BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF022L15

Length=561
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010671859.1|  PREDICTED: 60S ribosomal protein L36-2-like        201   6e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006339562.1|  PREDICTED: 60S ribosomal protein L36-2-like        201   1e-62   Solanum tuberosum [potatoes]
ref|XP_002317423.1|  hypothetical protein POPTR_0011s07390g             201   1e-62   Populus trichocarpa [western balsam poplar]
ref|XP_004240729.1|  PREDICTED: 60S ribosomal protein L36-2             200   3e-62   Solanum lycopersicum
ref|XP_004229955.1|  PREDICTED: 60S ribosomal protein L36-2             199   4e-62   Solanum lycopersicum
ref|XP_010108352.1|  60S ribosomal protein L36-2                        199   7e-62   Morus notabilis
ref|XP_009627970.1|  PREDICTED: 60S ribosomal protein L36-2-like        199   7e-62   Nicotiana tomentosiformis
ref|XP_011045936.1|  PREDICTED: 60S ribosomal protein L36-2-like ...    199   9e-62   Populus euphratica
ref|XP_011045934.1|  PREDICTED: 60S ribosomal protein L36-2-like ...    199   9e-62   Populus euphratica
ref|XP_007051817.1|  60S ribosomal protein L36 isoform 1                199   1e-61   
gb|AFK38454.1|  unknown                                                 198   1e-61   Lotus japonicus
emb|CDP08821.1|  unnamed protein product                                197   2e-61   Coffea canephora [robusta coffee]
ref|XP_010696542.1|  PREDICTED: 60S ribosomal protein L36-2-like        197   2e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001275159.1|  60S ribosomal protein L36-2-like                   197   2e-61   Solanum tuberosum [potatoes]
ref|XP_010060856.1|  PREDICTED: 60S ribosomal protein L36-2-like        197   3e-61   Eucalyptus grandis [rose gum]
ref|XP_002318214.1|  hypothetical protein POPTR_0012s13060g             197   4e-61   Populus trichocarpa [western balsam poplar]
emb|CDP05183.1|  unnamed protein product                                196   7e-61   Coffea canephora [robusta coffee]
ref|XP_010035150.1|  PREDICTED: 60S ribosomal protein L36-2-like        196   8e-61   Eucalyptus grandis [rose gum]
gb|KCW90685.1|  hypothetical protein EUGRSUZ_A02774                     197   9e-61   Eucalyptus grandis [rose gum]
gb|KCW90686.1|  hypothetical protein EUGRSUZ_A02774                     197   9e-61   Eucalyptus grandis [rose gum]
ref|XP_002305746.1|  60S ribosomal protein L36-3                        196   9e-61   Populus trichocarpa [western balsam poplar]
ref|XP_004496553.1|  PREDICTED: 60S ribosomal protein L36-2-like        195   2e-60   Cicer arietinum [garbanzo]
ref|XP_011093140.1|  PREDICTED: 60S ribosomal protein L36-2-like        195   2e-60   Sesamum indicum [beniseed]
ref|XP_009614811.1|  PREDICTED: 60S ribosomal protein L36-2-like        195   2e-60   Nicotiana tomentosiformis
gb|AFK43005.1|  unknown                                                 194   4e-60   Lotus japonicus
ref|XP_002322479.1|  hypothetical protein POPTR_0015s12960g             194   4e-60   Populus trichocarpa [western balsam poplar]
ref|XP_011076152.1|  PREDICTED: 60S ribosomal protein L36-2-like        194   4e-60   Sesamum indicum [beniseed]
ref|XP_009772617.1|  PREDICTED: 60S ribosomal protein L36-2-like        194   5e-60   Nicotiana sylvestris
gb|EYU25104.1|  hypothetical protein MIMGU_mgv1a016711mg                194   5e-60   Erythranthe guttata [common monkey flower]
ref|XP_011008474.1|  PREDICTED: 60S ribosomal protein L36-2-like ...    194   6e-60   Populus euphratica
gb|KJB52776.1|  hypothetical protein B456_008G276200                    195   6e-60   Gossypium raimondii
ref|XP_010255374.1|  PREDICTED: 60S ribosomal protein L36-2-like        194   8e-60   Nelumbo nucifera [Indian lotus]
ref|XP_004140771.1|  PREDICTED: 60S ribosomal protein L36-2-like        194   8e-60   Cucumis sativus [cucumbers]
gb|KDP28634.1|  hypothetical protein JCGZ_14405                         194   9e-60   Jatropha curcas
ref|XP_010108357.1|  60S ribosomal protein L36-2                        196   9e-60   
gb|KJB52777.1|  hypothetical protein B456_008G276200                    194   1e-59   Gossypium raimondii
ref|XP_006445050.1|  hypothetical protein CICLE_v10022961mg             192   4e-59   
ref|XP_011084426.1|  PREDICTED: 60S ribosomal protein L36-2-like        192   4e-59   Sesamum indicum [beniseed]
gb|EYU19556.1|  hypothetical protein MIMGU_mgv1a016705mg                191   5e-59   Erythranthe guttata [common monkey flower]
ref|XP_003555154.1|  PREDICTED: 60S ribosomal protein L36-3             191   7e-59   Glycine max [soybeans]
ref|XP_002268754.1|  PREDICTED: 60S ribosomal protein L36-3             191   1e-58   Vitis vinifera
ref|XP_003556112.1|  PREDICTED: 60S ribosomal protein L36-3-like ...    191   1e-58   Glycine max [soybeans]
gb|KJB52778.1|  hypothetical protein B456_008G276200                    191   1e-58   Gossypium raimondii
ref|XP_003536462.1|  PREDICTED: 60S ribosomal protein L36-3-like        190   1e-58   Glycine max [soybeans]
ref|XP_002273507.1|  PREDICTED: 60S ribosomal protein L36-3             190   2e-58   Vitis vinifera
ref|XP_004234407.1|  PREDICTED: 60S ribosomal protein L36-2             190   2e-58   Solanum lycopersicum
ref|XP_007038724.1|  60S ribosomal protein L36                          190   2e-58   Theobroma cacao [chocolate]
ref|XP_007143433.1|  hypothetical protein PHAVU_007G072100g             190   2e-58   Phaseolus vulgaris [French bean]
gb|KJB34107.1|  hypothetical protein B456_006G048500                    190   3e-58   Gossypium raimondii
gb|KJB09831.1|  hypothetical protein B456_001G169600                    189   3e-58   Gossypium raimondii
emb|CBI40362.3|  unnamed protein product                                191   4e-58   Vitis vinifera
ref|XP_008234218.1|  PREDICTED: 60S ribosomal protein L36-3-like        189   4e-58   Prunus mume [ume]
ref|XP_006421951.1|  hypothetical protein CICLE_v10006222mg             189   5e-58   Citrus clementina [clementine]
gb|KDO52003.1|  hypothetical protein CISIN_1g033549mg                   189   5e-58   Citrus sinensis [apfelsine]
ref|XP_011101239.1|  PREDICTED: 60S ribosomal protein L36-2-like        189   6e-58   Sesamum indicum [beniseed]
ref|XP_003592267.1|  60S ribosomal protein L36                          189   6e-58   Medicago truncatula
ref|XP_007051818.1|  Ribosomal protein L36e family protein isoform 2    189   6e-58   
ref|XP_003592268.1|  60S ribosomal protein L36                          190   6e-58   
ref|NP_001274874.1|  60S ribosomal protein L36-2-like                   188   8e-58   Solanum tuberosum [potatoes]
ref|XP_006421950.1|  hypothetical protein CICLE_v10006222mg             189   9e-58   
ref|XP_006349632.1|  PREDICTED: 60S ribosomal protein L36-2-like        188   9e-58   Solanum tuberosum [potatoes]
ref|XP_009789213.1|  PREDICTED: 60S ribosomal protein L36-1-like        188   1e-57   Nicotiana sylvestris
ref|XP_007051819.1|  Ribosomal protein L36e family protein isoform 3    189   1e-57   
ref|XP_007218628.1|  hypothetical protein PRUPE_ppa013641mg             188   1e-57   Prunus persica
gb|KHG10655.1|  60S ribosomal L36-2 -like protein                       188   1e-57   Gossypium arboreum [tree cotton]
ref|XP_009605981.1|  PREDICTED: 60S ribosomal protein L36-1-like        187   2e-57   Nicotiana tomentosiformis
gb|ACH63218.1|  ribosomal protein L36                                   187   2e-57   Rheum australe [Himalayan rhubarb]
gb|KHG14589.1|  60S ribosomal L36-2 -like protein                       188   2e-57   Gossypium arboreum [tree cotton]
ref|XP_009399872.1|  PREDICTED: 60S ribosomal protein L36-2-like        187   3e-57   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG11153.1|  60S ribosomal L36-2 -like protein                       186   5e-57   Gossypium arboreum [tree cotton]
ref|XP_004308073.1|  PREDICTED: 60S ribosomal protein L36-2-like        186   8e-57   Fragaria vesca subsp. vesca
ref|XP_002513689.1|  60S ribosomal protein L36e, putative               186   1e-56   Ricinus communis
ref|XP_006846149.1|  hypothetical protein AMTR_s00012p00179170          186   1e-56   Amborella trichopoda
ref|XP_008802753.1|  PREDICTED: 60S ribosomal protein L36-2             185   2e-56   Phoenix dactylifera
ref|XP_004302782.1|  PREDICTED: 60S ribosomal protein L36-2-like        185   2e-56   Fragaria vesca subsp. vesca
gb|KJB23856.1|  hypothetical protein B456_004G118000                    185   2e-56   Gossypium raimondii
gb|AFK47188.1|  unknown                                                 185   2e-56   Medicago truncatula
ref|XP_011008473.1|  PREDICTED: 60S ribosomal protein L36-1-like ...    185   2e-56   Populus euphratica
ref|XP_010241904.1|  PREDICTED: 60S ribosomal protein L36-3-like        185   2e-56   Nelumbo nucifera [Indian lotus]
ref|XP_009380656.1|  PREDICTED: 60S ribosomal protein L36-2-like        185   3e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP22263.1|  hypothetical protein JCGZ_26094                         184   3e-56   Jatropha curcas
ref|XP_009419935.1|  PREDICTED: 60S ribosomal protein L36-3-like        184   3e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010922348.1|  PREDICTED: 60S ribosomal protein L36-3-like        184   6e-56   Elaeis guineensis
ref|NP_001044760.1|  Os01g0840700                                       184   6e-56   
gb|AEY84977.1|  60S ribosomal protein L36                               183   1e-55   Wolffia australiana
ref|XP_010543315.1|  PREDICTED: 60S ribosomal protein L36-3             183   1e-55   Tarenaya hassleriana [spider flower]
ref|XP_010558320.1|  PREDICTED: 60S ribosomal protein L36-2-like        183   1e-55   Tarenaya hassleriana [spider flower]
dbj|BAJ98221.1|  predicted protein                                      183   1e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006827643.1|  hypothetical protein AMTR_s00009p00248470          182   2e-55   
ref|XP_010553286.1|  PREDICTED: 60S ribosomal protein L36-2-like        182   2e-55   Tarenaya hassleriana [spider flower]
ref|XP_010931250.1|  PREDICTED: 60S ribosomal protein L36-3-like        182   2e-55   Elaeis guineensis
ref|XP_004309360.1|  PREDICTED: 60S ribosomal protein L36-2-like        182   2e-55   Fragaria vesca subsp. vesca
pdb|3J61|II  Chain i, Localization Of The Large Subunit Ribosomal...    182   2e-55   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010528374.1|  PREDICTED: 60S ribosomal protein L36-2-like        182   2e-55   Tarenaya hassleriana [spider flower]
ref|XP_010553284.1|  PREDICTED: 60S ribosomal protein L36-2             182   2e-55   Tarenaya hassleriana [spider flower]
gb|EAY76455.1|  hypothetical protein OsI_04390                          182   2e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_009420092.1|  PREDICTED: 60S ribosomal protein L36-3-like        182   2e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009412547.1|  PREDICTED: 60S ribosomal protein L36-3-like        182   3e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006644985.1|  PREDICTED: 60S ribosomal protein L36-2-like        182   3e-55   Oryza brachyantha
ref|XP_007206165.1|  hypothetical protein PRUPE_ppa013654mg             182   4e-55   Prunus persica
ref|XP_010232542.1|  PREDICTED: 60S ribosomal protein L36-3-like        182   4e-55   Brachypodium distachyon [annual false brome]
gb|KJB34108.1|  hypothetical protein B456_006G048500                    181   5e-55   Gossypium raimondii
ref|NP_001055753.1|  Os05g0459900                                       181   1e-54   
ref|XP_008784534.1|  PREDICTED: 60S ribosomal protein L36-3-like        180   1e-54   Phoenix dactylifera
gb|AES62519.2|  60S ribosomal protein L36                               180   2e-54   Medicago truncatula
ref|XP_003563645.1|  PREDICTED: 60S ribosomal protein L36-3-like        180   2e-54   Brachypodium distachyon [annual false brome]
ref|XP_006654512.1|  PREDICTED: 60S ribosomal protein L36-2-like        180   2e-54   Oryza brachyantha
ref|XP_003592269.1|  60S ribosomal protein L36                          181   2e-54   
ref|XP_002511852.1|  60S ribosomal protein L36e, putative               180   2e-54   
ref|XP_008369879.1|  PREDICTED: 60S ribosomal protein L36-3-like        180   2e-54   
