_v10020173mg [Capsella rubella]
 gb|EOA35062.1| hypothetical protein CARUB_v10020173mg [Capsella rubella]
Length=503

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS +FA YIKQRGYDLHD + YGQML+DAGFE+VIAEDRTDQFMKVLK+ELDAVEKEK+ 
Sbjct  405  PSSDFANYIKQRGYDLHDVQAYGQMLKDAGFEEVIAEDRTDQFMKVLKRELDAVEKEKDE  464

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  465  FISDFSKEDYEDIVGGWSSKLLRSSSGEQKWGL  497


 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPALFR+FYKWLKPGGK+LITDYC+
Sbjct  341  KCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPALFRTFYKWLKPGGKILITDYCR  400

Query  492  GLDLPQKNLQRILSK  448
                P  +    + +
Sbjct  401  SPKTPSSDFANYIKQ  415



>gb|ETP40953.1| hypothetical protein F442_11791, partial [Phytophthora parasitica 
P10297]
Length=247

 Score =   102 bits (254),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKGLD  484
            VEFE+ D TKK +PDA+FDV+YSRDTILHI+DK ALF  F++WLKPGG+VLI+DYC+G  
Sbjct  88   VEFEICDATKKEFPDASFDVVYSRDTILHIEDKQALFAKFFRWLKPGGRVLISDYCRGEQ  147

Query  483  LP  478
             P
Sbjct  148  EP  149


 Score = 95.1 bits (235),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            P++ F AY+  RGY L    +YG++L   GF  V+AEDRT+QF++VLK EL     +KE 
Sbjct  149  PTDRFKAYVAGRGYHLLSPSQYGKVLESVGFTSVLAEDRTEQFVEVLKDELTRTLAQKEQ  208

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            F+ + SE D+  IV GW+ K+ R   G+Q+WGL
Sbjct  209  FVAETSESDFKYIVDGWEAKIVRCGEGDQKWGL  241



>ref|XP_010864863.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Esox 
lucius]
Length=495

 Score =   103 bits (256),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P + +F  Y+KQRGY L+   +YG+ L  AGF DV AEDRT QFM+V++ EL      K+
Sbjct  396  PWTPQFQEYVKQRGYILYTPPQYGKFLEQAGFSDVRAEDRTAQFMQVIEMELARAVPIKD  455

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FI++FSEEDY  I+ GW  KL R ++G+QRWGL
Sbjct  456  EFIKEFSEEDYLAIINGWSEKLQRCTTGDQRWGL  489


 Score = 94.0 bits (232),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V FEVAD TK+ +P  +FDV+YSRDTILHI DK ALF+ F+ WLKPGG+VLI+DYC G
Sbjct  335  SVHFEVADATKRDFPQGSFDVVYSRDTILHIDDKLALFKRFHSWLKPGGQVLISDYCCG  393



>ref|XP_007209942.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11141.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=491

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + +G PS EFA YIKQRGYDLH+ + YGQML+DAGF++VIAEDRTDQF +VL++ELDAV
Sbjct  387  CRSAGTPSAEFAEYIKQRGYDLHNVQAYGQMLKDAGFDEVIAEDRTDQFKEVLQRELDAV  446

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+K+AFIQDFSEEDY+DIVGGWK KL R  SGEQ+WGL
Sbjct  447  EKDKDAFIQDFSEEDYDDIVGGWKAKLIRADSGEQKWGL  485


 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCT+KTY D TFDVIYSRDTILHIQDKPALFRSFY+WLKPGGKVLI+DYC+
Sbjct  329  KCAVEFEVADCTQKTYADDTFDVIYSRDTILHIQDKPALFRSFYRWLKPGGKVLISDYCR  388

Query  492  GLDLPQKNL-QRILSKGVMTYMIQ  424
                P     + I  +G   + +Q
Sbjct  389  SAGTPSAEFAEYIKQRGYDLHNVQ  412



>ref|XP_002891445.1| hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67704.1| hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS +FA YI+QRGYDLHD + YGQML+DAGFEDVIAEDRTDQF++VL++ELD VEKEKE 
Sbjct  393  PSPDFAEYIEQRGYDLHDVQAYGQMLKDAGFEDVIAEDRTDQFVRVLRRELDKVEKEKEE  452

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFSEEDYNDIVGGW  KL RT+SGEQ+WGL
Sbjct  453  FISDFSEEDYNDIVGGWTAKLERTASGEQKWGL  485


 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLITDYC+
Sbjct  329  KCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALFRAFFKWLKPGGKVLITDYCR  388

Query  492  GLDLPQKNLQRILSK  448
              + P  +    + +
Sbjct  389  SAETPSPDFAEYIEQ  403



>gb|AEY75253.1| phosphoethanolamine N-methyltransferase [Atriplex canescens]
Length=494

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 96/133 (72%), Gaps = 8/133 (6%)
 Frame = -3

Query  577  YSRQT--------CTFQVILQMVEARGQSPHY*LLQRSGPPSEEFAAYIKQRGYDLHDTE  422
            YSR T          F+  L+ ++  G+       + +GPPS EFAAYIKQRGYDLHD +
Sbjct  356  YSRDTILHIQDKPALFRSFLKWLKPGGKVLISDYCKSAGPPSSEFAAYIKQRGYDLHDVK  415

Query  421  EYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLK  242
             YGQML+DAGF +VIAEDRTDQF+KVL++EL A+E EK+ FI DFSE+DYNDIV GWK K
Sbjct  416  AYGQMLKDAGFIEVIAEDRTDQFIKVLQRELYALEMEKDEFIADFSEQDYNDIVDGWKAK  475

Query  241  LTRTSSGEQRWGL  203
            L RT  GEQRWGL
Sbjct  476  LVRTKGGEQRWGL  488


 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            K AVEFEVADCTKK YP+ +FDVIYSRDTILHIQDKPALFRSF KWLKPGGKVLI+DYCK
Sbjct  332  KYAVEFEVADCTKKDYPENSFDVIYSRDTILHIQDKPALFRSFLKWLKPGGKVLISDYCK  391

Query  492  GLDLPQKNL  466
                P    
Sbjct  392  SAGPPSSEF  400



>gb|KFK41794.1| hypothetical protein AALP_AA2G173000 [Arabis alpina]
Length=505

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS +FA YIKQRGYDLHD + YGQML+DAGF +VIAEDRTDQFMKVLK+ELDAVEKEK+ 
Sbjct  407  PSADFANYIKQRGYDLHDVQAYGQMLKDAGFNEVIAEDRTDQFMKVLKRELDAVEKEKDD  466

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY DI+GGWK KL R+SSGEQ+WGL
Sbjct  467  FISDFSKEDYEDIIGGWKSKLLRSSSGEQKWGL  499


 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPALFR+FYKWLKPGGKVLITDYC+
Sbjct  343  KCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPALFRTFYKWLKPGGKVLITDYCR  402

Query  492  GLDLPQKNLQRILSK  448
                P  +    + +
Sbjct  403  SPKTPSADFANYIKQ  417



>dbj|BAC57960.1| phosphoethanolamine N-methyltransferase [Aster tripolium]
Length=493

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             ++SG PSE+FA YIKQRGYDLHD E YG+ML+DAGF +VIAEDRT QF++VL++EL+ V
Sbjct  389  CRKSGKPSEDFAEYIKQRGYDLHDVETYGKMLKDAGFGEVIAEDRTKQFIEVLQRELERV  448

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEKE FIQDF+E DYNDIVGGWK KL RT SGEQRWGL
Sbjct  449  EKEKEEFIQDFTEGDYNDIVGGWKAKLVRTGSGEQRWGL  487


 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            +C+VEFEVADCTKK+YPD +FDVIYSRDTILHIQDKPALFR+FYKWLKPGGKVLI+DYC+
Sbjct  331  QCSVEFEVADCTKKSYPDNSFDVIYSRDTILHIQDKPALFRTFYKWLKPGGKVLISDYCR  390

Query  492  GLDLPQKNLQRILSK  448
                P ++    + +
Sbjct  391  KSGKPSEDFAEYIKQ  405



>ref|NP_001056231.2| Os05g0548900 [Oryza sativa Japonica Group]
 dbj|BAF18145.2| Os05g0548900, partial [Oryza sativa Japonica Group]
Length=208

 Score =   150 bits (379),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLHD + YG+ML DAGF  VIAEDRTDQF++VL++EL  V
Sbjct  105  CRNPGKPSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHHVIAEDRTDQFLRVLQRELAEV  164

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK KEAF+ DF++EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  165  EKNKEAFMADFTQEDYDDIVNGWNAKLKRSSAGEQRWGL  203


 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT KTY   TFDVIYSRDTILHI DKPALFRSF+KWLKPGGKVLI+DYC+
Sbjct  47   KCSVEFEVADCTTKTYAPNTFDVIYSRDTILHIHDKPALFRSFFKWLKPGGKVLISDYCR  106

Query  492  GLDLPQKNL  466
                P +  
Sbjct  107  NPGKPSEEF  115



>ref|NP_001087172.1| phosphoethanolamine methyltransferase [Xenopus laevis]
 gb|AAH78119.1| MGC83638 protein [Xenopus laevis]
Length=494

 Score =   101 bits (252),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P +  F  Y+KQRGY L+  +EYGQ L  AGF +V A+DRT+QF+ VL  EL      K+
Sbjct  390  PWAPVFQEYVKQRGYILYTPQEYGQFLEKAGFVNVQAQDRTEQFVNVLNTELSRTRDIKQ  449

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FI++FSEEDY  I+ GWK K  R S G+QRWGL
Sbjct  450  QFIENFSEEDYKYIIDGWKEKQHRCSLGDQRWGL  483


 Score = 93.2 bits (230),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            V+FE+ D T++ + + +FDV+YSRDTILHI DK ALFR FY W+KPGGK+LITDYC G
Sbjct  330  VQFEIGDATRRCFSEGSFDVVYSRDTILHINDKEALFRRFYSWIKPGGKLLITDYCCG  387



>ref|XP_010921205.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921212.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921222.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921230.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921238.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
Length=480

 Score =   155 bits (393),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +RSG PSEEFA YIKQRGYDLHD E YGQML+DAGF +V AEDRT QF++VL++ELDAV
Sbjct  371  CKRSGTPSEEFAEYIKQRGYDLHDVEAYGQMLKDAGFYEVTAEDRTTQFLEVLQRELDAV  430

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+++AFI++FS+EDY++IVGGWK KL R+S GEQRWGL
Sbjct  431  EKDRDAFIKEFSKEDYDEIVGGWKAKLKRSSVGEQRWGL  469


 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK Y D TF VIYSRDTILHIQDKP LFRSF+KWLKPGGK+LITDYCK
Sbjct  313  KCSVEFEVADCTKKIYSDNTFAVIYSRDTILHIQDKPMLFRSFFKWLKPGGKLLITDYCK  372

Query  492  GLDLPQKNLQRILSK  448
                P +     + +
Sbjct  373  RSGTPSEEFAEYIKQ  387



>ref|XP_010921197.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Elaeis guineensis]
Length=499

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +RSG PSEEFA YIKQRGYDLHD E YGQML+DAGF +V AEDRT QF++VL++ELDAV
Sbjct  390  CKRSGTPSEEFAEYIKQRGYDLHDVEAYGQMLKDAGFYEVTAEDRTTQFLEVLQRELDAV  449

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+++AFI++FS+EDY++IVGGWK KL R+S GEQRWGL
Sbjct  450  EKDRDAFIKEFSKEDYDEIVGGWKAKLKRSSVGEQRWGL  488


 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK Y D TF VIYSRDTILHIQDKP LFRSF+KWLKPGGK+LITDYCK
Sbjct  332  KCSVEFEVADCTKKIYSDNTFAVIYSRDTILHIQDKPMLFRSFFKWLKPGGKLLITDYCK  391

Query  492  GLDLPQKNL  466
                P +  
Sbjct  392  RSGTPSEEF  400



>ref|XP_007228349.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Astyanax 
mexicanus]
Length=551

 Score =   100 bits (249),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P +  F  Y+ QRGY L+  + YGQ L +AGF  V AEDRT QF++V+K EL   E+ + 
Sbjct  452  PWTPAFQDYVNQRGYILYTPQRYGQFLEEAGFTKVRAEDRTAQFIQVIKDELKRAEEIQN  511

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FIQ+FS+EDY+ IV GW  KL R  +G+Q+WGL
Sbjct  512  EFIQEFSQEDYDAIVNGWTEKLQRCEAGDQQWGL  545


 Score = 93.6 bits (231),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V+FEV+D TK+ +P+ +FDV+YSRDTILHI DK  LFR F+ WL+PGGK+LI+DYC G
Sbjct  391  SVQFEVSDATKRIFPEGSFDVVYSRDTILHISDKLELFRKFHSWLRPGGKLLISDYCCG  449



>ref|XP_010921188.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Elaeis guineensis]
Length=537

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +RSG PSEEFA YIKQRGYDLHD E YGQML+DAGF +V AEDRT QF++VL++ELDAV
Sbjct  428  CKRSGTPSEEFAEYIKQRGYDLHDVEAYGQMLKDAGFYEVTAEDRTTQFLEVLQRELDAV  487

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+++AFI++FS+EDY++IVGGWK KL R+S GEQRWGL
Sbjct  488  EKDRDAFIKEFSKEDYDEIVGGWKAKLKRSSVGEQRWGL  526


 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK Y D TF VIYSRDTILHIQDKP LFRSF+KWLKPGGK+LITDYCK
Sbjct  370  KCSVEFEVADCTKKIYSDNTFAVIYSRDTILHIQDKPMLFRSFFKWLKPGGKLLITDYCK  429

Query  492  GLDLPQKNLQRILSK  448
                P +     + +
Sbjct  430  RSGTPSEEFAEYIKQ  444



>gb|KJB53041.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=448

 Score =   119 bits (297),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPALFR FYKWLKPGGKVLI+DYCK
Sbjct  327  NCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALFRYFYKWLKPGGKVLISDYCK  386


 Score = 74.3 bits (181),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQ  356
             + +G  S EFA YIKQRGYDLHD + YGQML DAGF+ VIAEDRTDQ
Sbjct  385  CKSAGASSPEFAEYIKQRGYDLHDVKAYGQMLTDAGFDQVIAEDRTDQ  432



>ref|XP_002594089.1| hypothetical protein BRAFLDRAFT_118790 [Branchiostoma floridae]
 gb|EEN50100.1| hypothetical protein BRAFLDRAFT_118790 [Branchiostoma floridae]
Length=577

 Score = 99.0 bits (245),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = -3

Query  478  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  299
            S+ F  Y+ QRGY L+   +YG++L +AGF +V AEDRT QF  +L +E+   E  KE F
Sbjct  408  SDVFKQYVAQRGYTLYSPAKYGKLLEEAGFINVQAEDRTQQFTDILNREVARTEANKEEF  467

Query  298  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            I++FSEED+  IV GWK KL R   G+Q+WGL
Sbjct  468  IKEFSEEDFRYIVEGWKAKLHRCELGDQKWGL  499


 Score = 94.4 bits (233),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            V FE++DCTK+ YP  TFDV+YSRDTILHIQDK  LF+ F  WLKPGGK+LI+DYC G
Sbjct  346  VRFEISDCTKREYPAETFDVVYSRDTILHIQDKLPLFKRFLTWLKPGGKLLISDYCCG  403



>gb|KDP23923.1| hypothetical protein JCGZ_27083 [Jatropha curcas]
Length=491

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + +G PSEEFA YIKQRGYDLH  + YGQMLRDAGF+DVIAEDRTDQF +VL++ELDA 
Sbjct  387  CKSAGTPSEEFAEYIKQRGYDLHCVKAYGQMLRDAGFDDVIAEDRTDQFNQVLQQELDAT  446

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K+ FI DFSE+DYNDI+ GWK KL R+SSGEQRWGL
Sbjct  447  EKIKDEFITDFSEKDYNDIIDGWKAKLIRSSSGEQRWGL  485


 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPALFRSFYKWLKPGGK+LITDYCK
Sbjct  329  KCAVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKILITDYCK  388

Query  492  GLDLPQKNLQRILSK  448
                P +     + +
Sbjct  389  SAGTPSEEFAEYIKQ  403



>ref|XP_002898136.1| phosphoethanolamine N-methyltransferase [Phytophthora infestans 
T30-4]
 gb|EEY63549.1| phosphoethanolamine N-methyltransferase [Phytophthora infestans 
T30-4]
Length=498

 Score =   100 bits (249),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKGLD  484
            VEFE+ D TKK + DA+FDV+YSRDTILHI+DK ALF  F++WLKPGG+VLI+DYC+G  
Sbjct  339  VEFEICDATKKEFADASFDVVYSRDTILHIEDKEALFAKFFRWLKPGGRVLISDYCQGEQ  398

Query  483  LP  478
             P
Sbjct  399  EP  400


 Score = 92.8 bits (229),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS+ F AY+  RGY L    +YG++L   GF  V AEDRT+QF+ VLK EL     +KE 
Sbjct  400  PSDRFKAYVAGRGYYLLSPSQYGRVLESVGFTSVQAEDRTEQFVGVLKDELTRTLAQKEQ  459

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            F+ + SE D+  IV GW+ K+ R   G+Q+WGL
Sbjct  460  FVAETSESDFKYIVDGWEAKIVRCGEGDQKWGL  492



>ref|XP_008360927.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Malus domestica]
Length=492

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -3

Query  487  GPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEK  308
            G PSE FA YIKQRGYDLHD + YGQML+DAGF++VIAEDRTDQF  VL++ELDAVEK+K
Sbjct  392  GTPSENFAEYIKQRGYDLHDVKAYGQMLKDAGFDEVIAEDRTDQFKAVLERELDAVEKDK  451

Query  307  EAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            ++F+QDFS+EDY+DI+GGWK KL R  SGEQ+WGL
Sbjct  452  DSFVQDFSQEDYDDIIGGWKAKLIRVDSGEQKWGL  486


 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPALFRSFY+WLKPGGKVLI+DYC+
Sbjct  330  KCAVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPALFRSFYEWLKPGGKVLISDYCR  389

Query  492  GLDLPQKNLQRILSK  448
             +  P +N    + +
Sbjct  390  CVGTPSENFAEYIKQ  404



>ref|XP_008393424.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Malus 
domestica]
Length=492

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -3

Query  487  GPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEK  308
            G PSE FA YIKQRGYDLHD + YGQML+DAGF++VIAEDRTDQF  VL++ELDAVEK+K
Sbjct  392  GTPSENFAEYIKQRGYDLHDVKAYGQMLKDAGFDEVIAEDRTDQFKAVLERELDAVEKDK  451

Query  307  EAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            ++F+QDFS+EDY+DI+GGWK KL R  SGEQ+WGL
Sbjct  452  DSFVQDFSQEDYDDIIGGWKAKLIRVDSGEQKWGL  486


 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPALFRSFY+WLKPGGKVLI+DYC+
Sbjct  330  KCAVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPALFRSFYEWLKPGGKVLISDYCR  389

Query  492  GLDLPQKNLQRILSK  448
             +  P +N    + +
Sbjct  390  CVGTPSENFAEYIKQ  404



>dbj|BAD80838.1| phosphoethanolamine N-methyltransferase [Atriplex nummularia]
Length=503

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -3

Query  556  FQVILQMVEARGQSPHY*LLQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  377
            F+  L+ ++  G+       + + PPS EFAAYIKQRGYDLHD + YGQML+DAGF +VI
Sbjct  380  FRSFLKWLKPGGKVLISDYCKSAVPPSSEFAAYIKQRGYDLHDVKAYGQMLKDAGFIEVI  439

Query  376  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            AEDRTDQF+KVL++ELDA+E EK+ FI DFSE+DYNDIV GWK KL RT   EQRWGL
Sbjct  440  AEDRTDQFIKVLQRELDALETEKDEFIADFSEQDYNDIVDGWKAKLVRTKGDEQRWGL  497


 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKK YP+ +FDVIYSRDTILHIQDKPALFRSF KWLKPGGKVLI+DYCK
Sbjct  341  KCAVEFEVADCTKKDYPENSFDVIYSRDTILHIQDKPALFRSFLKWLKPGGKVLISDYCK  400



>ref|XP_002441466.1| hypothetical protein SORBIDRAFT_09g027360 [Sorghum bicolor]
 gb|EES19896.1| hypothetical protein SORBIDRAFT_09g027360 [Sorghum bicolor]
Length=510

 Score =   154 bits (388),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLHD + YGQML+DAGF DVIAEDRT+QF+ VL++EL  V
Sbjct  407  CKNPGKPSEEFAAYIKQRGYDLHDVKAYGQMLKDAGFHDVIAEDRTEQFLNVLRRELGEV  466

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK KEAF+ DF++EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  467  EKNKEAFLADFTQEDYDDIVNGWNAKLKRSSAGEQRWGL  505


 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT K YP+ +FDVIYSRDTILHIQDKPALFRSF+KWLKPGGKVLI+DYCK
Sbjct  349  KCSVEFEVADCTTKDYPEDSFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCK  408

Query  492  GLDLPQKNL  466
                P +  
Sbjct  409  NPGKPSEEF  417



>ref|XP_002898137.1| phosphoethanolamine N-methyltransferase, putative [Phytophthora 
infestans T30-4]
 gb|EEY63550.1| phosphoethanolamine N-methyltransferase, putative [Phytophthora 
infestans T30-4]
Length=531