emb|CDM84897.1|  unnamed protein product                                179   4e-54   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009421339.1|  PREDICTED: 60S ribosomal protein L36-3-like        179   4e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003568301.1|  PREDICTED: 60S ribosomal protein L36-3-like        179   4e-54   Brachypodium distachyon [annual false brome]
ref|XP_008810595.1|  PREDICTED: 60S ribosomal protein L36-3-like        179   5e-54   Phoenix dactylifera
ref|XP_008776722.1|  PREDICTED: 60S ribosomal protein L36-3-like        178   7e-54   Phoenix dactylifera
ref|XP_002458740.1|  hypothetical protein SORBIDRAFT_03g039390          178   9e-54   Sorghum bicolor [broomcorn]
dbj|BAJ92829.1|  predicted protein                                      178   1e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK21348.1|  unknown                                                 178   1e-53   Picea sitchensis
ref|XP_008388314.1|  PREDICTED: 60S ribosomal protein L36-3-like        177   2e-53   
ref|XP_004970529.1|  PREDICTED: 60S ribosomal protein L36-2-like ...    177   2e-53   Setaria italica
ref|XP_009143472.1|  PREDICTED: 60S ribosomal protein L36-2             177   2e-53   Brassica rapa
ref|XP_009133194.1|  PREDICTED: 60S ribosomal protein L36-2-like        176   4e-53   
emb|CDX79744.1|  BnaC03g20800D                                          176   5e-53   
gb|ABR25361.1|  60S ribosomal protein l-36-2                            176   5e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_009141676.1|  PREDICTED: 60S ribosomal protein L36-2-like        176   8e-53   Brassica rapa
ref|XP_010505352.1|  PREDICTED: 60S ribosomal protein L36-2-like        176   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_006410950.1|  hypothetical protein EUTSA_v10017455mg             175   1e-52   Eutrema salsugineum [saltwater cress]
gb|ABK21274.1|  unknown                                                 175   1e-52   Picea sitchensis
emb|CDY07780.1|  BnaA03g17310D                                          179   2e-52   Brassica napus [oilseed rape]
gb|EMT26739.1|  60S ribosomal protein L36-2                             175   2e-52   
ref|XP_009103881.1|  PREDICTED: 60S ribosomal protein L36-2             174   2e-52   Brassica rapa
ref|XP_010937642.1|  PREDICTED: 60S ribosomal protein L36-3-like        174   3e-52   Elaeis guineensis
ref|XP_010427033.1|  PREDICTED: 60S ribosomal protein L36-2             174   4e-52   Camelina sativa [gold-of-pleasure]
ref|XP_009116070.1|  PREDICTED: 60S ribosomal protein L36-2             174   4e-52   Brassica rapa
ref|XP_010509313.1|  PREDICTED: 60S ribosomal protein L36-2-like        174   4e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010517031.1|  PREDICTED: 60S ribosomal protein L36-2-like        174   5e-52   Camelina sativa [gold-of-pleasure]
gb|EMS49232.1|  60S ribosomal protein L36-2                             175   5e-52   Triticum urartu
gb|EMT04101.1|  hypothetical protein F775_43985                         173   9e-52   
ref|XP_006295258.1|  hypothetical protein CARUB_v10024358mg             172   1e-51   Capsella rubella
gb|EMS68428.1|  60S ribosomal protein L36-3                             172   2e-51   Triticum urartu
gb|AAV83991.1|  putative 60S ribosomal protein L36                      172   2e-51   Saccharum officinarum [noble cane]
ref|XP_004970528.1|  PREDICTED: 60S ribosomal protein L36-2-like ...    172   3e-51   
ref|NP_001284558.1|  uncharacterized protein LOC103504721               171   4e-51   Zea mays [maize]
ref|XP_004961851.1|  PREDICTED: 60S ribosomal protein L36-3-like ...    171   6e-51   Setaria italica
ref|XP_010504144.1|  PREDICTED: 60S ribosomal protein L36-2-like        171   8e-51   Camelina sativa [gold-of-pleasure]
ref|XP_006292075.1|  hypothetical protein CARUB_v10018270mg             171   1e-50   Capsella rubella
ref|XP_010515876.1|  PREDICTED: 60S ribosomal protein L36-2-like        170   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006403658.1|  hypothetical protein EUTSA_v10010840mg             169   3e-50   Eutrema salsugineum [saltwater cress]
ref|NP_850697.1|  60S ribosomal protein L36-2                           169   4e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877939.1|  60S ribosomal protein L36                          169   5e-50   
emb|CDX73528.1|  BnaC08g24750D                                          169   6e-50   
gb|ACG34217.1|  60S ribosomal protein L36-2                             168   7e-50   Zea mays [maize]
ref|XP_004961850.1|  PREDICTED: 60S ribosomal protein L36-3-like ...    168   1e-49   
ref|NP_181296.1|  60S ribosomal protein L36-1                           168   1e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006286404.1|  hypothetical protein CARUB_v10002302mg             167   1e-49   Capsella rubella
ref|XP_010490699.1|  PREDICTED: 60S ribosomal protein L36-3-like        167   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_002881517.1|  60S ribosomal protein L36                          167   2e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_010423862.1|  PREDICTED: 60S ribosomal protein L36-3             167   2e-49   Camelina sativa [gold-of-pleasure]
ref|NP_001149704.1|  LOC100283331                                       167   2e-49   Zea mays [maize]
ref|XP_002870974.1|  60S ribosomal protein L36                          165   2e-48   Arabidopsis lyrata subsp. lyrata
gb|EMT02216.1|  60S ribosomal protein L36-2                             163   2e-47   
ref|NP_195865.1|  60S ribosomal protein L36-3                           161   3e-47   Arabidopsis thaliana [mouse-ear cress]
gb|KDO38035.1|  hypothetical protein CISIN_1g037449mg                   159   2e-46   Citrus sinensis [apfelsine]
gb|ACG39797.1|  60S ribosomal protein L36-2                             160   3e-46   Zea mays [maize]
ref|XP_006422473.1|  hypothetical protein CICLE_v10029636mg             158   6e-46   
ref|XP_001758751.1|  predicted protein                                  156   5e-45   
ref|XP_001766383.1|  predicted protein                                  155   7e-45   
ref|XP_002966421.1|  hypothetical protein SELMODRAFT_439710             151   3e-43   Selaginella moellendorffii
emb|CDY07570.1|  BnaC06g14940D                                          151   4e-43   Brassica napus [oilseed rape]
gb|AFK41147.1|  unknown                                                 150   5e-43   Medicago truncatula
ref|XP_010456363.1|  PREDICTED: 60S ribosomal protein L36-3-like        152   5e-43   
ref|XP_006443526.1|  hypothetical protein CICLE_v10023595mg             149   2e-42   Citrus clementina [clementine]
ref|NP_566987.1|  60S ribosomal protein L36-2                           145   6e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002976225.1|  hypothetical protein SELMODRAFT_267958             145   8e-41   Selaginella moellendorffii
pir||T14304  ribosomal protein - carrot (fragment)                      145   8e-41
ref|XP_006493829.1|  PREDICTED: 60S ribosomal protein L36-2-like        145   9e-41   Citrus sinensis [apfelsine]
sp|P52866.2|RL36_DAUCA  RecName: Full=60S ribosomal protein L36         143   3e-40   Daucus carota [carrots]
ref|XP_002987131.1|  hypothetical protein SELMODRAFT_125537             142   2e-39   
gb|KFK24742.1|  hypothetical protein AALP_AA8G018600                    146   2e-39   Arabis alpina [alpine rockcress]
ref|XP_002953563.1|  component of cytosolic 80S ribosome and 60S ...    140   4e-39   Volvox carteri f. nagariensis
ref|XP_006450712.1|  hypothetical protein CICLE_v10010663mg             140   1e-38   
gb|KDO79856.1|  hypothetical protein CISIN_1g041684mg                   139   2e-38   Citrus sinensis [apfelsine]
ref|WP_036770920.1|  hypothetical protein                               137   7e-38   
gb|EMS54664.1|  60S ribosomal protein L36-1                             139   1e-37   Triticum urartu
ref|XP_001703188.1|  ribosomal protein L36, component of cytosoli...    136   1e-37   Chlamydomonas reinhardtii
gb|KDO42554.1|  hypothetical protein CISIN_1g038355mg                   134   1e-36   Citrus sinensis [apfelsine]
ref|XP_006492010.1|  PREDICTED: 60S ribosomal protein L36-2-like        134   1e-36   Citrus sinensis [apfelsine]
ref|XP_006436937.1|  hypothetical protein CICLE_v10033467mg             134   1e-36   
ref|XP_004510960.1|  PREDICTED: 60S ribosomal protein L36-3-like ...    134   2e-36   
ref|XP_005782836.1|  hypothetical protein EMIHUDRAFT_442529             133   5e-36   Emiliania huxleyi CCMP1516
ref|XP_005649688.1|  ribosomal protein L36 component of cytosolic...    132   5e-36   Coccomyxa subellipsoidea C-169
ref|XP_011396354.1|  60S ribosomal protein L36-3                        132   5e-36   Auxenochlorella protothecoides
gb|KDD74326.1|  ribosomal protein L36e                                  132   6e-36   Helicosporidium sp. ATCC 50920
ref|XP_002463626.1|  hypothetical protein SORBIDRAFT_01g003200          134   9e-36   
sp|Q9LRB8.1|RL36_ULVCO  RecName: Full=60S ribosomal protein L36         131   1e-35   Ulva compressa
ref|XP_002507140.1|  60S ribosomal protein L36                          127   8e-34   Micromonas commoda
ref|XP_006420273.1|  hypothetical protein CICLE_v10006778mg             126   1e-33   
ref|XP_010495043.1|  PREDICTED: 60S ribosomal protein L36-3-like        126   2e-33   Camelina sativa [gold-of-pleasure]
dbj|BAJ87211.1|  predicted protein                                      125   3e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFK35178.1|  unknown                                                 124   4e-33   Lotus japonicus
gb|KFK36650.1|  hypothetical protein AALP_AA4G152200                    126   7e-33   Arabis alpina [alpine rockcress]
ref|XP_004986151.1|  PREDICTED: uncharacterized protein LOC101772435    127   7e-33   Setaria italica
ref|XP_003074843.1|  Rpl36 60S ribosomal protein L36, probable (IC)     124   7e-33   Ostreococcus tauri
ref|XP_003056517.1|  60S ribosomal protein L36                          123   2e-32   Micromonas pusilla CCMP1545
ref|XP_001416206.1|  60S ribosomal protein L36, probable                122   6e-32   Ostreococcus lucimarinus CCE9901
gb|KIY96786.1|  60S ribosomal protein L36                               122   8e-32   Monoraphidium neglectum
gb|KDO66027.1|  hypothetical protein CISIN_1g035914mg                   120   3e-31   Citrus sinensis [apfelsine]
ref|XP_005850248.1|  hypothetical protein CHLNCDRAFT_141923             119   5e-31   Chlorella variabilis
ref|XP_004961849.1|  PREDICTED: 60S ribosomal protein L36-3-like ...    120   8e-31   
ref|XP_001626706.1|  predicted protein                                  119   1e-30   Nematostella vectensis
gb|AGH70180.1|  60S ribosomal protein L36                               118   2e-30   Placozoa sp. H4
emb|CDM81131.1|  unnamed protein product                                117   2e-30   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002111013.1|  expressed hypothetical protein                     117   2e-30   Trichoplax adhaerens
gb|AFG65289.1|  hypothetical protein CL823Contig1_01                    117   3e-30   Pinus taeda
ref|XP_005703824.1|  60S ribosomal protein L36e                         117   5e-30   Galdieria sulphuraria
gb|ACO11656.1|  60S ribosomal protein L36                               115   2e-29   Caligus rogercresseyi
gb|ESA02313.1|  hypothetical protein GLOINDRAFT_38702                   115   4e-29   
ref|XP_009025143.1|  hypothetical protein HELRODRAFT_67827              115   4e-29   Helobdella robusta
ref|XP_005536754.1|  60S ribosomal protein L36                          114   4e-29   Cyanidioschyzon merolae strain 10D
gb|EXX78590.1|  ribosomal 60S subunit protein L36A                      115   5e-29   Rhizophagus irregularis DAOM 197198w
gb|AEB54643.1|  ribosomal protein L36                                   115   6e-29   Procambarus clarkii
gb|ABG74908.1|  ribosomal protein L36e                                  114   7e-29   Artemia franciscana
ref|XP_006442634.1|  hypothetical protein CICLE_v10023654mg             113   1e-28   
ref|XP_002602280.1|  hypothetical protein BRAFLDRAFT_279545             114   1e-28   Branchiostoma floridae
gb|EPZ34903.1|  60S ribosomal protein L36-B                             113   1e-28   Rozella allomycis CSF55
ref|XP_006678782.1|  hypothetical protein BATDEDRAFT_88084              113   2e-28   Batrachochytrium dendrobatidis JAM81
gb|AAN52381.1|  ribosomal protein L36                                   113   2e-28   Branchiostoma belcheri