 Score =   100 bits (248),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKGLD  484
            VEFE+ D TKK + DA+FDV+YSRDTILHI+DK ALF  F++WLKPGG+VLI+DYC+G  
Sbjct  372  VEFEICDATKKEFADASFDVVYSRDTILHIEDKEALFAKFFRWLKPGGRVLISDYCQGEQ  431

Query  483  LP  478
             P
Sbjct  432  EP  433


 Score = 91.7 bits (226),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS+ F AY+  RGY L    +YG++L   GF  V AEDRT+QF+ VLK EL     +K+ 
Sbjct  433  PSDRFKAYVAGRGYYLLSPSQYGRVLESVGFTSVQAEDRTEQFVGVLKDELTRTLAQKDQ  492

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            F+ + SE D+  IV GW+ K+ R   G+Q+WGL
Sbjct  493  FVAETSESDFKYIVDGWEAKIVRCGEGDQKWGL  525



>ref|XP_004969638.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=499

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLHD E YGQML+DAGF DVIAEDRTDQF+ VL+KEL   
Sbjct  396  CRNPGKPSEEFAAYIKQRGYDLHDVEAYGQMLKDAGFHDVIAEDRTDQFLCVLEKELAKF  455

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K+ F+ DFS+EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  456  EKNKDDFLSDFSQEDYDDIVNGWKAKLQRSSAGEQRWGL  494


 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  669  CAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            C+VEFEVADCT KTYPD TFDVIYSRDTILHIQDKP+LF++F+KWLKPGGKVLI+DYC+ 
Sbjct  339  CSVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPSLFKTFFKWLKPGGKVLISDYCRN  398

Query  489  LDLPQKNL  466
               P +  
Sbjct  399  PGKPSEEF  406



>ref|XP_010519218.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X1 [Tarenaya hassleriana]
Length=510

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS +FA YI+QRGYDLHD + YGQML+DAGF++V AEDRTDQFM+VLK+ELDAVEKEKE 
Sbjct  403  PSPDFAEYIEQRGYDLHDIQAYGQMLKDAGFDEVTAEDRTDQFMQVLKRELDAVEKEKEE  462

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY +IVGGWK KL R+SSGEQRWGL
Sbjct  463  FILDFSKEDYEEIVGGWKAKLMRSSSGEQRWGL  495


 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK+YP  TFDVIYSRDTILHIQDKPALFR+FYKWLKPGGKVLI+DYC+
Sbjct  339  KCSVEFEVADCTKKSYPVNTFDVIYSRDTILHIQDKPALFRTFYKWLKPGGKVLISDYCR  398

Query  492  GLDLPQKNL-QRILSKGVMTYMIQ  424
                P  +  + I  +G   + IQ
Sbjct  399  SPKAPSPDFAEYIEQRGYDLHDIQ  422



>ref|XP_004137500.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
sativus]
 ref|XP_004161836.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
2 [Cucumis sativus]
 gb|KGN64173.1| hypothetical protein Csa_1G042800 [Cucumis sativus]
Length=493

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            P+EEF+ YIKQRGYDLHD + YGQML+DAGF DVIAEDRTDQF++VL++EL  +EKEKE 
Sbjct  395  PTEEFSEYIKQRGYDLHDVKAYGQMLQDAGFHDVIAEDRTDQFIRVLERELSTIEKEKEE  454

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FIQDFS EDYN+IV GWK KL R+S+GEQRWGL
Sbjct  455  FIQDFSVEDYNEIVDGWKAKLVRSSTGEQRWGL  487


 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC VEFEVADCT KTYPD TFDVIYSRDTILHIQDKPALF+SFYKWLKPGGKVLI+DYC+
Sbjct  331  KCPVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPALFKSFYKWLKPGGKVLISDYCR  390

Query  492  GLDLPQKNLQRILSK  448
              + P +     + +
Sbjct  391  SDETPTEEFSEYIKQ  405



>ref|XP_010519219.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X2 [Tarenaya hassleriana]
Length=499

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS +FA YI+QRGYDLHD + YGQML+DAGF++V AEDRTDQFM+VLK+ELDAVEKEKE 
Sbjct  392  PSPDFAEYIEQRGYDLHDIQAYGQMLKDAGFDEVTAEDRTDQFMQVLKRELDAVEKEKEE  451

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY +IVGGWK KL R+SSGEQRWGL
Sbjct  452  FILDFSKEDYEEIVGGWKAKLMRSSSGEQRWGL  484


 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK+YP  TFDVIYSRDTILHIQDKPALFR+FYKWLKPGGKVLI+DYC+
Sbjct  328  KCSVEFEVADCTKKSYPVNTFDVIYSRDTILHIQDKPALFRTFYKWLKPGGKVLISDYCR  387

Query  492  GLDLPQKNL-QRILSKGVMTYMIQ  424
                P  +  + I  +G   + IQ
Sbjct  388  SPKAPSPDFAEYIEQRGYDLHDIQ  411



>ref|XP_004161835.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
1 [Cucumis sativus]
Length=527

 Score =   154 bits (388),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            P+EEF+ YIKQRGYDLHD + YGQML+DAGF DVIAEDRTDQF++VL++EL  +EKEKE 
Sbjct  429  PTEEFSEYIKQRGYDLHDVKAYGQMLQDAGFHDVIAEDRTDQFIRVLERELSTIEKEKEE  488

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FIQDFS EDYN+IV GWK KL R+S+GEQRWGL
Sbjct  489  FIQDFSVEDYNEIVDGWKAKLVRSSTGEQRWGL  521


 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC VEFEVADCT KTYPD TFDVIYSRDTILHIQDKPALF+SFYKWLKPGGKVLI+DYC+
Sbjct  365  KCPVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPALFKSFYKWLKPGGKVLISDYCR  424

Query  492  GLDLPQKNLQRILSK  448
              + P +     + +
Sbjct  425  SDETPTEEFSEYIKQ  439



>ref|XP_002883100.1| N-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59359.1| N-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=491

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS EF+ YIKQRGYDLHD + YGQML+DAGF DVIAEDRTDQFM+VLK+ELD VEKEKE 
Sbjct  393  PSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFTDVIAEDRTDQFMQVLKRELDRVEKEKEE  452

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  453  FISDFSKEDYDDIVGGWKAKLERCASDEQKWGL  485


 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCT K YPD +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLI+DYC+
Sbjct  329  NCSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLISDYCR  388

Query  492  GLDLPQKNLQRILSK  448
                P       + +
Sbjct  389  SPKTPSAEFSEYIKQ  403



>gb|AAM13092.1| unknown protein [Arabidopsis thaliana]
Length=491

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS EF+ YIKQRGYDLHD + YGQML+DAGF DVIAEDRTDQFM+VLK+ELD VEKEKE 
Sbjct  393  PSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFTDVIAEDRTDQFMQVLKRELDRVEKEKEK  452

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  453  FISDFSKEDYDDIVGGWKSKLERCASDEQKWGL  485


 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  669  CAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            C+V FEVADCT K YPD +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLI+DYC+ 
Sbjct  330  CSVGFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLISDYCRS  389

Query  489  LDLPQKNLQRILSK  448
               P       + +
Sbjct  390  PKTPSAEFSEYIKQ  403



>ref|NP_188427.2| phosphoethanolamine N-methyltransferase 1 [Arabidopsis thaliana]
 sp|Q9FR44.1|PEAM1_ARATH RecName: Full=Phosphoethanolamine N-methyltransferase 1; Short=AtNMT1; 
Short=PEAMT 1; AltName: Full=Protein XIPOTL 1 [Arabidopsis 
thaliana]
 gb|AAG41121.1|AF197940_1 SAM:phospho-ethanolamine N-methyltransferase [Arabidopsis thaliana]
 gb|AAK32886.1|AF367299_1 AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AAL25589.1| AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AAM10282.1| AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AEE76033.1| phosphoethanolamine N-methyltransferase 1 [Arabidopsis thaliana]
Length=491

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS EF+ YIKQRGYDLHD + YGQML+DAGF DVIAEDRTDQFM+VLK+ELD VEKEKE 
Sbjct  393  PSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFTDVIAEDRTDQFMQVLKRELDRVEKEKEK  452

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  453  FISDFSKEDYDDIVGGWKSKLERCASDEQKWGL  485


 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  669  CAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            C+VEFEVADCT K YPD +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLI+DYC+ 
Sbjct  330  CSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLISDYCRS  389

Query  489  LDLPQKNLQRILSK  448
               P       + +
Sbjct  390  PKTPSAEFSEYIKQ  403



>dbj|BAB02720.1| methyl transferase-like protein [Arabidopsis thaliana]
Length=498

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS EF+ YIKQRGYDLHD + YGQML+DAGF DVIAEDRTDQFM+VLK+ELD VEKEKE 
Sbjct  400  PSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFTDVIAEDRTDQFMQVLKRELDRVEKEKEK  459

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  460  FISDFSKEDYDDIVGGWKSKLERCASDEQKWGL  492


 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  669  CAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            C+VEFEVADCT K YPD +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLI+DYC+ 
Sbjct  337  CSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLISDYCRS  396

Query  489  LDLPQKNLQRILSK  448
               P       + +
Sbjct  397  PKTPSAEFSEYIKQ  410



>ref|XP_008799222.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X3 [Phoenix dactylifera]
Length=482

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + S  PSE FA YIKQRGYDLHD E Y QML+DAGF +V+AEDRTDQF++VL++ELD V
Sbjct  378  CKSSETPSEAFAEYIKQRGYDLHDVEAYSQMLKDAGFYEVVAEDRTDQFLEVLQRELDVV  437

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+K+AFIQ+FS+EDYN+IV GWK KL R+SSGEQRWGL
Sbjct  438  EKDKDAFIQEFSKEDYNEIVSGWKAKLKRSSSGEQRWGL  476


 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCT+KTYPD TFDVIYSRDTILHIQDKP LFRSF+KWLKPGGK+LITDYCK
Sbjct  320  KCAVEFEVADCTRKTYPDNTFDVIYSRDTILHIQDKPMLFRSFFKWLKPGGKILITDYCK  379

Query  492  GLDLPQK  472
              + P +
Sbjct  380  SSETPSE  386



>ref|XP_010921161.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Elaeis 
guineensis]
Length=494

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + SG PSE FA YIKQRGYDLHD E YGQML+DAGF + +AEDRTDQF++VL++ELDAV
Sbjct  390  CKSSGTPSEAFAEYIKQRGYDLHDVEAYGQMLKDAGFYEAVAEDRTDQFLEVLQRELDAV  449

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+K+AF+Q+FS+EDY++IV GWK KL R+S GEQRWGL
Sbjct  450  EKDKDAFVQEFSKEDYDEIVSGWKAKLKRSSFGEQRWGL  488


 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC++EFEVADCTKKTYPD TFDVIYSRDTILHIQDKP LFRSF+KWLKPGGK+LITDYCK
Sbjct  332  KCSIEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPMLFRSFFKWLKPGGKILITDYCK  391

Query  492  GLDLPQK  472
                P +
Sbjct  392  SSGTPSE  398



>ref|XP_008799219.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Phoenix dactylifera]
Length=494

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + S  PSE FA YIKQRGYDLHD E Y QML+DAGF +V+AEDRTDQF++VL++ELD V
Sbjct  390  CKSSETPSEAFAEYIKQRGYDLHDVEAYSQMLKDAGFYEVVAEDRTDQFLEVLQRELDVV  449

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+K+AFIQ+FS+EDYN+IV GWK KL R+SSGEQRWGL
Sbjct  450  EKDKDAFIQEFSKEDYNEIVSGWKAKLKRSSSGEQRWGL  488


 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCT+KTYPD TFDVIYSRDTILHIQDKP LFRSF+KWLKPGGK+LITDYCK
Sbjct  332  KCAVEFEVADCTRKTYPDNTFDVIYSRDTILHIQDKPMLFRSFFKWLKPGGKILITDYCK  391

Query  492  GLDLPQK  472
              + P +
Sbjct  392  SSETPSE  398



>gb|KHG16117.1| Phosphoethanolamine N-methyltransferase 1 -like protein [Gossypium 
arboreum]
Length=486

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + S  PS EFA YIKQRGYDLHD + YGQML DAGF+ ++AEDRTDQF++VL++EL+ V
Sbjct  380  CKSSKTPSREFAEYIKQRGYDLHDVKSYGQMLEDAGFDVILAEDRTDQFLQVLRRELNQV  439

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEK+AFI DFS+EDY++IVGGWK KL R+SSGEQRWGL
Sbjct  440  EKEKDAFISDFSKEDYDEIVGGWKAKLIRSSSGEQRWGL  478


 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK YPD +FDVIYSRDTILHI DKPALFRSFYKWLKPGGK+LI+DYCK
Sbjct  322  KCSVEFEVADCTKKVYPDNSFDVIYSRDTILHIHDKPALFRSFYKWLKPGGKLLISDYCK  381

Query  492  GLDLPQKNLQRILSK  448
                P +     + +
Sbjct  382  SSKTPSREFAEYIKQ  396



>ref|XP_008799221.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Phoenix dactylifera]
Length=492

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + S  PSE FA YIKQRGYDLHD E Y QML+DAGF +V+AEDRTDQF++VL++ELD V
Sbjct  388  CKSSETPSEAFAEYIKQRGYDLHDVEAYSQMLKDAGFYEVVAEDRTDQFLEVLQRELDVV  447

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+K+AFIQ+FS+EDYN+IV GWK KL R+SSGEQRWGL
Sbjct  448  EKDKDAFIQEFSKEDYNEIVSGWKAKLKRSSSGEQRWGL  486


 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCT+KTYPD TFDVIYSRDTILHIQDKP LFRSF+KWLKPGGK+LITDYCK
Sbjct  330  KCAVEFEVADCTRKTYPDNTFDVIYSRDTILHIQDKPMLFRSFFKWLKPGGKILITDYCK  389

Query  492  GLDLPQK  472
              + P +
Sbjct  390  SSETPSE  396



>ref|XP_010540184.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like, partial 
[Tarenaya hassleriana]
Length=457

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS +FA YIKQRGYDLHD + YGQML+DAGF +VIAEDRT+QFM+VLK+ELDAVEKEKE 
Sbjct  358  PSPDFAEYIKQRGYDLHDIQTYGQMLKDAGFNEVIAEDRTNQFMQVLKRELDAVEKEKEE  417

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FIQDFS+E+Y ++VGGW+ KL R+S GEQRWGL
Sbjct  418  FIQDFSKEEYEEMVGGWRAKLQRSSRGEQRWGL  450


 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCTKK+Y D TFDVIYSRDTILHIQDKP LF++FYKWLKPGGKVLI+DYC+
Sbjct  294  KCSVEFEVADCTKKSYSDNTFDVIYSRDTILHIQDKPTLFKTFYKWLKPGGKVLISDYCR  353

Query  492  GLDLPQKNL-QRILSKGVMTYMIQ  424
                P  +  + I  +G   + IQ
Sbjct  354  SPKAPSPDFAEYIKQRGYDLHDIQ  377



>ref|XP_008464197.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
melo]
Length=493

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -3

Query  487  GPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEK  308
            G P+EEF+ YIKQRGYDLHD + YGQML+D GF DVIAEDRTDQF++VL++EL   EKEK
Sbjct  393  GTPTEEFSEYIKQRGYDLHDVKAYGQMLQDVGFHDVIAEDRTDQFIRVLERELSTTEKEK  452

Query  307  EAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            E FIQDFS EDYN+IV GWK KL R+S+GEQRWGL
Sbjct  453  EEFIQDFSVEDYNEIVDGWKAKLVRSSTGEQRWGL  487


 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC VEFEVADCT KTYPD TFDVIYSRDTILHIQDKPALF+SFYKWLKPGGKVLI+DYC+
Sbjct  331  KCPVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPALFKSFYKWLKPGGKVLISDYCR  390

Query  492  GLDLPQKNLQRILSK  448
                P +     + +
Sbjct  391  SDGTPTEEFSEYIKQ  405



>ref|XP_005096335.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Aplysia californica]
 ref|XP_005096336.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Aplysia californica]
Length=486

 Score = 98.6 bits (244),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = -3

Query  478  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  299
            SE+F  Y+KQRGY+L    +YG++L  AGF +V AEDR+ QF KVLK E+   E  K+ F
Sbjct  389  SEKFKTYVKQRGYNLLSPAQYGKVLEAAGFVNVRAEDRSAQFAKVLKSEIAKTESIKDEF  448

Query  298  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            I++F E+ Y  IV GWK KL R   G+QRWGL
Sbjct  449  IKEFDEDGYRYIVDGWKEKLGRVEIGDQRWGL  480


 Score = 91.3 bits (225),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYC  496
            V FE+AD TK+ YP  +FDVIYSRDTILHI DK ALF+ FYK+L+PGGKVLI+DYC
Sbjct  327  VVFEIADATKRDYPAQSFDVIYSRDTILHIPDKLALFKKFYKFLRPGGKVLISDYC  382



>ref|XP_005096334.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Aplysia californica]
Length=494

 Score = 98.6 bits (244),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = -3

Query  478  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  299
            SE+F  Y+KQRGY+L    +YG++L  AGF +V AEDR+ QF KVLK E+   E  K+ F
Sbjct  397  SEKFKTYVKQRGYNLLSPAQYGKVLEAAGFVNVRAEDRSAQFAKVLKSEIAKTESIKDEF  456

Query  298  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            I++F E+ Y  IV GWK KL R   G+QRWGL
Sbjct  457  IKEFDEDGYRYIVDGWKEKLGRVEIGDQRWGL  488


 Score = 91.3 bits (225),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYC  496
            V FE+AD TK+ YP  +FDVIYSRDTILHI DK ALF+ FYK+L+PGGKVLI+DYC
Sbjct  335  VVFEIADATKRDYPAQSFDVIYSRDTILHIPDKLALFKKFYKFLRPGGKVLISDYC  390



>gb|AFW78991.1| hypothetical protein ZEAMMB73_932976 [Zea mays]
Length=356

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLHD + YGQML+DAGF +VIAEDRT+QF+ VL++E+  V
Sbjct  253  CKNPGKPSEEFAAYIKQRGYDLHDVKAYGQMLKDAGFHNVIAEDRTEQFLNVLQREIGEV  312

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K+AF+ DF++EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  313  EKNKDAFLADFTQEDYDDIVNGWNAKLKRSSAGEQRWGL  351


 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT K YP+ +FDVIYSRDTILHIQDKPALFRSF+KWLKPGGKVLI+DYCK
Sbjct  195  KCSVEFEVADCTTKDYPENSFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCK  254

Query  492  GLDLPQKNL  466
                P +  
Sbjct  255  NPGKPSEEF  263



>gb|AER10512.1| phosphoethanolamine N-methyltransferase [Pyrus betulifolia]
 gb|AER10513.1| phosphoethanolamine N-methyltransferase [Pyrus betulifolia]
Length=492

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -3

Query  490  SGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKE  311
            +G PSE FA YIKQRGYDLHD + YGQML+DAGF +VIAEDRTDQF  VL++ELDA+EK+
Sbjct  391  AGTPSENFAEYIKQRGYDLHDVKAYGQMLKDAGFYEVIAEDRTDQFKAVLERELDAIEKD  450

Query  310  KEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            K++F+QDFS+ DY+DIVGGWK KL R  SGEQ+WGL
Sbjct  451  KDSFVQDFSQGDYDDIVGGWKAKLIRVESGEQKWGL  486


 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKKTYPD +FDVIYSRDTILHIQDKPALFRSFY+WLKPGGKVLI+DYC+
Sbjct  330  KCAVEFEVADCTKKTYPDNSFDVIYSRDTILHIQDKPALFRSFYEWLKPGGKVLISDYCR  389

Query  492  GLDLPQKNLQRILSK  448
                P +N    + +
Sbjct  390  CAGTPSENFAEYIKQ  404



>gb|KFK39125.1| hypothetical protein AALP_AA3G204100 [Arabis alpina]
Length=491

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS EF+ YIKQRGYDLHD + YGQML+DAGF DVIA DRTDQF++VL++EL+ VEKEKE 
Sbjct  393  PSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFNDVIAADRTDQFVQVLRRELERVEKEKEE  452

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY+DIVGGWK KL RT+SGEQ+WGL
Sbjct  453  FIADFSKEDYDDIVGGWKAKLERTASGEQKWGL  485


 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT K YPD +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLI+DYC+
Sbjct  329  KCSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLISDYCR  388

Query  492  GLDLPQKNLQRILSK  448
                P       + +
Sbjct  389  SPKTPSAEFSEYIKQ  403



>ref|XP_004137341.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cucumis 
sativus]
Length=500

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PS EFA YI+QRGYDLHD + Y +ML +AGF +V+AEDRTDQFM VL++ELD V
Sbjct  394  CKSGGVPSSEFAEYIEQRGYDLHDIKSYAKMLEEAGFNNVVAEDRTDQFMSVLQRELDIV  453

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEKEAFI DFSEEDYNDIVGGWK KL R+  GEQ+WGL
Sbjct  454  EKEKEAFILDFSEEDYNDIVGGWKAKLKRSWCGEQKWGL  492