gb|KGG51704.1|  60S ribosomal protein L36                               113   2e-28   Mitosporidium daphniae
sp|Q4PM12.1|RL36_IXOSC  RecName: Full=60S ribosomal protein L36         113   2e-28   Ixodes scapularis [blacklegged tick]
gb|EPX71888.1|  60S ribosomal protein L36                               112   3e-28   Schizosaccharomyces octosporus yFS286
ref|XP_006449933.1|  hypothetical protein CICLE_v10017552mg             112   4e-28   
gb|ACO12212.1|  60S ribosomal protein L36                               112   4e-28   Lepeophtheirus salmonis
emb|CCQ18647.1|  60S ribosomal protein L36                              112   5e-28   Sycon ciliatum
ref|NP_587850.1|  60S ribosomal protein L36                             112   6e-28   Schizosaccharomyces pombe
gb|ACG47156.1|  60S ribosomal protein L36-2                             111   6e-28   Zea mays [maize]
gb|EDL08532.1|  mCG17441                                                112   6e-28   Mus musculus [mouse]
gb|EDL38178.1|  mCG5564                                                 112   8e-28   Mus musculus [mouse]
gb|EDL30578.1|  mCG14445                                                111   9e-28   Mus musculus [mouse]
gb|EPY49944.1|  60S ribosomal protein L36                               111   1e-27   Schizosaccharomyces cryophilus OY26
ref|XP_006776262.1|  PREDICTED: 60S ribosomal protein L36-like          111   1e-27   
ref|XP_003448819.1|  PREDICTED: 60S ribosomal protein L36-like          110   1e-27   Oreochromis niloticus
ref|XP_003369234.1|  60S ribosomal protein L36                          112   1e-27   Trichinella spiralis
gb|ACN09945.1|  60S ribosomal protein L36                               110   2e-27   Salmo salar
ref|XP_005948486.1|  PREDICTED: 60S ribosomal protein L36-like          110   2e-27   Haplochromis burtoni
ref|XP_004067689.1|  PREDICTED: 60S ribosomal protein L36               110   2e-27   Oryzias latipes [Japanese rice fish]
ref|XP_009495627.1|  50S ribosomal protein L36e                         110   2e-27   Fonticula alba
ref|XP_005989906.1|  PREDICTED: 60S ribosomal protein L36               110   2e-27   Latimeria chalumnae
ref|XP_005713313.1|  60S ribosomal protein L36                          110   2e-27   Chondrus crispus [carageen]
gb|EIE83316.1|  50S ribosomal protein L36e                              110   2e-27   Rhizopus delemar RA 99-880
ref|XP_008280071.1|  PREDICTED: 60S ribosomal protein L36               110   3e-27   Stegastes partitus
ref|XP_005812936.1|  PREDICTED: 60S ribosomal protein L36-like is...    111   3e-27   
gb|EIF46093.1|  60s ribosomal protein l36                               109   4e-27   Brettanomyces bruxellensis AWRI1499
ref|XP_007509092.1|  60S ribosomal protein L36                          109   4e-27   Bathycoccus prasinos
ref|XP_004655044.1|  PREDICTED: 60S ribosomal protein L36               109   4e-27   Jaculus jaculus
ref|XP_008406382.1|  PREDICTED: 60S ribosomal protein L36               109   4e-27   Poecilia reticulata
gb|KFD45335.1|  hypothetical protein M513_13789                         109   4e-27   Trichuris suis
ref|XP_001100689.1|  PREDICTED: 60S ribosomal protein L36-like          109   5e-27   
gb|ACD65182.1|  putative 60S ribosomal protein RPL36                    109   5e-27   Phoronis muelleri
ref|XP_005081423.1|  PREDICTED: 60S ribosomal protein L36               109   5e-27   Mesocricetus auratus [Syrian golden hamster]
ref|XP_006890622.1|  PREDICTED: 60S ribosomal protein L36-like          109   5e-27   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|EDK98448.1|  mCG129641                                               109   6e-27   Mus musculus [mouse]
ref|XP_005312983.1|  PREDICTED: 60S ribosomal protein L36               109   6e-27   Chrysemys picta bellii
gb|EHH17067.1|  hypothetical protein EGK_13368                          109   7e-27   Macaca mulatta [rhesus macaque]
ref|NP_056229.2|  60S ribosomal protein L36                             109   7e-27   Homo sapiens [man]
ref|XP_005548972.1|  PREDICTED: 60S ribosomal protein L36-like          109   7e-27   
ref|NP_001291085.1|  ribosomal protein L36                              109   7e-27   Esox lucius
ref|XP_004595665.1|  PREDICTED: 60S ribosomal protein L36-like          109   7e-27   Ochotona princeps [southern American pika]
ref|XP_004378486.1|  PREDICTED: 60S ribosomal protein L36               109   7e-27   Trichechus manatus latirostris
gb|AAX48870.1|  L36                                                     108   7e-27   Suberites domuncula
ref|XP_002708713.1|  PREDICTED: 60S ribosomal protein L36               108   7e-27   Oryctolagus cuniculus [domestic rabbit]
ref|XP_006832244.1|  PREDICTED: 60S ribosomal protein L36-like          108   7e-27   Chrysochloris asiatica
gb|ACI66199.1|  60S ribosomal protein L36                               108   8e-27   Salmo salar
gb|EPB83754.1|  50S ribosomal protein L36e                              108   8e-27   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_002127857.1|  PREDICTED: 60S ribosomal protein L36-like          108   8e-27   
gb|ACO07534.1|  60S ribosomal protein L36                               108   8e-27   Oncorhynchus mykiss
gb|AAX28983.1|  ribosomal protein L36                                   108   8e-27   synthetic construct
ref|NP_001005100.1|  60S ribosomal protein L36                          108   1e-26   Xenopus tropicalis [western clawed frog]
ref|XP_004578136.1|  PREDICTED: 60S ribosomal protein L36-like          108   1e-26   
gb|EFX88873.1|  hypothetical protein DAPPUDRAFT_230277                  108   1e-26   Daphnia pulex
ref|XP_007246230.1|  PREDICTED: 60S ribosomal protein L36               108   1e-26   
gb|ACO15031.1|  60S ribosomal protein L36                               108   1e-26   
ref|WP_034359331.1|  hypothetical protein                               108   1e-26   
ref|XP_010904080.1|  PREDICTED: 60S ribosomal protein L36               109   1e-26   
gb|EPB86512.1|  60S ribosomal protein L36-A                             108   1e-26   
ref|XP_004441324.1|  PREDICTED: 60S ribosomal protein L36               108   1e-26   
emb|CDH52875.1|  60s ribosomal protein l36                              108   1e-26   
ref|XP_005812937.1|  PREDICTED: 60S ribosomal protein L36-like is...    108   1e-26   
ref|NP_596310.1|  60S ribosomal protein L36                             108   1e-26   
ref|XP_003973827.1|  PREDICTED: 60S ribosomal protein L36-like          108   1e-26   
ref|XP_001506170.1|  PREDICTED: 60S ribosomal protein L36               108   1e-26   
ref|NP_001071607.1|  60S ribosomal protein L36                          108   2e-26   
emb|CEP17325.1|  hypothetical protein                                   108   2e-26   
gb|ADK34015.1|  ribosomal protein L36                                   108   2e-26   
ref|XP_008571280.1|  PREDICTED: 60S ribosomal protein L36               108   2e-26   
dbj|BAF98687.1|  ribosomal protein L36                                  108   2e-26   
ref|XP_004008529.1|  PREDICTED: 60S ribosomal protein L36-like          108   2e-26   
ref|XP_004346873.1|  50S ribosomal protein L36e                         107   2e-26   
ref|XP_001365845.1|  PREDICTED: 60S ribosomal protein L36               107   2e-26   
ref|XP_005405818.1|  PREDICTED: 60S ribosomal protein L36               109   2e-26   
ref|XP_007882090.1|  hypothetical protein PFL1_06358                    108   2e-26   
ref|XP_005095721.1|  PREDICTED: 60S ribosomal protein L36               108   2e-26   
gb|ELK29837.1|  60S ribosomal protein L36                               107   2e-26   
emb|CEP10590.1|  hypothetical protein                                   107   2e-26   
gb|ADJ18355.1|  60S ribosomal protein L36                               107   2e-26   
ref|XP_005362156.1|  PREDICTED: 60S ribosomal protein L36-like          107   2e-26   
emb|CDS10733.1|  Putative 50S ribosomal protein L36e                    107   2e-26   
gb|AAH86914.1|  Rpl36 protein                                           107   3e-26   
ref|XP_011345852.1|  PREDICTED: 60S ribosomal protein L36               108   3e-26   
ref|XP_002174299.1|  60S ribosomal protein L36                          107   3e-26   
ref|XP_004277297.1|  PREDICTED: 60S ribosomal protein L36 isoform 1     108   3e-26   
ref|XP_005580050.1|  PREDICTED: 60S ribosomal protein L36-like          107   3e-26   
ref|XP_011262454.1|  PREDICTED: 60S ribosomal protein L36               107   3e-26   
ref|XP_007524887.1|  PREDICTED: 60S ribosomal protein L36               107   3e-26   
ref|XP_006639885.1|  PREDICTED: 60S ribosomal protein L36-like          107   3e-26   
ref|XP_008835153.1|  PREDICTED: 60S ribosomal protein L36               107   3e-26   
ref|XP_001106448.2|  PREDICTED: 60S ribosomal protein L36-like          109   3e-26   
ref|XP_004714309.1|  PREDICTED: 60S ribosomal protein L36               107   3e-26   
gb|ACI68713.1|  60S ribosomal protein L36                               108   4e-26   
ref|XP_007906489.1|  PREDICTED: 60S ribosomal protein L36               107   4e-26   
gb|ACO51890.1|  60S ribosomal protein L36                               107   4e-26   
gb|AAD27776.1|AF077043_1  60S ribosomal protein L36                     107   4e-26   
ref|XP_007871936.1|  50S ribosomal protein L36e                         107   4e-26   
ref|XP_011146371.1|  PREDICTED: 60S ribosomal protein L36-like          107   4e-26   
ref|XP_007431754.1|  PREDICTED: 60S ribosomal protein L36               108   4e-26   
dbj|GAA96049.1|  hypothetical protein E5Q_02710                         107   4e-26   
dbj|BAA13701.1|  ribosomal protein L39                                  107   4e-26   
ref|NP_071949.1|  60S ribosomal protein L36                             107   4e-26   
dbj|GAN07467.1|  60S ribosomal protein L36                              107   5e-26   
ref|XP_006126867.1|  PREDICTED: 60S ribosomal protein L36               107   5e-26   
emb|CDW61113.1|  Ribosomal L36e domain containing protein               107   5e-26   
emb|CDS12864.1|  Putative 50S ribosomal protein L36e                    107   5e-26   
gb|ABY28365.1|  ribosomal protein L36                                   107   5e-26   
gb|EIE75852.1|  50S ribosomal protein L36e                              106   5e-26   
ref|XP_006764310.1|  PREDICTED: 60S ribosomal protein L36               107   5e-26   
ref|XP_006695752.1|  60S ribosomal protein L36-like protein             107   5e-26   
ref|XP_006741742.1|  PREDICTED: 60S ribosomal protein L36-like          106   7e-26   
ref|XP_006098267.1|  PREDICTED: 60S ribosomal protein L36-like          106   7e-26   
gb|EPT03745.1|  hypothetical protein FOMPIDRAFT_1022307                 106   8e-26   
gb|EST10042.1|  putative 60S ribosomal protein L36                      106   9e-26   
ref|XP_004392512.1|  PREDICTED: 60S ribosomal protein L36-like          106   1e-25   
ref|XP_011307223.1|  PREDICTED: 60S ribosomal protein L36               106   1e-25   
ref|NP_001232394.1|  putative ribosomal protein L36                     105   1e-25   
ref|XP_011158784.1|  PREDICTED: 60S ribosomal protein L36               106   1e-25   
ref|XP_001794331.1|  hypothetical protein SNOG_03785                    105   1e-25   
ref|XP_008333225.1|  PREDICTED: 60S ribosomal protein L36               105   1e-25   
gb|EMS19923.1|  60S ribosomal protein l36                               105   1e-25   
emb|CDJ39626.1|  60S Ribosomal protein L36, putative                    105   1e-25   
ref|XP_002173334.1|  60S ribosomal protein L36                          105   1e-25   
ref|XP_006903108.1|  PREDICTED: 60S ribosomal protein L36-like          105   1e-25   
ref|XP_007113894.1|  PREDICTED: 60S ribosomal protein L36-like          105   1e-25   
ref|XP_002141815.1|  60s ribosomal protein L36                          105   1e-25   
emb|CEG63318.1|  Putative 60S ribosomal protein L36                     105   1e-25   
gb|ACN09999.1|  60S ribosomal protein L36                               107   1e-25   
gb|KFH65383.1|  50S ribosomal protein L36e                              105   2e-25   
ref|XP_011151943.1|  PREDICTED: 60S ribosomal protein L36-like          105   2e-25   
ref|NP_989471.1|  60S ribosomal protein L36                             105   2e-25   
ref|XP_005541293.1|  PREDICTED: 60S ribosomal protein L36-like          105   2e-25   
ref|XP_007337923.1|  ribosomal protein L36e                             105   2e-25   
gb|KFH65734.1|  50S ribosomal protein L36e                              105   2e-25   
dbj|BAN20532.1|  ribosomal protein L36                                  105   2e-25   
emb|CDQ84056.1|  unnamed protein product                                106   2e-25   
ref|XP_004712351.1|  PREDICTED: 60S ribosomal protein L36-like          105   2e-25   
gb|EKC40124.1|  60S ribosomal protein L36                               105   2e-25   
emb|CEI85672.1|  Putative 60S ribosomal protein L36                     105   2e-25   
ref|XP_003833584.1|  similar to 60S ribosomal protein L36               105   2e-25   
ref|XP_006262192.1|  PREDICTED: 60S ribosomal protein L36               105   2e-25   
ref|XP_006084456.1|  PREDICTED: 60S ribosomal protein L36-like          105   2e-25   
gb|ABW23190.1|  ribosomal protein rpl36                                 104   3e-25   
ref|XP_006436008.1|  hypothetical protein CICLE_v10033343mg             104   3e-25   
ref|XP_007744821.1|  60S ribosomal protein L36                          105   3e-25   
ref|XP_005962232.1|  PREDICTED: 60S ribosomal protein L36               104   3e-25   
ref|XP_005908765.1|  PREDICTED: 60S ribosomal protein L36-like          104   3e-25   
ref|XP_004709931.1|  PREDICTED: 60S ribosomal protein L36-like          104   3e-25   
ref|XP_006894244.1|  PREDICTED: uncharacterized protein LOC102862726    108   3e-25   
ref|NP_998117.1|  60S ribosomal protein L36                             104   3e-25   
gb|KDR23957.1|  60S ribosomal protein L36                               105   4e-25   
gb|KDE02275.1|  50S ribosomal protein L36e                              104   4e-25   
ref|XP_001117613.1|  PREDICTED: 60S ribosomal protein L36-like          104   4e-25   
ref|XP_011434000.1|  PREDICTED: 60S ribosomal protein L36-like          105   4e-25   
ref|XP_008202305.1|  PREDICTED: 60S ribosomal protein L36 isoform X2    105   4e-25   
emb|CDJ82309.1|  Ribosomal protein L36e domain containing protein       104   4e-25   
ref|XP_003388843.1|  PREDICTED: 60S ribosomal protein L36-like          104   4e-25   
ref|XP_006834113.1|  PREDICTED: 60S ribosomal protein L36-like          104   5e-25   
emb|CDI76099.1|  60S Ribosomal protein L36, putative                    104   5e-25   
ref|XP_005343467.1|  PREDICTED: 60S ribosomal protein L36-like          104   6e-25   
gb|ETN64210.1|  60S ribosomal protein L36                               104   6e-25   
ref|XP_005343707.1|  PREDICTED: 60S ribosomal protein L36-like          104   6e-25   
ref|XP_004402318.1|  PREDICTED: 60S ribosomal protein L36-like          104   6e-25   
ref|XP_004989925.1|  ribosomal protein rpl36                            104   6e-25   
ref|XP_001606808.2|  PREDICTED: 60S ribosomal protein L36 isoform X1    105   6e-25   
ref|XP_007169198.1|  PREDICTED: 60S ribosomal protein L36 isoform X1    103   7e-25   
ref|XP_972007.1|  PREDICTED: 60S ribosomal protein L36                  104   7e-25   
ref|XP_011504541.1|  PREDICTED: 60S ribosomal protein L36               104   7e-25   
ref|XP_007753968.1|  60S ribosomal protein L36                          103   7e-25   
ref|XP_628006.1|  60S ribosomal protein L36                             103   8e-25   
emb|CDH55803.1|  60s ribosomal protein l36                              103   9e-25   
ref|XP_005764067.1|  hypothetical protein EMIHUDRAFT_59540              102   1e-24   
ref|XP_003792708.1|  PREDICTED: 60S ribosomal protein L36-like          103   1e-24   
ref|XP_011386667.1|  ribosomal 60S subunit protein L36                  103   1e-24   
emb|CDJ29454.1|  60S Ribosomal protein L36, putative                    103   1e-24   
gb|EDL04149.1|  mCG1027530                                              103   1e-24   
tpg|DAA33264.1|  TPA: ribosomal protein L36-like                        103   1e-24   
ref|XP_007681341.1|  hypothetical protein BAUCODRAFT_28424              103   1e-24   
emb|CAJ17424.1|  ribosomal protein L36e                                 103   1e-24   
gb|KIW71958.1|  60S ribosomal protein L36                               103   1e-24   
ref|XP_003493694.1|  PREDICTED: 60S ribosomal protein L36-like is...    103   1e-24   
sp|P47964.2|RL36_MOUSE  RecName: Full=60S ribosomal protein L36         103   2e-24   
emb|CDW61161.1|  Ribosomal L36e domain containing protein               102   2e-24   
ref|XP_011055063.1|  PREDICTED: 60S ribosomal protein L36               103   2e-24   
emb|CDI51357.1|  probable 60S ribosomal protein L36                     103   2e-24   
ref|XP_003307107.1|  60S ribosomal protein L36                          103   2e-24   
ref|XP_008552866.1|  PREDICTED: 60S ribosomal protein L36               103   2e-24   
emb|CEG65205.1|  Putative 60S ribosomal protein L36                     102   2e-24   
ref|NP_001187059.1|  60S ribosomal protein L36                          102   2e-24   
gb|KIJ56894.1|  hypothetical protein M422DRAFT_218685                   102   2e-24   
ref|XP_002167832.1|  PREDICTED: 60S ribosomal protein L36-like is...    102   2e-24   
gb|KIW26184.1|  60S ribosomal protein L36                               102   2e-24   
ref|XP_007415443.1|  hypothetical protein MELLADRAFT_50142              102   2e-24   
emb|CAR94544.1|  ribosomal protein L36e                                 102   3e-24   
ref|XP_005560413.1|  PREDICTED: 60S ribosomal protein L36-like          102   3e-24   
ref|XP_006177621.1|  PREDICTED: 60S ribosomal protein L36               102   3e-24   
ref|XP_003701329.1|  PREDICTED: 60S ribosomal protein L36-like is...    102   3e-24   
gb|EHH50543.1|  hypothetical protein EGM_01395                          111   3e-24   
ref|XP_001894797.1|  60S ribosomal protein L36                          102   4e-24   
ref|XP_002366517.1|  60s ribosomal protein L36, putative                102   4e-24   
gb|EJW79971.1|  50S ribosomal protein L36e                              102   4e-24   
gb|KIX97684.1|  60S ribosomal protein L36                               102   4e-24   
gb|KIP10734.1|  hypothetical protein PHLGIDRAFT_100899                  102   4e-24   
gb|ABP52060.1|  ribosomal protein L36                                   102   4e-24   
ref|XP_008031535.1|  hypothetical protein SETTUDRAFT_166386             102   4e-24   
gb|KDN41062.1|  putative 60S ribosomal protein L36                      102   4e-24   
gb|EGU89217.1|  hypothetical protein FOXB_00170                         102   4e-24   
ref|XP_006191727.1|  PREDICTED: 60S ribosomal protein L36-like          102   4e-24   
ref|XP_003701328.1|  PREDICTED: 60S ribosomal protein L36-like is...    102   4e-24   
ref|XP_003263716.1|  PREDICTED: 60S ribosomal protein L36-like is...    102   5e-24   
gb|EWG38004.1|  60S ribosomal protein L36                               101   5e-24   
ref|XP_006612016.1|  PREDICTED: 60S ribosomal protein L36-like is...    102   5e-24   
gb|EYC40611.1|  hypothetical protein Y032_0604g547                      101   5e-24   
ref|XP_006888205.1|  PREDICTED: 60S ribosomal protein L36-like          102   5e-24   
gb|AAX62448.1|  ribosomal protein L36                                   102   5e-24   
ref|XP_004578381.1|  PREDICTED: 60S ribosomal protein L36-1-like        104   6e-24   
ref|XP_001939089.1|  60S ribosomal protein L36                          101   6e-24   
gb|EHH15550.1|  hypothetical protein EGK_01659                          110   6e-24   
gb|EHB03597.1|  60S ribosomal protein L36                               101   6e-24   
ref|XP_010996646.1|  PREDICTED: 60S ribosomal protein L36               101   6e-24   
ref|XP_311984.4|  AGAP002921-PA                                         101   6e-24   
ref|XP_003493693.1|  PREDICTED: 60S ribosomal protein L36-like is...    101   7e-24   
emb|CCF41582.1|  60S ribosomal protein L36                              101   7e-24   
emb|CCJ28255.1|  unnamed protein product                                101   7e-24   
emb|CAJ17425.1|  ribosomal protein L36e                                 101   7e-24   
ref|XP_006567037.1|  PREDICTED: 60S ribosomal protein L36 isoform X1    101   7e-24   
emb|CCF54174.1|  probable 60S ribosomal protein L36                     101   7e-24   
emb|CAF96620.1|  unnamed protein product                                102   7e-24   
ref|XP_003737729.1|  PREDICTED: 60S ribosomal protein L36-like          101   7e-24   
ref|XP_001647928.1|  AAEL000010-PB                                      101   8e-24   
ref|XP_003399707.1|  PREDICTED: 60S ribosomal protein L36-like          101   8e-24   
ref|XP_007692313.1|  hypothetical protein COCMIDRAFT_106853             101   8e-24   
gb|KIW83084.1|  60S ribosomal protein L36                               101   9e-24   
gb|EQL02010.1|  Ribosomal protein L36e                                  101   9e-24   
ref|XP_003139703.1|  ribosomal protein L36                              100   9e-24   
ref|XP_004625518.1|  PREDICTED: 60S ribosomal protein L36-like          102   9e-24   
gb|EQB52081.1|  hypothetical protein CGLO_08318                         100   9e-24   
gb|EGT53191.1|  CBN-RPL-36 protein                                      100   1e-23   
gb|KEQ85116.1|  ribosomal protein L36e                                  100   1e-23   
gb|ACY71286.1|  ribosomal protein L36                                   100   1e-23   
ref|XP_005821560.1|  large subunit ribosomal protein L36e, cytopl...    100   1e-23   
ref|XP_008772721.1|  PREDICTED: 60S ribosomal protein L36-like          100   1e-23   
dbj|GAC73657.1|  hypothetical protein PANT_9d00203                      100   1e-23   
gb|ELU13360.1|  hypothetical protein CAPTEDRAFT_148399                  100   1e-23   
gb|AGE89256.1|  ribosomal protein L36e                                  100   1e-23   
ref|XP_003851215.1|  60S ribosomal protein L36                          100   1e-23   
gb|KEQ93366.1|  hypothetical protein AUEXF2481DRAFT_42094               100   1e-23   
gb|EEQ88635.1|  60S ribosomal protein L36                               100   2e-23   
ref|XP_001239913.1|  60S ribosomal protein L36                          100   2e-23   
ref|XP_004630470.1|  PREDICTED: 60S ribosomal protein L36-like          100   2e-23   
ref|XP_008601352.1|  60S ribosomal protein                              100   2e-23   
gb|EME39696.1|  hypothetical protein DOTSEDRAFT_75371                   100   2e-23   
emb|CAJ17423.1|  ribosomal protein L36e                                 100   2e-23   
ref|XP_007217200.1|  hypothetical protein PRUPE_ppa014238mg           99.4    2e-23   
dbj|GAK62240.1|  60S ribosomal protein L36                              103   2e-23   
ref|XP_002634549.1|  C. briggsae CBR-RPL-36 protein                     100   2e-23   
emb|CAJ17426.1|  ribosomal protein L36e                                 100   2e-23   
ref|XP_007278050.1|  60s ribosomal protein l36                          100   2e-23   
tpe|CAL69085.1|  TPA: putative 60S ribosomal protein L36 isoform 2      100   2e-23   
ref|XP_003003527.1|  60S ribosomal protein L36                          100   2e-23   
gb|EFQ29357.1|  ribosomal protein L36e                                  100   2e-23   
gb|KIW42774.1|  60S ribosomal protein L36                               100   2e-23   
ref|XP_003695268.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    100   2e-23   
gb|ETN78462.1|  ribosomal protein L36e                                  105   3e-23   
gb|EMF10130.1|  60S ribosomal protein L36                             99.8    3e-23   
ref|XP_008875839.1|  hypothetical protein H310_11067                  99.8    3e-23   
gb|KHJ76047.1|  ribosomal protein L36e                                99.8    3e-23   
ref|XP_004642109.1|  PREDICTED: 60S ribosomal protein L36-like        99.8    3e-23   
gb|AAP80812.1|  putative 60S ribosomal protein L36                    99.4    3e-23   
gb|ESZ95354.1|  60S ribosomal protein L36                             99.8    3e-23   
gb|AEE61429.1|  unknown                                               99.8    4e-23   
ref|NP_498573.2|  Protein RPL-36                                      99.4    4e-23   
ref|XP_004284753.1|  PREDICTED: 60S ribosomal protein L36-like        99.4    4e-23   
ref|XP_008469259.1|  PREDICTED: 60S ribosomal protein L36-like        99.8    4e-23   
gb|ADT80680.1|  ribosomal protein L36                                   100   4e-23   