 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKK Y D TFDVIYSRDTILHIQDKPALFRSFYKW+KPGGK+LI+DYCK
Sbjct  336  KCAVEFEVADCTKKVYLDNTFDVIYSRDTILHIQDKPALFRSFYKWVKPGGKILISDYCK  395

Query  492  GLDLPQKNLQRILSK  448
               +P       + +
Sbjct  396  SGGVPSSEFAEYIEQ  410



>emb|CDM83854.1| unnamed protein product [Triticum aestivum]
Length=396

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLHD E YGQML++AGF DVIAE+RTDQF+KVL++EL  V
Sbjct  293  CRSPGKPSEEFAAYIKQRGYDLHDVEAYGQMLQNAGFHDVIAEERTDQFLKVLQRELAEV  352

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K+ F+ DF +EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  353  EKNKDEFLADFGQEDYDDIVTGWNAKLQRSSAGEQRWGL  391


 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCT KTYPD+TFDVIYSRDTILHIQDKP+LFRSF+KWLKPGGKVLI+DYC+
Sbjct  235  KCAVEFEVADCTTKTYPDSTFDVIYSRDTILHIQDKPSLFRSFFKWLKPGGKVLISDYCR  294

Query  492  GLDLPQKNL  466
                P +  
Sbjct  295  SPGKPSEEF  303



>ref|XP_009012150.1| hypothetical protein HELRODRAFT_183893 [Helobdella robusta]
 gb|ESO09748.1| hypothetical protein HELRODRAFT_183893 [Helobdella robusta]
Length=406

 Score =   105 bits (261),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = -3

Query  478  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  299
            S++F AY+KQRGY L   E YG++L + GFE V A+DRTDQF+ +L+KE++ V   ++AF
Sbjct  309  SDDFEAYVKQRGYILLSVERYGKLLEEVGFERVQAQDRTDQFVDILRKEIERVVASRDAF  368

Query  298  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            ++DF+E DY  +V GW  KL R   G+Q+WGL
Sbjct  369  LKDFTESDYRALVDGWMSKLKRCDKGDQKWGL  400


 Score = 83.2 bits (204),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYC  496
            V FEV D  K+ +   +FDVIYSRDTILHI DK  LF  F+KWL+PGG++LI+DYC
Sbjct  247  VSFEVCDALKRNFQSESFDVIYSRDTILHISDKKKLFTLFHKWLRPGGRLLISDYC  302



>gb|EEC79642.1| hypothetical protein OsI_20868 [Oryza sativa Indica Group]
Length=504

 Score =   150 bits (379),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLHD + YG+ML DAGF  VIAEDRTDQF++VL++EL  V
Sbjct  401  CRNPGKPSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHHVIAEDRTDQFLRVLQRELAEV  460

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK KEAF+ DF++EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  461  EKNKEAFLADFTQEDYDDIVNGWNAKLKRSSAGEQRWGL  499


 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT KTY   TFDVIYSRDTILHI DKPALFRSF+KWLKPGGKVLI+DYC+
Sbjct  343  KCSVEFEVADCTTKTYAPNTFDVIYSRDTILHIHDKPALFRSFFKWLKPGGKVLISDYCR  402

Query  492  GLDLPQKNL  466
                P +  
Sbjct  403  NPGKPSEEF  411



>ref|XP_006297517.1| hypothetical protein CARUB_v10013541mg [Capsella rubella]
 gb|EOA30415.1| hypothetical protein CARUB_v10013541mg [Capsella rubella]
Length=491

 Score =   150 bits (379),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS EF+ YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQFM+VL++EL+ VEKEKE 
Sbjct  393  PSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFKDVIAEDRTDQFMQVLRRELERVEKEKEE  452

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  453  FIADFSKEDYDDIVGGWKAKLERCASDEQKWGL  485


 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCT K YPD +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLI+DYC+
Sbjct  329  NCSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLISDYCR  388

Query  492  GLDLPQKNLQRILSK  448
                P       + +
Sbjct  389  SPKTPSAEFSEYIKQ  403



>dbj|BAH01482.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64589.1| hypothetical protein OsJ_19441 [Oryza sativa Japonica Group]
Length=495

 Score =   150 bits (379),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLHD + YG+ML DAGF  VIAEDRTDQF++VL++EL  V
Sbjct  392  CRNPGKPSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHHVIAEDRTDQFLRVLQRELAEV  451

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK KEAF+ DF++EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  452  EKNKEAFMADFTQEDYDDIVNGWNAKLKRSSAGEQRWGL  490


 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT KTY   TFDVIYSRDTILHI DKPALFRSF+KWLKPGGKVLI+DYC+
Sbjct  334  KCSVEFEVADCTTKTYAPNTFDVIYSRDTILHIHDKPALFRSFFKWLKPGGKVLISDYCR  393

Query  492  GLDLPQKNL  466
                P +  
Sbjct  394  NPGKPSEEF  402



>ref|XP_009360079.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=492

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  490  SGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKE  311
            +G PSE FA YIKQRGYDLHD + YGQML DAGF +VIAEDRTDQF  VL++ELDA+EK+
Sbjct  391  AGTPSENFAEYIKQRGYDLHDVKAYGQMLEDAGFYEVIAEDRTDQFKAVLERELDAIEKD  450

Query  310  KEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            K++F+QDFS+ DY+DIVGGWK KL R  SGEQ+WGL
Sbjct  451  KDSFVQDFSQGDYDDIVGGWKAKLIRVDSGEQKWGL  486


 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLI+DYC+
Sbjct  330  KCAVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLISDYCR  389

Query  492  GLDLPQKNLQRILSK  448
            G   P +N    + +
Sbjct  390  GAGTPSENFAEYIKQ  404



>ref|XP_007036802.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY21303.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=493

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + +G PS EFA YI+QRGYDLHD E YGQ+L DAGF++VIAEDRT+QF++VL++EL+ V
Sbjct  389  CKNAGTPSSEFAEYIEQRGYDLHDVEAYGQILSDAGFDEVIAEDRTEQFLQVLQRELNEV  448

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK+K+AF+  FS+EDY+DI+GGWK KL R+SSGEQRWGL
Sbjct  449  EKDKDAFVSSFSQEDYDDILGGWKAKLIRSSSGEQRWGL  487


 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCTKKTYPD +FDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLI+DYCK
Sbjct  331  NCSVEFEVADCTKKTYPDNSFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLISDYCK  390

Query  492  GLDLPQKNLQRILSK  448
                P       + +
Sbjct  391  NAGTPSSEFAEYIEQ  405



>ref|XP_002456194.1| hypothetical protein SORBIDRAFT_03g031950 [Sorghum bicolor]
 gb|EES01314.1| hypothetical protein SORBIDRAFT_03g031950 [Sorghum bicolor]
Length=501

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLHD E YGQML+ AGF DVIAEDRTDQF+ VL+KEL   
Sbjct  398  CRSPGKPSEEFAAYIKQRGYDLHDVEAYGQMLKSAGFRDVIAEDRTDQFLGVLEKELAKF  457

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K+ F+ DF++EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  458  EKNKDDFLSDFTQEDYDDIVNGWKAKLQRSSAGEQRWGL  496


 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  669  CAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            C+VEFEVADCT KTYP+ TFDVIYSRDTILHIQDKP+LF+SF+KWLKPGGKVLI+DYC+ 
Sbjct  341  CSVEFEVADCTTKTYPENTFDVIYSRDTILHIQDKPSLFKSFFKWLKPGGKVLISDYCRS  400

Query  489  LDLPQKNL  466
               P +  
Sbjct  401  PGKPSEEF  408



>ref|NP_001169597.1| uncharacterized LOC100383478 [Zea mays]
 gb|ABF83429.1| S-adenosyl-L-methionine: phosphoethanolamine N-methyltransferase 
[Zea mays]
 gb|ACN34220.1| unknown [Zea mays]
 gb|AFW78993.1| S-adenosyl-L-methionine: phosphoethanolamine N-methyltransferase 
[Zea mays]
Length=501

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLHD + YGQML+DAGF +VIAEDRT+QF+ VL++E+  V
Sbjct  398  CKNPGKPSEEFAAYIKQRGYDLHDVKAYGQMLKDAGFHNVIAEDRTEQFLNVLQREIGEV  457

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K+AF+ DF++EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  458  EKNKDAFLADFTQEDYDDIVNGWNAKLKRSSAGEQRWGL  496


 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT K YP+ +FDVIYSRDTILHIQDKPALFRSF+KWLKPGGKVLI+DYCK
Sbjct  340  KCSVEFEVADCTTKDYPENSFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCK  399

Query  492  GLDLPQKNL  466
                P +  
Sbjct  400  NPGKPSEEF  408



>ref|XP_009404071.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Musa acuminata subsp. malaccensis]
Length=497

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             ++ G PS++FAAYIKQRGYDLHD + YGQML++AGF  VIAEDRT+QF++VL++ELDAV
Sbjct  393  CKKLGTPSDDFAAYIKQRGYDLHDVDAYGQMLKNAGFNKVIAEDRTNQFLEVLQRELDAV  452

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            E  KE FI+DFS+EDY++IV GWK KL R+S GEQRWGL
Sbjct  453  EMGKEGFIRDFSQEDYDEIVNGWKAKLKRSSVGEQRWGL  491


 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKKTYP+ TFDVIYSRDTILHIQDKP LFRSF+KWLKPGGK+LI+DYCK
Sbjct  335  KCAVEFEVADCTKKTYPENTFDVIYSRDTILHIQDKPTLFRSFFKWLKPGGKLLISDYCK  394

Query  492  GLDLPQKNL  466
             L  P  + 
Sbjct  395  KLGTPSDDF  403



>ref|XP_010487709.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Camelina sativa]
Length=494

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS EF+ YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQF +VL++EL++VEKEKE 
Sbjct  396  PSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFKDVIAEDRTDQFTQVLRRELESVEKEKEE  455

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  456  FISDFSKEDYDDIVGGWKAKLERCASDEQKWGL  488


 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCT K YPD +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLI+DYC+
Sbjct  332  NCSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLISDYCR  391

Query  492  GLDLPQKNLQRILSK  448
                P       + +
Sbjct  392  SPKTPSAEFSEYIKQ  406



>ref|XP_010487710.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Camelina sativa]
Length=491

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS EF+ YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQF +VL++EL++VEKEKE 
Sbjct  393  PSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFKDVIAEDRTDQFTQVLRRELESVEKEKEE  452

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  453  FISDFSKEDYDDIVGGWKAKLERCASDEQKWGL  485


 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCT K YPD +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLI+DYC+
Sbjct  329  NCSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLISDYCR  388

Query  492  GLDLPQKNLQRILSK  448
                P       + +
Sbjct  389  SPKTPSAEFSEYIKQ  403



>gb|EMT21187.1| Phosphoethanolamine N-methyltransferase 1 [Aegilops tauschii]
Length=503