>ref|XP_010671859.1| PREDICTED: 60S ribosomal protein L36-2-like [Beta vulgaris subsp. 
vulgaris]
Length=110

 Score =   201 bits (512),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLNRGH+VTKKELAPRPSDRKGKTSKR++FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLFVGLNRGHIVTKKELAPRPSDRKGKTSKRVHFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALK+AKRKLGTHKRAKRKREEMS VLRKMR+ GGGDKKK
Sbjct  61   TELLKVGKDKRALKLAKRKLGTHKRAKRKREEMSNVLRKMRSAGGGDKKK  110



>ref|XP_006339562.1| PREDICTED: 60S ribosomal protein L36-2-like [Solanum tuberosum]
Length=110

 Score =   201 bits (510),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/110 (93%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GL VGLN+GHVVTKKELAPRPSDRKGKTSKRI+FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLSVGLNKGHVVTKKELAPRPSDRKGKTSKRIHFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMRATGGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRATGGGEKKK  110



>ref|XP_002317423.1| hypothetical protein POPTR_0011s07390g [Populus trichocarpa]
 gb|EEE98035.1| hypothetical protein POPTR_0011s07390g [Populus trichocarpa]
Length=110

 Score =   201 bits (510),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLN+GH+VTKKELAPRPSDRKGKTSKR+ FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGKTSKRVQFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMRA GGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSNVLRKMRAAGGGEKKK  110



>ref|XP_004240729.1| PREDICTED: 60S ribosomal protein L36-2 [Solanum lycopersicum]
Length=110

 Score =   200 bits (508),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+G+ VGLN+GHVVTKKELAPRPSDRKGKTSKRI+FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGISVGLNKGHVVTKKELAPRPSDRKGKTSKRIHFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMRATGGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRATGGGEKKK  110



>ref|XP_004229955.1| PREDICTED: 60S ribosomal protein L36-2 [Solanum lycopersicum]
Length=110

 Score =   199 bits (507),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GL VGLN+GHVVTKKELAPRPSDRKGKTSKRI+FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLSVGLNKGHVVTKKELAPRPSDRKGKTSKRIHFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRATGGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRATGGGEKKK  110



>ref|XP_010108352.1| 60S ribosomal protein L36-2 [Morus notabilis]
 gb|EXC19143.1| 60S ribosomal protein L36-2 [Morus notabilis]
Length=110

 Score =   199 bits (506),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLN+GHVVTKKELAPRPSDRKGKTSKR++FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLFVGLNKGHVVTKKELAPRPSDRKGKTSKRVHFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA GGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRAGGGGEKKK  110



>ref|XP_009627970.1| PREDICTED: 60S ribosomal protein L36-2-like [Nicotiana tomentosiformis]
 ref|XP_009627977.1| PREDICTED: 60S ribosomal protein L36-2-like [Nicotiana tomentosiformis]
 ref|XP_009767770.1| PREDICTED: 60S ribosomal protein L36-2-like [Nicotiana sylvestris]
 ref|XP_009767778.1| PREDICTED: 60S ribosomal protein L36-2-like [Nicotiana sylvestris]
Length=110

 Score =   199 bits (505),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GL VGLN+GHVVTKKELAPRPSDRKGKTSKR++FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLSVGLNKGHVVTKKELAPRPSDRKGKTSKRVHFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRATGGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRATGGGEKKK  110



>ref|XP_011045936.1| PREDICTED: 60S ribosomal protein L36-2-like isoform X2 [Populus 
euphratica]
Length=110

 Score =   199 bits (505),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLN+GH+VTKKELAPRPSDRKGK SKR+ FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGKASKRVQFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMRA GGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSNVLRKMRAAGGGEKKK  110



>ref|XP_011045934.1| PREDICTED: 60S ribosomal protein L36-2-like isoform X1 [Populus 
euphratica]
Length=117

 Score =   199 bits (505),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/111 (89%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = -3

Query  511  GMAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKR  332
             MAPKQ N+GLFVGLN+GH+VTKKELAPRPSDRKGK SKR+ FV+SLIREVAGFAPYEKR
Sbjct  7    AMAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGKASKRVQFVRSLIREVAGFAPYEKR  66

Query  331  ITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            ITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMRA GGG+KKK
Sbjct  67   ITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSNVLRKMRAAGGGEKKK  117



>ref|XP_007051817.1| 60S ribosomal protein L36 isoform 1 [Theobroma cacao]
 gb|EOX95974.1| 60S ribosomal protein L36 isoform 1 [Theobroma cacao]
Length=110

 Score =   199 bits (505),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLN+GHVVTKKELAPRPSDRKGKTSKR++FVKSLIREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLFVGLNKGHVVTKKELAPRPSDRKGKTSKRVHFVKSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ GG +KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRSAGGAEKKK  110



>gb|AFK38454.1| unknown [Lotus japonicus]
Length=110

 Score =   198 bits (503),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ ++GLFVGLN+GHVVTKKELAPRPSDRKGKTSKR++FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPSTGLFVGLNKGHVVTKKELAPRPSDRKGKTSKRVHFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMRA G GDKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSNVLRKMRAGGAGDKKK  110



>emb|CDP08821.1| unnamed protein product [Coffea canephora]
Length=110

 Score =   197 bits (502),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLNRGHVVTKKELAPRPSDRKGKTSKR++FV+SLIREVAG APYEKRI
Sbjct  1    MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRVHFVRSLIREVAGLAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS V+RKMRA GGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVVRKMRAAGGGEKKK  110



>ref|XP_010696542.1| PREDICTED: 60S ribosomal protein L36-2-like [Beta vulgaris subsp. 
vulgaris]
Length=110

 Score =   197 bits (502),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLNRGH+VTKKELAPRPSDRKGKTSKR++FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLFVGLNRGHIVTKKELAPRPSDRKGKTSKRVHFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALK+AKRKLGTHKRAKRKREEMS VLRKMR+ GG +KKK
Sbjct  61   TELLKVGKDKRALKLAKRKLGTHKRAKRKREEMSTVLRKMRSAGGAEKKK  110



>ref|NP_001275159.1| 60S ribosomal protein L36-2-like [Solanum tuberosum]
 gb|AFX67004.1| ribosomal protein L36 [Solanum tuberosum]
Length=110

 Score =   197 bits (502),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GL VGLN+GHVVTKKELAPRPSDRKGKTSKRI+FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLSVGLNKGHVVTKKELAPRPSDRKGKTSKRIHFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREE+S VLRKMRATGGG+K+K
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEISSVLRKMRATGGGEKEK  110



>ref|XP_010060856.1| PREDICTED: 60S ribosomal protein L36-2-like [Eucalyptus grandis]
Length=110

 Score =   197 bits (501),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 108/110 (98%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ ++GLFVGLN+GH+VTKKELAPRPSDRKGK+SKR++FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPSTGLFVGLNKGHIVTKKELAPRPSDRKGKSSKRVHFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+TGGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRSTGGGEKKK  110



>ref|XP_002318214.1| hypothetical protein POPTR_0012s13060g [Populus trichocarpa]
 ref|XP_011030131.1| PREDICTED: 60S ribosomal protein L36-2-like [Populus euphratica]
 gb|ABK94253.1| unknown [Populus trichocarpa]
 gb|EEE96434.1| hypothetical protein POPTR_0012s13060g [Populus trichocarpa]
Length=110

 Score =   197 bits (500),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLN+GHVVTKK+LAPRPSDRKGK+SKR+ FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLFVGLNKGHVVTKKDLAPRPSDRKGKSSKRVLFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMRA GGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSNVLRKMRAAGGGEKKK  110



>emb|CDP05183.1| unnamed protein product [Coffea canephora]
Length=110

 Score =   196 bits (499),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLNRGHVVTKKELAPRPSDRKGKTSKR++FV++LIREVAG APYEKRI
Sbjct  1    MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRVHFVRNLIREVAGLAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS V+RKMRA GGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVVRKMRAAGGGEKKK  110