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLH+ E YGQML++AGF DVIAEDRTDQF+KVL++EL  V
Sbjct  400  CRSPGKPSEEFAAYIKQRGYDLHNVEAYGQMLQNAGFHDVIAEDRTDQFLKVLQRELAEV  459

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K+ F+ DF +EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  460  EKNKDEFLADFGQEDYDDIVTGWNAKLQRSSAGEQRWGL  498


 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCT KTYPD TFDVIYSRDTILHIQDKPALFRSF+KWLKPGGKVLI+DYC+
Sbjct  342  KCAVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCR  401

Query  492  GLDLPQKNL  466
                P +  
Sbjct  402  SPGKPSEEF  410



>gb|AGO59019.1| heat responsive transcription factor protein, partial [Triticum 
aestivum]
Length=460

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLHD + YG+ML DAGF DV+AEDRTDQF++VL++EL   
Sbjct  361  CRSPGTPSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHDVVAEDRTDQFLRVLERELGET  420

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK KEAF+ DF++EDY+DIV GW  KL R+S+GEQ+WGL
Sbjct  421  EKNKEAFLADFTQEDYDDIVNGWSAKLKRSSAGEQKWGL  459


 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -1

Query  669  CAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            C+VEFEVADCT K Y + TFDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLI+DYC+ 
Sbjct  304  CSVEFEVADCTTKEYAENTFDVIYSRDTILHIQDKPALFRNFFKWLKPGGKVLISDYCRS  363

Query  489  LDLPQKNL  466
               P +  
Sbjct  364  PGTPSEEF  371



>ref|XP_007209943.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11142.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=493

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 85/101 (84%), Gaps = 2/101 (2%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFM--KVLKKELD  326
             + +G PS EFA YIKQRGYDLH+ + YGQML+DAGF++VIAEDRTDQ     +L++ELD
Sbjct  387  CRSAGTPSAEFAEYIKQRGYDLHNVQAYGQMLKDAGFDEVIAEDRTDQVCIRLLLQRELD  446

Query  325  AVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            AVEK+K+AFIQDFSEEDY+DIVGGWK KL R  SGEQ+WGL
Sbjct  447  AVEKDKDAFIQDFSEEDYDDIVGGWKAKLIRADSGEQKWGL  487


 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCT+KTY D TFDVIYSRDTILHIQDKPALFRSFY+WLKPGGKVLI+DYC+
Sbjct  329  KCAVEFEVADCTQKTYADDTFDVIYSRDTILHIQDKPALFRSFYRWLKPGGKVLISDYCR  388

Query  492  GLDLPQKNL-QRILSKGVMTYMIQ  424
                P     + I  +G   + +Q
Sbjct  389  SAGTPSAEFAEYIKQRGYDLHNVQ  412



>gb|EMT23240.1| Phosphoethanolamine N-methyltransferase 1 [Aegilops tauschii]
Length=497

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLHD + YG+ML DAGF DV+AEDRTDQF++VL++ELD  
Sbjct  394  CRSPGTPSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHDVVAEDRTDQFLRVLERELDGT  453

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK KEAF+ DF++ED +DIV GW  KL R+S+GEQ+WGL
Sbjct  454  EKSKEAFLADFTQEDSDDIVNGWSAKLKRSSAGEQKWGL  492


 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -1

Query  669  CAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            C+VEFEVADCT K Y + TFDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLI+DYC+ 
Sbjct  337  CSVEFEVADCTTKEYAENTFDVIYSRDTILHIQDKPALFRNFFKWLKPGGKVLISDYCRS  396

Query  489  LDLPQKNL  466
               P +  
Sbjct  397  PGTPSEEF  404



>gb|EMT23241.1| Phosphoethanolamine N-methyltransferase 1 [Aegilops tauschii]
Length=553

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLHD + YG+ML DAGF DV+AEDRTDQF++VL++EL   
Sbjct  450  CRSPGTPSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHDVVAEDRTDQFLRVLERELGET  509

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK KEAF+ DF++EDY+DIV GW  KL R+S+GEQ+WGL
Sbjct  510  EKNKEAFLADFTQEDYDDIVNGWSAKLKRSSAGEQKWGL  548


 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  669  CAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            C+VEFEVADCT K Y + TFDVIY RDTILHIQDKPALFR+F+KWLKPGGKVLI+DYC+ 
Sbjct  393  CSVEFEVADCTTKEYAENTFDVIYCRDTILHIQDKPALFRNFFKWLKPGGKVLISDYCRS  452

Query  489  LDLPQKNL  466
               P +  
Sbjct  453  PGTPSEEF  460



>emb|CDM83845.1| unnamed protein product [Triticum aestivum]
Length=504

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLHD E YGQML++AGF DVIAE+RTDQF+KVL++EL  V
Sbjct  401  CRSPGKPSEEFAAYIKQRGYDLHDVEAYGQMLQNAGFHDVIAEERTDQFLKVLQRELAEV  460

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K+ F+ DF +EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  461  EKNKDEFLADFGQEDYDDIVTGWNAKLQRSSAGEQRWGL  499


 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCT KTYPD+TFDVIYSRDTILHIQDKP+LFRSF+KWLKPGGKVLI+DYC+
Sbjct  343  KCAVEFEVADCTTKTYPDSTFDVIYSRDTILHIQDKPSLFRSFFKWLKPGGKVLISDYCR  402

Query  492  GLDLPQKNL  466
                P +  
Sbjct  403  SPGKPSEEF  411



>gb|AAL40895.1| phosphoethanolamine methyltransferase [Triticum aestivum]
Length=498

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLHD + YG+ML DAGF DV+AEDRTDQF++VL++EL   
Sbjct  395  CRSPGTPSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHDVVAEDRTDQFLRVLERELGET  454

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK KEAF+ DF++EDY+DIV GW  KL R+S+GEQ+WGL
Sbjct  455  EKNKEAFLADFTQEDYDDIVNGWSAKLKRSSAGEQKWGL  493


 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -1

Query  669  CAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            C+VEFEVADCT K Y + TFDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLI+DYC+ 
Sbjct  338  CSVEFEVADCTTKEYAENTFDVIYSRDTILHIQDKPALFRNFFKWLKPGGKVLISDYCRS  397

Query  489  LDLPQKNL  466
               P +  
Sbjct  398  PGTPSEEF  405



>gb|ACV89824.1| S-adenosyl-L-methionine:phosphoethanolamine N-methyltransferase 
[Triticum aestivum]
Length=505

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLH+ E YGQML++AGF DV+AEDRTDQF+KVL++EL  V
Sbjct  402  CRSPGKPSEEFAAYIKQRGYDLHNVETYGQMLQNAGFHDVVAEDRTDQFLKVLQRELAEV  461

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K+ F+ DF +EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  462  EKNKDEFLADFGQEDYDDIVTGWNAKLQRSSAGEQRWGL  500


 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCT KTYPD TFDVIYSRDTILHIQDKPALFRSF+KWLKPGGKVLI+DYC+
Sbjct  344  KCAVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCR  403

Query  492  GLDLPQKNL  466
                P +  
Sbjct  404  SPGKPSEEF  412



>gb|AAV67950.1| putative phosphoethanolamine N-methyltransferase [Zea mays]
Length=495

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFA YIKQRGYDLHD E YGQML+DAGF +VIAEDRT+QF+ VL++E+  V
Sbjct  392  CKSPGKPSEEFATYIKQRGYDLHDVEAYGQMLKDAGFHNVIAEDRTEQFLNVLQREIGEV  451

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K+AF+ DF++EDY+DIV GW  KL R+S GEQRWGL
Sbjct  452  EKNKDAFLADFTQEDYDDIVNGWNAKLKRSSGGEQRWGL  490


 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC VEFEVADCT KTYPD  FDVIYSRDTILHIQDKP+LF+SF+KWLKPGGKVLI+DYCK
Sbjct  334  KCLVEFEVADCTTKTYPDHMFDVIYSRDTILHIQDKPSLFKSFFKWLKPGGKVLISDYCK  393

Query  492  GLDLPQKNL  466
                P +  
Sbjct  394  SPGKPSEEF  402



>gb|EMS54147.1| Phosphoethanolamine N-methyltransferase 1 [Triticum urartu]
Length=504

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLH+ E YGQML++AGF DV+AEDRTDQF+KVL++EL  V
Sbjct  401  CRSPGKPSEEFAAYIKQRGYDLHNVETYGQMLQNAGFHDVVAEDRTDQFLKVLQRELAEV  460

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K+ F+ DF +EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  461  EKNKDEFLADFGQEDYDDIVTGWNAKLQRSSAGEQRWGL  499


 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCT KTYPD TFDVIYSRDTILHIQDKPALFRSF+KWLKPGGKVLI+DYC+
Sbjct  343  KCAVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCR  402

Query  492  GLDLPQKNL  466
                P +  
Sbjct  403  SPGKPSEEF  411



>ref|XP_009061459.1| hypothetical protein LOTGIDRAFT_219756 [Lottia gigantea]
 gb|ESO87855.1| hypothetical protein LOTGIDRAFT_219756 [Lottia gigantea]
Length=490

 Score = 92.8 bits (229),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 67/99 (68%), Gaps = 2/99 (2%)
 Frame = -3

Query  493  RSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEK  314
            + G  SEEF AY+KQRGY+L +  +YG++L  AG  +V AED+T  F ++L+ EL+    
Sbjct  384  KEGDHSEEFKAYVKQRGYNLLNPSQYGKVLEKAGLVNVKAEDKTVLFGEILRSELERTLS  443

Query  313  EKEAFIQDFSEEDYNDIVGGWKLKLTRTSS--GEQRWGL  203
             K+ FI++F E++YNDIV GW  K+ R     G+QRWGL
Sbjct  444  IKDEFIEEFGEKNYNDIVEGWTDKVKRVGKGDGDQRWGL  482


 Score = 92.4 bits (228),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  663  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYC  496
            V FE+AD TK+ YPD +FD IYSRD ILHI++K  LF+ FYKWLKPGGK+LI+DYC
Sbjct  327  VVFEIADATKRDYPDNSFDAIYSRDAILHIKEKLELFQRFYKWLKPGGKILISDYC  382



>ref|XP_008675144.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Zea mays]
 ref|XP_008675145.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Zea mays]
Length=501

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFA YIKQRGYDLHD E YGQML++AGF  VIAEDRTDQF+ VL+KELD  
Sbjct  398  CKSPGKPSEEFATYIKQRGYDLHDVEAYGQMLKNAGFSHVIAEDRTDQFLSVLQKELDKF  457

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K+ F+ +F++EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  458  EKNKDDFLSEFAQEDYDDIVNGWKAKLQRSSAGEQRWGL  496