>ref|XP_010035150.1| PREDICTED: 60S ribosomal protein L36-2-like [Eucalyptus grandis]
 gb|KCW46445.1| hypothetical protein EUGRSUZ_K00276 [Eucalyptus grandis]
Length=110

 Score =   196 bits (499),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ ++GLFVGLN+GH+VTKKELAPRPSDRKGKTSKR++FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPSTGLFVGLNKGHIVTKKELAPRPSDRKGKTSKRVHFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ GGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRSAGGGEKKK  110



>gb|KCW90685.1| hypothetical protein EUGRSUZ_A02774 [Eucalyptus grandis]
Length=150

 Score =   197 bits (502),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 108/110 (98%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ ++GLFVGLN+GH+VTKKELAPRPSDRKGK+SKR++FV+SLIREVAGFAPYEKRI
Sbjct  41   MAPKQPSTGLFVGLNKGHIVTKKELAPRPSDRKGKSSKRVHFVRSLIREVAGFAPYEKRI  100

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+TGGG+KKK
Sbjct  101  TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRSTGGGEKKK  150



>gb|KCW90686.1| hypothetical protein EUGRSUZ_A02774 [Eucalyptus grandis]
Length=149

 Score =   197 bits (502),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 108/110 (98%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ ++GLFVGLN+GH+VTKKELAPRPSDRKGK+SKR++FV+SLIREVAGFAPYEKRI
Sbjct  40   MAPKQPSTGLFVGLNKGHIVTKKELAPRPSDRKGKSSKRVHFVRSLIREVAGFAPYEKRI  99

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+TGGG+KKK
Sbjct  100  TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRSTGGGEKKK  149



>ref|XP_002305746.1| 60S ribosomal protein L36-3 [Populus trichocarpa]
 gb|ABK94139.1| unknown [Populus trichocarpa]
 gb|ABK95527.1| unknown [Populus trichocarpa]
 gb|EEE86257.1| 60S ribosomal protein L36-3 [Populus trichocarpa]
Length=110

 Score =   196 bits (498),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLN+GH+VTKKELAPRPSDRKGKTSKR+ FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGKTSKRVLFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA GG +KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRAAGGAEKKK  110



>ref|XP_004496553.1| PREDICTED: 60S ribosomal protein L36-2-like [Cicer arietinum]
 ref|XP_004499956.1| PREDICTED: 60S ribosomal protein L36-2-like [Cicer arietinum]
 ref|XP_004508599.1| PREDICTED: 60S ribosomal protein L36-2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004508600.1| PREDICTED: 60S ribosomal protein L36-2-like isoform X2 [Cicer 
arietinum]
 ref|XP_004510961.1| PREDICTED: 60S ribosomal protein L36-3-like isoform X2 [Cicer 
arietinum]
Length=110

 Score =   195 bits (496),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ ++GLFVGLN+GHVVTKKELAPRPSDRKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPKQPSTGLFVGLNKGHVVTKKELAPRPSDRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA G GDKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRAGGAGDKKK  110



>ref|XP_011093140.1| PREDICTED: 60S ribosomal protein L36-2-like [Sesamum indicum]
Length=110

 Score =   195 bits (496),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP+Q NSGLFVGLN+GH+ TKKELAPRPSDRKGKTSKR++F +SLIREVAGFAPYEKRI
Sbjct  1    MAPQQPNSGLFVGLNKGHITTKKELAPRPSDRKGKTSKRVHFARSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEM+  LRKMRA GGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMASALRKMRAAGGGEKKK  110



>ref|XP_009614811.1| PREDICTED: 60S ribosomal protein L36-2-like [Nicotiana tomentosiformis]
Length=110

 Score =   195 bits (495),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GL VGLN+GHVVTKKELAPRPSDRKGKTSKR++FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLSVGLNKGHVVTKKELAPRPSDRKGKTSKRVHFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS  LRKMRA GGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNALRKMRAAGGGEKKK  110



>gb|AFK43005.1| unknown [Lotus japonicus]
Length=111

 Score =   194 bits (494),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/111 (90%), Positives = 107/111 (96%), Gaps = 1/111 (1%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ ++GLFVGLN+GHVVTKKELAPRPSDRKGKTSKR++FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPSTGLFVGLNKGHVVTKKELAPRPSDRKGKTSKRVHFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGG-GDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMR+ GG GDKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSNVLRKMRSGGGAGDKKK  111



>ref|XP_002322479.1| hypothetical protein POPTR_0015s12960g [Populus trichocarpa]
 ref|XP_011048749.1| PREDICTED: 60S ribosomal protein L36-2-like [Populus euphratica]
 gb|ABK93038.1| unknown [Populus trichocarpa]
 gb|ABK94316.1| unknown [Populus trichocarpa]
 gb|EEF06606.1| hypothetical protein POPTR_0015s12960g [Populus trichocarpa]
Length=110

 Score =   194 bits (494),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLN+GHVVTKK+LAPRPSDRKGK+SKR+ FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLFVGLNKGHVVTKKDLAPRPSDRKGKSSKRVLFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ GGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRSAGGGEKKK  110



>ref|XP_011076152.1| PREDICTED: 60S ribosomal protein L36-2-like [Sesamum indicum]
 ref|XP_011076153.1| PREDICTED: 60S ribosomal protein L36-2-like [Sesamum indicum]
Length=110

 Score =   194 bits (494),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ NSGLFVGL +GHVVT KELAPRP+DRKGKTSKR++F +SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPNSGLFVGLKKGHVVTPKELAPRPADRKGKTSKRVHFARSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEM+G LRKMRA GGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMAGALRKMRAAGGGEKKK  110



>ref|XP_009772617.1| PREDICTED: 60S ribosomal protein L36-2-like [Nicotiana sylvestris]
Length=110

 Score =   194 bits (493),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GL VGLN+GHVVTKKELAPRPSDRKGKTSKR++FV+ LIREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLSVGLNKGHVVTKKELAPRPSDRKGKTSKRVHFVRGLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA GGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRAAGGGEKKK  110



>gb|EYU25104.1| hypothetical protein MIMGU_mgv1a016711mg [Erythranthe guttata]
 gb|EYU25105.1| hypothetical protein MIMGU_mgv1a016711mg [Erythranthe guttata]
Length=110

 Score =   194 bits (493),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ NSGL VGL +GH+VT KELAPRPSDRKGKTSKR++FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPNSGLSVGLKKGHIVTPKELAPRPSDRKGKTSKRVHFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSG LRKMRA GGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGALRKMRAAGGGEKKK  110



>ref|XP_011008474.1| PREDICTED: 60S ribosomal protein L36-2-like isoform X2 [Populus 
euphratica]
Length=110

 Score =   194 bits (493),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLN+GH+VTKKELAPRPSDRKGK SKR+ FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGKASKRVLFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA GG +KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRAAGGAEKKK  110



>gb|KJB52776.1| hypothetical protein B456_008G276200 [Gossypium raimondii]
Length=147

 Score =   195 bits (496),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  520  IERGMAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPY  341
            +  GMA KQ N+GLFVGLN+GHVVTKKELAPRPS+RKGKTSKR++FV++LIREVAGFAPY
Sbjct  33   VSTGMATKQPNTGLFVGLNKGHVVTKKELAPRPSNRKGKTSKRVHFVRNLIREVAGFAPY  92

Query  340  EKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            EKRITELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA GGG +KK
Sbjct  93   EKRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRAHGGGAEKK  146



>ref|XP_010255374.1| PREDICTED: 60S ribosomal protein L36-2-like [Nelumbo nucifera]
 ref|XP_010255375.1| PREDICTED: 60S ribosomal protein L36-2-like [Nelumbo nucifera]
Length=110

 Score =   194 bits (492),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP+Q  SGLFVGLN+GH VTKKELAPRPSDRKGKTSKR++FVKSLIREVAGFAPYEKRI
Sbjct  1    MAPQQPKSGLFVGLNKGHTVTKKELAPRPSDRKGKTSKRVHFVKSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAK+KLGTHKRAK+KREEMS VLRKMR+ G GDKKK
Sbjct  61   TELLKVGKDKRALKVAKKKLGTHKRAKKKREEMSSVLRKMRSAGVGDKKK  110



>ref|XP_004140771.1| PREDICTED: 60S ribosomal protein L36-2-like [Cucumis sativus]
 ref|XP_004152381.1| PREDICTED: 60S ribosomal protein L36-2-like [Cucumis sativus]
 ref|XP_004166235.1| PREDICTED: 60S ribosomal protein L36-2-like [Cucumis sativus]
 ref|XP_004171084.1| PREDICTED: 60S ribosomal protein L36-2-like [Cucumis sativus]
 ref|XP_008436991.1| PREDICTED: 60S ribosomal protein L36-2-like [Cucumis melo]
 ref|XP_008439254.1| PREDICTED: 60S ribosomal protein L36-2-like [Cucumis melo]
 gb|ADN34294.1| 60S ribosomal protein l36e [Cucumis melo subsp. melo]
 gb|KGN50297.1| hypothetical protein Csa_5G166410 [Cucumis sativus]
 gb|KGN57388.1| hypothetical protein Csa_3G182240 [Cucumis sativus]
Length=110

 Score =   194 bits (492),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLN+GH+VTKKELAPRPSDRKGK+SKR+ FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGKSSKRVLFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA GG +KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRAGGGAEKKK  110



>gb|KDP28634.1| hypothetical protein JCGZ_14405 [Jatropha curcas]
Length=110

 Score =   194 bits (492),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLN+GHVVTKKELAPRPSDRKG+TSKR++FV+S+IREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLFVGLNKGHVVTKKELAPRPSDRKGRTSKRVSFVRSIIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA G  +KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRAGGAAEKKK  110



>ref|XP_010108357.1| 60S ribosomal protein L36-2 [Morus notabilis]
 gb|EXC19148.1| 60S ribosomal protein L36-2 [Morus notabilis]
Length=178

 Score =   196 bits (498),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLN+GHVVTKKELAP+PSDRKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  69   MAPKQPNTGLFVGLNKGHVVTKKELAPKPSDRKGKTSKRVHFVRNLIREVAGFAPYEKRI  128

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+ VLRKMRA GGG+KKK
Sbjct  129  TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMANVLRKMRAGGGGEKKK  178



>gb|KJB52777.1| hypothetical protein B456_008G276200 [Gossypium raimondii]
Length=148

 Score =   194 bits (494),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = -3

Query  511  GMAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKR  332
            GMA KQ N+GLFVGLN+GHVVTKKELAPRPS+RKGKTSKR++FV++LIREVAGFAPYEKR
Sbjct  37   GMATKQPNTGLFVGLNKGHVVTKKELAPRPSNRKGKTSKRVHFVRNLIREVAGFAPYEKR  96

Query  331  ITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            ITELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA GGG +KK
Sbjct  97   ITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRAHGGGAEKK  147



>ref|XP_006445050.1| hypothetical protein CICLE_v10022961mg [Citrus clementina]
 ref|XP_006445051.1| hypothetical protein CICLE_v10022961mg [Citrus clementina]
 ref|XP_006445052.1| hypothetical protein CICLE_v10022961mg [Citrus clementina]
 ref|XP_006445053.1| hypothetical protein CICLE_v10022961mg [Citrus clementina]
 ref|XP_006445054.1| hypothetical protein CICLE_v10022961mg [Citrus clementina]
 ref|XP_006491089.1| PREDICTED: 60S ribosomal protein L36-3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006491090.1| PREDICTED: 60S ribosomal protein L36-3-like isoform X2 [Citrus 
sinensis]
 gb|ESR58290.1| hypothetical protein CICLE_v10022961mg [Citrus clementina]
 gb|ESR58291.1| hypothetical protein CICLE_v10022961mg [Citrus clementina]
 gb|ESR58292.1| hypothetical protein CICLE_v10022961mg [Citrus clementina]
 gb|ESR58293.1| hypothetical protein CICLE_v10022961mg [Citrus clementina]
 gb|ESR58294.1| hypothetical protein CICLE_v10022961mg [Citrus clementina]
 gb|KDO86145.1| hypothetical protein CISIN_1g033850mg [Citrus sinensis]
 gb|KDO86146.1| hypothetical protein CISIN_1g033850mg [Citrus sinensis]
 gb|KDO86147.1| hypothetical protein CISIN_1g033850mg [Citrus sinensis]
 gb|KDO86148.1| hypothetical protein CISIN_1g033850mg [Citrus sinensis]
Length=110