 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC VEFEVADCT KTYPD  FDVIYSRDTILHIQDKP+LF+SF+KWLKPGGKVLI+DYCK
Sbjct  340  KCLVEFEVADCTTKTYPDHMFDVIYSRDTILHIQDKPSLFKSFFKWLKPGGKVLISDYCK  399

Query  492  GLDLPQKNL  466
                P +  
Sbjct  400  SPGKPSEEF  408



>tpg|DAA57997.1| TPA: putative phosphoethanolamine N-methyltransferase [Zea mays]
Length=498

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFA YIKQRGYDLHD E YGQML++AGF  VIAEDRTDQF+ VL+KELD  
Sbjct  395  CKSPGKPSEEFATYIKQRGYDLHDVEAYGQMLKNAGFSHVIAEDRTDQFLSVLQKELDKF  454

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K+ F+ +F++EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  455  EKNKDDFLSEFAQEDYDDIVNGWKAKLQRSSAGEQRWGL  493


 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC VEFEVADCT KTYPD  FDVIYSRDTILHIQDKP+LF+SF+KWLKPGGKVLI+DYCK
Sbjct  337  KCLVEFEVADCTTKTYPDHMFDVIYSRDTILHIQDKPSLFKSFFKWLKPGGKVLISDYCK  396

Query  492  GLDLPQKNL  466
                P +  
Sbjct  397  SPGKPSEEF  405



>ref|XP_008620240.1| hypothetical protein SDRG_15834 [Saprolegnia diclina VS20]
 gb|EQC26347.1| hypothetical protein SDRG_15834 [Saprolegnia diclina VS20]
Length=416

 Score = 95.9 bits (237),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 58/92 (63%), Gaps = 0/92 (0%)
 Frame = -3

Query  478  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  299
            +  F AY+  RGY L     YG ++   GF DV AEDRT+ F++VL+ ELD     K+AF
Sbjct  319  TTRFKAYVTSRGYHLLTPAAYGNVIASVGFTDVEAEDRTEHFVQVLQTELDRTRLNKDAF  378

Query  298  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            I + S  DY DIV GW+ KL R + G+Q+WGL
Sbjct  379  IAETSAHDYEDIVDGWEAKLVRCAEGDQKWGL  410


 Score = 89.4 bits (220),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -1

Query  660  EFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            EFE+ D T K Y  A+FDVIYSRDTILHI DK ALF  FY WLKPGG++LI+DYC G
Sbjct  257  EFEICDATTKEYAPASFDVIYSRDTILHIGDKKALFAKFYSWLKPGGRLLISDYCCG  313



>ref|XP_001768934.1| predicted protein [Physcomitrella patens]
 gb|EDQ66288.1| predicted protein [Physcomitrella patens]
Length=431

 Score =   119 bits (297),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = -3

Query  472  EFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQ  293
            +FA+YIKQR YDLH  + YGQML+ +GF  V AED TDQF++VLK+EL A E+E++ FI+
Sbjct  335  QFASYIKQRNYDLHSVQTYGQMLQRSGFIKVHAEDGTDQFVEVLKRELSATEQERDKFIE  394

Query  292  DFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            +FSE+DYN IV GWK KL R ++ EQ+WGL
Sbjct  395  EFSEDDYNYIVNGWKSKLERCANDEQKWGL  424


 Score = 65.9 bits (159),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQ  571
            KCA+EFEV DCTK  YP+A+FDVIYSRDTILHIQ
Sbjct  302  KCAIEFEVGDCTKINYPEASFDVIYSRDTILHIQ  335



>emb|CDY35847.1| BnaC09g37790D [Brassica napus]
Length=376

 Score =   111 bits (277),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCT  TYPD +FDVIYS  TI HIQDKPALF++F+KWLKPGG+VLITDYCK
Sbjct  230  NCSVEFEVADCTTNTYPDNSFDVIYSSATIFHIQDKPALFKTFFKWLKPGGRVLITDYCK  289

Query  492  GLDLP  478
              + P
Sbjct  290  SDETP  294


 Score = 73.6 bits (179),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS  FA YIKQRGYD+HD + YGQ+   AGFEDVIAEDR DQ           ++K+K  
Sbjct  294  PSPVFAEYIKQRGYDIHDVQAYGQVY--AGFEDVIAEDRIDQVTLTHIHIHVQIKKKKNL  351

Query  301  FIQDFSEEDYND  266
            FI DFSE   +D
Sbjct  352  FISDFSEVKKHD  363



>ref|XP_010506234.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X1 [Camelina sativa]
Length=494

 Score =   147 bits (372),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS EF+ YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQF +VL++EL++VEKEKE 
Sbjct  396  PSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFKDVIAEDRTDQFTQVLRRELESVEKEKEE  455

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY+DIVGGWK +L R +S EQ+WGL
Sbjct  456  FISDFSKEDYDDIVGGWKAELERCASDEQKWGL  488


 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCT K YPD +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLI+DYC+
Sbjct  332  NCSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLISDYCR  391

Query  492  GLDLPQKNLQRILSK  448
                P       + +
Sbjct  392  SPKTPSAEFSEYIKQ  406



>ref|XP_008620239.1| hypothetical protein SDRG_15833 [Saprolegnia diclina VS20]
 gb|EQC26346.1| hypothetical protein SDRG_15833 [Saprolegnia diclina VS20]
Length=498

 Score = 95.1 bits (235),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 58/92 (63%), Gaps = 0/92 (0%)
 Frame = -3

Query  478  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  299
            +  F AY+  RGY L     YG ++   GF DV AEDRT+ F++VL+ ELD     K+AF
Sbjct  401  TTRFKAYVASRGYHLLTPAAYGNVIASVGFTDVEAEDRTEHFVQVLQTELDRTRLNKDAF  460

Query  298  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            I + S  DY DIV GW+ KL R + G+Q+WGL
Sbjct  461  IAETSAHDYEDIVDGWEAKLVRCAEGDQKWGL  492


 Score = 89.7 bits (221),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -1

Query  660  EFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            EFE+ D T K Y  A+FDVIYSRDTILHI DK ALF  FY WLKPGG++LI+DYC G
Sbjct  339  EFEICDATTKEYAPASFDVIYSRDTILHIGDKKALFAKFYSWLKPGGRLLISDYCCG  395



>ref|XP_010506242.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X2 [Camelina sativa]
Length=491

 Score =   147 bits (372),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  481  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  302
            PS EF+ YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQF +VL++EL++VEKEKE 
Sbjct  393  PSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFKDVIAEDRTDQFTQVLRRELESVEKEKEE  452

Query  301  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            FI DFS+EDY+DIVGGWK +L R +S EQ+WGL
Sbjct  453  FISDFSKEDYDDIVGGWKAELERCASDEQKWGL  485


 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCT K YPD +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLI+DYC+
Sbjct  329  NCSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLISDYCR  388

Query  492  GLDLPQKNLQRILSK  448
                P       + +
Sbjct  389  SPKTPSAEFSEYIKQ  403



>ref|XP_004961340.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=498

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLHD + YG+ML  AGF DVIAEDRT+QF+ VL++EL  V
Sbjct  395  CKNPGKPSEEFAAYIKQRGYDLHDVKAYGKMLEGAGFHDVIAEDRTEQFLSVLRRELAEV  454

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K+AF+ DF++EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  455  EKNKDAFVADFTQEDYDDIVNGWNAKLKRSSAGEQRWGL  493


 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT K YP+ +FDVIYSRDTILHIQDKPALFRSF+KWLKPGGKVLI+DYCK
Sbjct  337  KCSVEFEVADCTTKDYPENSFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCK  396

Query  492  GLDLPQKNL  466
                P +  
Sbjct  397  NPGKPSEEF  405



>ref|XP_004166029.1| PREDICTED: LOW QUALITY PROTEIN: phosphoethanolamine N-methyltransferase-like 
[Cucumis sativus]
Length=500

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PS EFA YI+QRGYDLHD + Y +ML +AGF +V+AEDRTDQFM VL++ELD V
Sbjct  394  CKSGGVPSSEFAEYIEQRGYDLHDIKSYAKMLEEAGFNNVVAEDRTDQFMSVLQRELDIV  453

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEK+ FI DFSEEDYNDIVGGWK KL R+  GEQ+WGL
Sbjct  454  EKEKKXFILDFSEEDYNDIVGGWKAKLKRSWCGEQKWGL  492


 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCTKK Y D TFDVIYSRDTILHIQDKPALFRSFYKW+KPGGK+LI+DYCK
Sbjct  336  KCAVEFEVADCTKKVYLDNTFDVIYSRDTILHIQDKPALFRSFYKWVKPGGKILISDYCK  395

Query  492  GLDLPQKNLQRILSK  448
               +P       + +
Sbjct  396  SGGVPSSEFAEYIEQ  410



>gb|KDO18852.1| hypothetical protein SPRG_15851 [Saprolegnia parasitica CBS 223.65]
Length=415

 Score = 95.5 bits (236),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 58/92 (63%), Gaps = 0/92 (0%)
 Frame = -3

Query  478  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  299
            +  F AY+  RGY L     YGQ++   GF DV AEDRT+ F++VL+ EL      K+AF
Sbjct  318  TARFKAYVASRGYHLLTPAAYGQVIASVGFSDVEAEDRTEHFVQVLQTELARTRLNKDAF  377

Query  298  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            I + S  DY DIV GW+ KL R + G+Q+WGL
Sbjct  378  IAETSAHDYEDIVDGWEAKLVRCAEGDQKWGL  409


 Score = 88.6 bits (218),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -1

Query  660  EFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            EFE+ D T K Y  A+FDVIYSRDTILHI DK +LF  FY WLKPGG++LI+DYC G
Sbjct  256  EFEICDATTKEYAPASFDVIYSRDTILHIADKTSLFAKFYTWLKPGGRLLISDYCCG  312



>emb|CAG09731.1| unnamed protein product [Tetraodon nigroviridis]
Length=492

 Score = 96.7 bits (239),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  666  AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            +V+FEVAD T++ +P+ +FDVIYSRDTILHI DKPALF  F+ WLKPGG++LI+DYC G
Sbjct  332  SVQFEVADATRRMFPECSFDVIYSRDTILHIDDKPALFERFHSWLKPGGQLLISDYCCG  390


 Score = 87.4 bits (215),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 67/94 (71%), Gaps = 3/94 (3%)
 Frame = -3

Query  484  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  305
            P SE    Y+KQRGY L+   EYG+ L++AGF  V AEDRT QF++V++ EL+  E  KE
Sbjct  396  PLSE---TYVKQRGYTLYTPSEYGEFLKEAGFCQVQAEDRTAQFIQVIETELERAEAIKE  452

Query  304  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
             FI++FSEEDY  IV GW+ KL R+ SG+ RWGL
Sbjct  453  EFIEEFSEEDYLAIVNGWREKLARSRSGDHRWGL  486



>ref|NP_001148925.1| LOC100282545 [Zea mays]
 gb|ACG33501.1| phosphoethanolamine N-methyltransferase [Zea mays]
Length=502

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLH  E YGQML+ AGF DVIAEDRTDQF+ VL KEL   
Sbjct  399  CRSPGKPSEEFAAYIKQRGYDLHAVEAYGQMLKSAGFRDVIAEDRTDQFLGVLDKELAEF  458

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K+ F+ DF++EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  459  EKNKDDFLSDFTQEDYDDIVNGWKAKLQRSSAGEQRWGL  497


 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -1

Query  669  CAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            C+VEFEVADCT KTYPD TFDVIYSRDTILHI DKP+LF+SF+ WLKPGGKVLI+DYC+ 
Sbjct  342  CSVEFEVADCTTKTYPDNTFDVIYSRDTILHIHDKPSLFKSFFNWLKPGGKVLISDYCRS  401

Query  489  LDLPQKNL  466
               P +  
Sbjct  402  PGKPSEEF  409



>ref|XP_010231068.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Brachypodium distachyon]
Length=472

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSE+FAAYIKQRGYDLHD + YG+ML +AGF DVIAEDRTDQF++VL++EL   
Sbjct  369  CRSPGKPSEDFAAYIKQRGYDLHDVKTYGKMLENAGFHDVIAEDRTDQFLRVLERELAET  428

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK KEAF+ DF++EDY+DIV GW  KL R+S+GEQ+WGL
Sbjct  429  EKNKEAFLADFTQEDYDDIVNGWSAKLKRSSAGEQKWGL  467


 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT K YP+ TFDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLI+DYC+
Sbjct  311  KCSVEFEVADCTTKEYPENTFDVIYSRDTILHIQDKPALFRNFFKWLKPGGKVLISDYCR  370

Query  492  GLDLPQKNL  466
                P ++ 
Sbjct  371  SPGKPSEDF  379



>gb|AFW83642.1| phosphoethanolamine N-methyltransferase [Zea mays]
Length=502

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLH  E YGQML+ AGF DVIAEDRTDQF+ VL KEL   
Sbjct  399  CRSPGKPSEEFAAYIKQRGYDLHAVEAYGQMLKSAGFRDVIAEDRTDQFLGVLDKELAEF  458

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K+ F+ DF++EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  459  EKNKDDFLSDFTQEDYDDIVNGWKAKLQRSSAGEQRWGL  497


 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  669  CAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            C+VEFEVADCT KTYPD TFDVIYSRDTILHI DKP+LF+SF+KWLKPGGKVLI+DYC+ 
Sbjct  342  CSVEFEVADCTTKTYPDNTFDVIYSRDTILHIHDKPSLFKSFFKWLKPGGKVLISDYCRS  401

Query  489  LDLPQKNL  466
               P +  
Sbjct  402  PGKPSEEF  409



>ref|XP_003567962.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Brachypodium distachyon]
Length=501

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSE+FAAYIKQRGYDLHD + YG+ML +AGF DVIAEDRTDQF++VL++EL   
Sbjct  398  CRSPGKPSEDFAAYIKQRGYDLHDVKTYGKMLENAGFHDVIAEDRTDQFLRVLERELAET  457

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK KEAF+ DF++EDY+DIV GW  KL R+S+GEQ+WGL
Sbjct  458  EKNKEAFLADFTQEDYDDIVNGWSAKLKRSSAGEQKWGL  496


 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT K YP+ TFDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLI+DYC+
Sbjct  340  KCSVEFEVADCTTKEYPENTFDVIYSRDTILHIQDKPALFRNFFKWLKPGGKVLISDYCR  399

Query  492  GLDLPQKNL  466
                P ++ 
Sbjct  400  SPGKPSEDF  408



>ref|XP_006655550.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Oryza 
brachyantha]
Length=495

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLHD + YG+ML DAGF  V AEDRTDQF++VL++EL  V
Sbjct  392  CRSPGKPSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHHVTAEDRTDQFLRVLQRELAEV  451

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K+AF+ DF++EDY+DIV GW  KL R+S+GEQ+WGL
Sbjct  452  EKNKDAFLADFTQEDYDDIVNGWNAKLKRSSAGEQKWGL  490


 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT K+Y   TFDVIYSRDTILHI DKPALFRSF+KWLKPGGKVLI+DYC+
Sbjct  334  KCSVEFEVADCTTKSYQPNTFDVIYSRDTILHIHDKPALFRSFFKWLKPGGKVLISDYCR  393

Query  492  GLDLPQKNL  466
                P +  
Sbjct  394  SPGKPSEEF  402



>ref|XP_004969637.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=499

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLHD + YGQML++AGF  VIAEDRTDQF+ +L+KELD  
Sbjct  396  CRSPGKPSEEFAAYIKQRGYDLHDVDAYGQMLKNAGFSHVIAEDRTDQFLGILQKELDKF  455

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K  F+ DFS+ DY+DIV GWK K+ R+S+GEQRWGL
Sbjct  456  EKSKADFLSDFSQGDYDDIVNGWKAKVQRSSAGEQRWGL  494


 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT KTYPD TFDVIYSRDTILHIQDKP+LF+SF+KWLKPGGKVLI+DYC+
Sbjct  338  KCSVEFEVADCTTKTYPDHTFDVIYSRDTILHIQDKPSLFKSFFKWLKPGGKVLISDYCR  397

Query  492  GLDLPQKNL  466
                P +  
Sbjct  398  SPGKPSEEF  406



>ref|XP_007036803.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY21304.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
Length=494

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 86/100 (86%), Gaps = 1/100 (1%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQ-MLRDAGFEDVIAEDRTDQFMKVLKKELDA  323
             + +G PS EFA YI+QRGYDLHD E YGQ +L DAGF++VIAEDRT+QF++VL++EL+ 
Sbjct  389  CKNAGTPSSEFAEYIEQRGYDLHDVEAYGQQILSDAGFDEVIAEDRTEQFLQVLQRELNE  448

Query  322  VEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            VEK+K+AF+  FS+EDY+DI+GGWK KL R+SSGEQRWGL
Sbjct  449  VEKDKDAFVSSFSQEDYDDILGGWKAKLIRSSSGEQRWGL  488


 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
             C+VEFEVADCTKKTYPD +FDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLI+DYCK
Sbjct  331  NCSVEFEVADCTKKTYPDNSFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLISDYCK  390

Query  492  GLDLPQKNLQRILSK  448
                P       + +
Sbjct  391  NAGTPSSEFAEYIEQ  405



>ref|XP_002456193.1| hypothetical protein SORBIDRAFT_03g031940 [Sorghum bicolor]
 gb|EES01313.1| hypothetical protein SORBIDRAFT_03g031940 [Sorghum bicolor]
Length=499

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFAAYIKQRGYDLHD E YGQML++AGF  VIAEDRTDQF+ VL+KELD  
Sbjct  396  CKSPGKPSEEFAAYIKQRGYDLHDVEAYGQMLKNAGFSHVIAEDRTDQFLSVLQKELDKF  455

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K+ F+ +F++ DY+DIV GWK KL RTS+ EQRWGL
Sbjct  456  EKNKDDFLSEFAQGDYDDIVNGWKAKLQRTSAREQRWGL  494


 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KC+VEFEVADCT KTYPD  FDVIYSRDTILHIQDKP+LF+SF+KWLKPGGKVLI+DYCK
Sbjct  338  KCSVEFEVADCTTKTYPDHMFDVIYSRDTILHIQDKPSLFKSFFKWLKPGGKVLISDYCK  397

Query  492  GLDLPQKNL  466
                P +  
Sbjct  398  SPGKPSEEF  406



>gb|KDO18851.1| hypothetical protein SPRG_15850 [Saprolegnia parasitica CBS 223.65]
Length=498

 Score = 93.2 bits (230),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 57/92 (62%), Gaps = 0/92 (0%)
 Frame = -3

Query  478  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  299
            +  F AY+  RGY L     YG ++   GF DV AEDRT+ F++VL+ EL      K+AF
Sbjct  401  TTRFKAYVASRGYHLLTPAAYGHVIASVGFSDVEAEDRTEHFVQVLQTELARTRLNKDAF  460

Query  298  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            I + S  DY DIV GW+ KL R + G+Q+WGL
Sbjct  461  IAETSAHDYEDIVDGWEAKLVRCAEGDQKWGL  492


 Score = 88.6 bits (218),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -1

Query  660  EFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKG  490
            EFE+ D T K Y  A+FDVIYSRDTILHI DK +LF  FY WLKPGG++LI+DYC G
Sbjct  339  EFEICDATTKEYAPASFDVIYSRDTILHIADKKSLFAKFYTWLKPGGRLLISDYCCG  395



>gb|KDP23922.1| hypothetical protein JCGZ_27082 [Jatropha curcas]
Length=510

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             + +G PSEEFA YIKQRGY LH+ + Y QML DAGF+DVIAEDRTDQF +VLK+ELDAV
Sbjct  406  CKSAGTPSEEFAEYIKQRGYYLHEVKPYVQMLTDAGFDDVIAEDRTDQFNRVLKRELDAV  465

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EKEK+ FI DFSE+D+NDIV GWK KL R+S+GEQ W L
Sbjct  466  EKEKDEFIHDFSEKDFNDIVDGWKAKLIRSSAGEQLWIL  504


 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFE+AD TKKTYP+ TFDVIY+RDT+LHI+DKPALFRSFYKWLKPGGK LI+DYCK
Sbjct  348  KCAVEFELADITKKTYPNNTFDVIYTRDTMLHIKDKPALFRSFYKWLKPGGKFLISDYCK  407

Query  492  GLDLPQKNLQRILSK  448
                P +     + +
Sbjct  408  SAGTPSEEFAEYIKQ  422



>dbj|BAJ97525.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -3

Query  499  LQRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAV  320
             +  G PSEEFA+YIKQRGYDLHD E YGQML +AGF DVIAED +DQF+KVL++EL  V
Sbjct  405  CRSPGKPSEEFASYIKQRGYDLHDVETYGQMLENAGFHDVIAEDHSDQFLKVLQRELAEV  464

Query  319  EKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  203
            EK K+ F+ DF +EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  465  EKNKDDFLADFGQEDYDDIVTGWNAKLHRSSAGEQRWGL  503


 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -1

Query  672  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  493
            KCAVEFEVADCT KTYPD TFDVIYSRDTILHIQDKPALFRSF+KWLKPGGKVLI+DYC+
Sbjct  347  KCAVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCR  406

Query  492  GLDLPQKNL  466
                P +  
Sbjct  407  SPGKPSEEF  415



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600