 Score =   192 bits (488),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLN+GHVVTKKEL PRPSDRKGKTSKR++FVK+LIREVAGFAPYE+RI
Sbjct  1    MAPKQPNTGLFVGLNKGHVVTKKELPPRPSDRKGKTSKRVHFVKNLIREVAGFAPYERRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS  LRKMR+ GG +KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNALRKMRSAGGAEKKK  110



>ref|XP_011084426.1| PREDICTED: 60S ribosomal protein L36-2-like [Sesamum indicum]
Length=110

 Score =   192 bits (487),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ NSGLFVGL +GHVVT KELAPRPSDRKGKTSKR++F +SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPNSGLFVGLKKGHVVTPKELAPRPSDRKGKTSKRVHFARSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+  LRKMRA GGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMASALRKMRAAGGGEKKK  110



>gb|EYU19556.1| hypothetical protein MIMGU_mgv1a016705mg [Erythranthe guttata]
 gb|EYU19557.1| hypothetical protein MIMGU_mgv1a016705mg [Erythranthe guttata]
Length=110

 Score =   191 bits (486),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ NSG+ VGL +GH+VT KELAPRPSDRKGKTSKR++FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPNSGISVGLKKGHIVTPKELAPRPSDRKGKTSKRVHFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSG LRKMRA GG +KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGALRKMRAAGGAEKKK  110



>ref|XP_003555154.1| PREDICTED: 60S ribosomal protein L36-3 [Glycine max]
 gb|KHN07524.1| 60S ribosomal protein L36-3 [Glycine soja]
Length=110

 Score =   191 bits (486),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPK  ++GLFVGLN+GHVVTKKEL PRPSDRKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPKHPSTGLFVGLNKGHVVTKKELPPRPSDRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA G GDKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRAGGAGDKKK  110



>ref|XP_002268754.1| PREDICTED: 60S ribosomal protein L36-3 [Vitis vinifera]
 ref|XP_010662724.1| PREDICTED: 60S ribosomal protein L36-3 [Vitis vinifera]
 ref|XP_010662725.1| PREDICTED: 60S ribosomal protein L36-3 [Vitis vinifera]
 emb|CBI22706.3| unnamed protein product [Vitis vinifera]
Length=110

 Score =   191 bits (484),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLN+GH+VTKKEL PRPSDRKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLFVGLNKGHIVTKKELPPRPSDRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ G G+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRSGGVGEKKK  110



>ref|XP_003556112.1| PREDICTED: 60S ribosomal protein L36-3-like isoform 1 [Glycine 
max]
 ref|XP_006606127.1| PREDICTED: 60S ribosomal protein L36-3-like [Glycine max]
 gb|ACU23270.1| unknown [Glycine max]
 gb|KHN12146.1| 60S ribosomal protein L36-3 [Glycine soja]
Length=110

 Score =   191 bits (484),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPK  ++GLFVGLN+GHVVTKKEL PRPSDRKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPKPPSTGLFVGLNKGHVVTKKELPPRPSDRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA G GDKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRAGGAGDKKK  110



>gb|KJB52778.1| hypothetical protein B456_008G276200 [Gossypium raimondii]
 gb|KJB52779.1| hypothetical protein B456_008G276200 [Gossypium raimondii]
Length=111

 Score =   191 bits (484),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MA KQ N+GLFVGLN+GHVVTKKELAPRPS+RKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MATKQPNTGLFVGLNKGHVVTKKELAPRPSNRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA GGG +KK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRAHGGGAEKK  110



>ref|XP_003536462.1| PREDICTED: 60S ribosomal protein L36-3-like [Glycine max]
 ref|XP_007151653.1| hypothetical protein PHAVU_004G065100g [Phaseolus vulgaris]
 gb|ESW23647.1| hypothetical protein PHAVU_004G065100g [Phaseolus vulgaris]
 gb|KHN21759.1| 60S ribosomal protein L36-3 [Glycine soja]
Length=110

 Score =   190 bits (483),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPK  ++GLFVGLN+GHVVTKKEL PRPSDRKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPKPPSTGLFVGLNKGHVVTKKELPPRPSDRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA G GDKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRAGGAGDKKK  110



>ref|XP_002273507.1| PREDICTED: 60S ribosomal protein L36-3 [Vitis vinifera]
 emb|CAN64895.1| hypothetical protein VITISV_013224 [Vitis vinifera]
Length=110

 Score =   190 bits (483),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLN+GHVVTKKEL PRPSDRKGKTSKR++FV+++IREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLFVGLNKGHVVTKKELPPRPSDRKGKTSKRVHFVRNIIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ G G+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRSGGVGEKKK  110



>ref|XP_004234407.1| PREDICTED: 60S ribosomal protein L36-2 [Solanum lycopersicum]
Length=108

 Score =   190 bits (483),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 2/110 (2%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP   N+GL VGLN+GH+VTKKELAPRPSDRKGKTSKRI+FV+SLIREVAGFAPYEKRI
Sbjct  1    MAP--PNTGLAVGLNKGHIVTKKELAPRPSDRKGKTSKRIHFVRSLIREVAGFAPYEKRI  58

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRATGGG+KKK
Sbjct  59   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRATGGGEKKK  108



>ref|XP_007038724.1| 60S ribosomal protein L36 [Theobroma cacao]
 gb|EOY23225.1| 60S ribosomal protein L36 [Theobroma cacao]
Length=111

 Score =   190 bits (483),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 106/111 (95%), Gaps = 1/111 (1%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MA KQ NSGLFVGLN+GH+VTKKELAPRPS+RKGKTSKR++FVK+LIREVAGFAPYEKRI
Sbjct  1    MATKQPNSGLFVGLNKGHIVTKKELAPRPSNRKGKTSKRVHFVKNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRA-TGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA  GGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRAHPGGGEKKK  111



>ref|XP_007143433.1| hypothetical protein PHAVU_007G072100g [Phaseolus vulgaris]
 gb|ESW15427.1| hypothetical protein PHAVU_007G072100g [Phaseolus vulgaris]
Length=110

 Score =   190 bits (482),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPK  ++GLFVGLN+GH+VTKKEL PRPSDRKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPKPPSTGLFVGLNKGHIVTKKELPPRPSDRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA G GDKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRAGGAGDKKK  110



>gb|KJB34107.1| hypothetical protein B456_006G048500 [Gossypium raimondii]
 gb|KJB34109.1| hypothetical protein B456_006G048500 [Gossypium raimondii]
Length=112

 Score =   190 bits (482),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 106/112 (95%), Gaps = 2/112 (2%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MA KQ N+GLFVGLN+GHVVTKKELAPRPS+RKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MATKQPNTGLFVGLNKGHVVTKKELAPRPSNRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRA--TGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA   GGGDKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRAHHPGGGDKKK  112



>gb|KJB09831.1| hypothetical protein B456_001G169600 [Gossypium raimondii]
Length=110

 Score =   189 bits (481),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  +GL VGLN+GHVVTKKELAPRPS+RKGKTSKR++FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPSQPKTGLSVGLNKGHVVTKKELAPRPSNRKGKTSKRVHFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ GGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRSAGGGEKKK  110



>emb|CBI40362.3| unnamed protein product [Vitis vinifera]
Length=145

 Score =   191 bits (484),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLN+GHVVTKKEL PRPSDRKGKTSKR++FV+++IREVAGFAPYEKRI
Sbjct  36   MAPKQPNTGLFVGLNKGHVVTKKELPPRPSDRKGKTSKRVHFVRNIIREVAGFAPYEKRI  95

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ G G+KKK
Sbjct  96   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRSGGVGEKKK  145



>ref|XP_008234218.1| PREDICTED: 60S ribosomal protein L36-3-like [Prunus mume]
Length=111

 Score =   189 bits (481),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+G+FVGLN+GH+VT+KELAPRPSDRKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGIFVGLNKGHIVTRKELAPRPSDRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRK+RA GG  +KK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKIRAGGGASEKK  110



>ref|XP_006421951.1| hypothetical protein CICLE_v10006222mg [Citrus clementina]
 ref|XP_006421952.1| hypothetical protein CICLE_v10006222mg [Citrus clementina]
 ref|XP_006490416.1| PREDICTED: 60S ribosomal protein L36-2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006490417.1| PREDICTED: 60S ribosomal protein L36-2-like isoform X2 [Citrus 
sinensis]
 gb|ESR35191.1| hypothetical protein CICLE_v10006222mg [Citrus clementina]
 gb|ESR35192.1| hypothetical protein CICLE_v10006222mg [Citrus clementina]
 gb|KDO52004.1| hypothetical protein CISIN_1g033549mg [Citrus sinensis]
 gb|KDO52005.1| hypothetical protein CISIN_1g033549mg [Citrus sinensis]
Length=110

 Score =   189 bits (480),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLN+GH+VTKKEL PRP+DRKGKTSKR++FV+++IREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLFVGLNKGHIVTKKELPPRPADRKGKTSKRVHFVRTVIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS  LRK RA GGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNALRKSRAPGGGEKKK  110



>gb|KDO52003.1| hypothetical protein CISIN_1g033549mg [Citrus sinensis]
Length=117

 Score =   189 bits (480),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLN+GH+VTKKEL PRP+DRKGKTSKR++FV+++IREVAGFAPYEKRI
Sbjct  8    MAPKQPNTGLFVGLNKGHIVTKKELPPRPADRKGKTSKRVHFVRTVIREVAGFAPYEKRI  67

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS  LRK RA GGG+KKK
Sbjct  68   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNALRKSRAPGGGEKKK  117



>ref|XP_011101239.1| PREDICTED: 60S ribosomal protein L36-2-like [Sesamum indicum]
Length=110

 Score =   189 bits (480),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP+Q N GLFVGLN+GH+ TKKELAPRPSDRKGKTSKR++F +SLIREV GF+PYEKRI
Sbjct  1    MAPQQPNFGLFVGLNKGHITTKKELAPRPSDRKGKTSKRVHFARSLIREVVGFSPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEM+  LRKMRA GGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMASALRKMRAPGGGEKKK  110



>ref|XP_003592267.1| 60S ribosomal protein L36 [Medicago truncatula]
 gb|AES62518.1| 60S ribosomal protein L36 [Medicago truncatula]
 gb|AFK42137.1| unknown [Medicago truncatula]
Length=111

 Score =   189 bits (480),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 106/111 (95%), Gaps = 1/111 (1%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ ++GLFVGLN+GH+VTKKELAPRPS RKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPKQPSTGLFVGLNKGHIVTKKELAPRPSARKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGG-GDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA GG GDKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRAGGGAGDKKK  111



>ref|XP_007051818.1| Ribosomal protein L36e family protein isoform 2, partial [Theobroma 
cacao]
 gb|EOX95975.1| Ribosomal protein L36e family protein isoform 2, partial [Theobroma 
cacao]
Length=131

 Score =   189 bits (481),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 106/120 (88%), Gaps = 2/120 (2%)
 Frame = -3

Query  538  RPSQNQIERGMAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREV  359
            R S   +   MAPKQ N+GLFVGLN+GHVVTKKELAPRPSDRKGKTSKR++FVKSLIREV
Sbjct  14   RYSVGAVWLVMAPKQPNTGLFVGLNKGHVVTKKELAPRPSDRKGKTSKRVHFVKSLIREV  73

Query  358  AGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            AGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRK    GG +KKK
Sbjct  74   AGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRK--TAGGAEKKK  131



>ref|XP_003592268.1| 60S ribosomal protein L36 [Medicago truncatula]
Length=147

 Score =   190 bits (483),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 114/126 (90%), Gaps = 2/126 (2%)
 Frame = -3

Query  550  IARLRPSQNQIERG-MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKS  374
            ++ +R S+  +  G MAPKQ ++GLFVGLN+GH+VTKKELAPRPS RKGKTSKR++FV++
Sbjct  22   LSGVRVSEITVTTGEMAPKQPSTGLFVGLNKGHIVTKKELAPRPSARKGKTSKRVHFVRN  81

Query  373  LIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGG  194
            LIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA GG
Sbjct  82   LIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRAGGG  141

Query  193  -GDKKK  179
             GDKKK
Sbjct  142  AGDKKK  147



>ref|NP_001274874.1| 60S ribosomal protein L36-2-like [Solanum tuberosum]
 ref|XP_006353870.1| PREDICTED: 60S ribosomal protein L36-2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006353871.1| PREDICTED: 60S ribosomal protein L36-2-like isoform X2 [Solanum 
tuberosum]
 gb|AFW90553.1| ribosomal protein L36 [Solanum tuberosum]
Length=108

 Score =   188 bits (478),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 105/110 (95%), Gaps = 2/110 (2%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP   N+GL VGLN+GH+VTKKELAPRPSDRKGKTSKRI+FV++LIREVAGFAPYEKRI
Sbjct  1    MAP--PNTGLAVGLNKGHIVTKKELAPRPSDRKGKTSKRIHFVRNLIREVAGFAPYEKRI  58

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRATGGG+KKK
Sbjct  59   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRATGGGEKKK  108



>ref|XP_006421950.1| hypothetical protein CICLE_v10006222mg [Citrus clementina]
 gb|ESR35190.1| hypothetical protein CICLE_v10006222mg [Citrus clementina]
Length=124

 Score =   189 bits (480),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLN+GH+VTKKEL PRP+DRKGKTSKR++FV+++IREVAGFAPYEKRI
Sbjct  15   MAPKQPNTGLFVGLNKGHIVTKKELPPRPADRKGKTSKRVHFVRTVIREVAGFAPYEKRI  74

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS  LRK RA GGG+KKK
Sbjct  75   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNALRKSRAPGGGEKKK  124



>ref|XP_006349632.1| PREDICTED: 60S ribosomal protein L36-2-like [Solanum tuberosum]
Length=108

 Score =   188 bits (478),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 105/110 (95%), Gaps = 2/110 (2%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP   N+GL VGLN+GH+VTKKELAPRP DRKGKTSKRI+FV++LIREVAGFAPYEKRI
Sbjct  1    MAP--PNTGLAVGLNKGHIVTKKELAPRPYDRKGKTSKRIHFVRNLIREVAGFAPYEKRI  58

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMSGVLRKMRATGGG+KKK
Sbjct  59   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSGVLRKMRATGGGEKKK  108



>ref|XP_009789213.1| PREDICTED: 60S ribosomal protein L36-1-like [Nicotiana sylvestris]
Length=108

 Score =   188 bits (478),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 104/110 (95%), Gaps = 2/110 (2%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP   N+GL VGLN+GHVVTKKELAPRPSDRKGKTSKR++FV+SLIREVAGFAPYEKRI
Sbjct  1    MAP--PNTGLAVGLNKGHVVTKKELAPRPSDRKGKTSKRVHFVRSLIREVAGFAPYEKRI  58

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRATGG +KKK
Sbjct  59   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRATGGAEKKK  108



>ref|XP_007051819.1| Ribosomal protein L36e family protein isoform 3, partial [Theobroma 
cacao]
 gb|EOX95976.1| Ribosomal protein L36e family protein isoform 3, partial [Theobroma 
cacao]
Length=125

 Score =   189 bits (479),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -3

Query  538  RPSQNQIERGMAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREV  359
            R S   +   MAPKQ N+GLFVGLN+GHVVTKKELAPRPSDRKGKTSKR++FVKSLIREV
Sbjct  15   RYSVGAVWLVMAPKQPNTGLFVGLNKGHVVTKKELAPRPSDRKGKTSKRVHFVKSLIREV  74

Query  358  AGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
            AGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR
Sbjct  75   AGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMR  125



>ref|XP_007218628.1| hypothetical protein PRUPE_ppa013641mg [Prunus persica]
 gb|EMJ19827.1| hypothetical protein PRUPE_ppa013641mg [Prunus persica]
Length=111

 Score =   188 bits (477),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+G+FVGLN+GH+VT+KELAPRPSDRKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGIFVGLNKGHIVTRKELAPRPSDRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAK+KLGTHKRAK+KREEMS VLRK+RA GG  +KK
Sbjct  61   TELLKVGKDKRALKVAKKKLGTHKRAKKKREEMSNVLRKIRAGGGASEKK  110



>gb|KHG10655.1| 60S ribosomal L36-2 -like protein [Gossypium arboreum]
 gb|KHG18042.1| 60S ribosomal L36-2 -like protein [Gossypium arboreum]
Length=112

 Score =   188 bits (477),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 105/112 (94%), Gaps = 2/112 (2%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MA KQ N+GLFVGLN+GH VTKKELAPRPS+RKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MATKQPNTGLFVGLNKGHAVTKKELAPRPSNRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRA--TGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA   GGGDKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRAHHPGGGDKKK  112



>ref|XP_009605981.1| PREDICTED: 60S ribosomal protein L36-1-like [Nicotiana tomentosiformis]
Length=108

 Score =   187 bits (476),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 103/110 (94%), Gaps = 2/110 (2%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP   NSGL VGLN+GHVVTKKELAPRPSDRKGKTSKR+ FV+SLIREVAGFAPYEKRI
Sbjct  1    MAP--PNSGLAVGLNKGHVVTKKELAPRPSDRKGKTSKRVLFVRSLIREVAGFAPYEKRI  58

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRATGG +KKK
Sbjct  59   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRATGGAEKKK  108



>gb|ACH63218.1| ribosomal protein L36 [Rheum australe]
Length=110

 Score =   187 bits (476),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ +SGLFVGLN+GH+VTKKEL  +PSDRKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPKQPSSGLFVGLNKGHIVTKKELPAKPSDRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ GG +KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRSAGGAEKKK  110



>gb|KHG14589.1| 60S ribosomal L36-2 -like protein [Gossypium arboreum]
Length=123

 Score =   188 bits (477),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 106/111 (95%), Gaps = 1/111 (1%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MA KQ N+GLFVGLN+GHVVTKKELAPRPS+RKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  13   MATKQPNTGLFVGLNKGHVVTKKELAPRPSNRKGKTSKRVHFVRNLIREVAGFAPYEKRI  72

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRA-TGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA  GGG+KKK
Sbjct  73   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRAHPGGGEKKK  123



>ref|XP_009399872.1| PREDICTED: 60S ribosomal protein L36-2-like [Musa acuminata subsp. 
malaccensis]
Length=110

 Score =   187 bits (475),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q+N+GLFVGLN+GH+VTK+ELAPRPS RKGKTSKR++FV+++IREVAGFAPYEKRI
Sbjct  1    MAPPQSNTGLFVGLNKGHIVTKRELAPRPSSRKGKTSKRVHFVRNIIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+ VLRKMR+ G  DKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMANVLRKMRSAGVSDKKK  110



>gb|KHG11153.1| 60S ribosomal L36-2 -like protein [Gossypium arboreum]
Length=110

 Score =   186 bits (473),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  +GL VGLN+GHVVTKKELA RPS+RKGKTSKR++FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPSQPKTGLSVGLNKGHVVTKKELASRPSNRKGKTSKRVHFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ GGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRSAGGGEKKK  110



>ref|XP_004308073.1| PREDICTED: 60S ribosomal protein L36-2-like [Fragaria vesca subsp. 
vesca]
Length=111

 Score =   186 bits (472),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  +GLFVGLN+GHV TKKELAPRPSDRKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPAQPKTGLFVGLNKGHVTTKKELAPRPSDRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ GG  +KK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRSGGGATEKK  110



>ref|XP_002513689.1| 60S ribosomal protein L36e, putative [Ricinus communis]
 gb|EEF49092.1| 60S ribosomal protein L36e, putative [Ricinus communis]
Length=107

 Score =   186 bits (471),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 103/110 (94%), Gaps = 3/110 (3%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP   N+GL VGLN+GHVVTKKELAPRPSDRKGKTSKR++FV+SLIREVAGFAPYEKRI
Sbjct  1    MAP---NTGLSVGLNKGHVVTKKELAPRPSDRKGKTSKRVSFVRSLIREVAGFAPYEKRI  57

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA GG +KKK
Sbjct  58   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRAGGGAEKKK  107



>ref|XP_006846149.1| hypothetical protein AMTR_s00012p00179170 [Amborella trichopoda]
 gb|ERN07824.1| hypothetical protein AMTR_s00012p00179170 [Amborella trichopoda]
Length=110

 Score =   186 bits (471),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP   ++GLFVG+N+GH+VTKKELAPRPSDRKGK+SKR +FVK++IREVAGFAPYEKRI
Sbjct  1    MAPSPPSTGLFVGINKGHIVTKKELAPRPSDRKGKSSKRAHFVKNIIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+GVLRKMRA G  DKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMAGVLRKMRAAGVSDKKK  110



>ref|XP_008802753.1| PREDICTED: 60S ribosomal protein L36-2 [Phoenix dactylifera]
Length=110

 Score =   185 bits (470),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q N+GLFVGLN+GH+VTK+ELAPRPS RKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPPQPNTGLFVGLNKGHIVTKRELAPRPSSRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+ VLRKMR+ G  +KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMANVLRKMRSAGVAEKKK  110



>ref|XP_004302782.1| PREDICTED: 60S ribosomal protein L36-2-like [Fragaria vesca subsp. 
vesca]
Length=110

 Score =   185 bits (470),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  +GLFVGLN+GHV TKKELAPRPSDRKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPPQPKTGLFVGLNKGHVTTKKELAPRPSDRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ G  +KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRSGGTTEKKK  110



>gb|KJB23856.1| hypothetical protein B456_004G118000 [Gossypium raimondii]
 gb|KJB23857.1| hypothetical protein B456_004G118000 [Gossypium raimondii]
 gb|KJB23858.1| hypothetical protein B456_004G118000 [Gossypium raimondii]
 gb|KJB23859.1| hypothetical protein B456_004G118000 [Gossypium raimondii]
Length=111

 Score =   185 bits (470),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 105/111 (95%), Gaps = 1/111 (1%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MA KQ N+GLFVGLN+GHVVTKKELA RPS+RKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MATKQPNTGLFVGLNKGHVVTKKELAQRPSNRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRAT-GGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA  GGG+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRAHPGGGEKKK  111



>gb|AFK47188.1| unknown [Medicago truncatula]
 gb|KEH26395.1| 60S ribosomal protein L36 [Medicago truncatula]
Length=111

 Score =   185 bits (470),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 105/111 (95%), Gaps = 1/111 (1%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ ++GLFVGLN+GHVVTKKELA +PS RKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPKQPSTGLFVGLNKGHVVTKKELALKPSSRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGG-GDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA GG GDKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRAGGGAGDKKK  111



>ref|XP_011008473.1| PREDICTED: 60S ribosomal protein L36-1-like isoform X1 [Populus 
euphratica]
Length=112

 Score =   185 bits (470),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLN+GH+VTKKELAPRPSDRKGK SKR+ FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGKASKRVLFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATG  197
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR  G
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRYIG  104



>ref|XP_010241904.1| PREDICTED: 60S ribosomal protein L36-3-like [Nelumbo nucifera]
Length=110

 Score =   185 bits (469),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP+Q  SGLFVGLN+GH+VTKKELAPRPS+RKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPQQPKSGLFVGLNKGHIVTKKELAPRPSNRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAK+KLGTHKRAK+KREEMS VLRKMR+ G   KKK
Sbjct  61   TELLKVGKDKRALKVAKKKLGTHKRAKKKREEMSSVLRKMRSAGVDHKKK  110



>ref|XP_009380656.1| PREDICTED: 60S ribosomal protein L36-2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380657.1| PREDICTED: 60S ribosomal protein L36-2-like [Musa acuminata subsp. 
malaccensis]
Length=110

 Score =   185 bits (469),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q NSGLFVGLN+GH+VTK+EL PRPS RKGKTSKR++FV+++IREVAGFAPYEKRI
Sbjct  1    MAPPQPNSGLFVGLNKGHIVTKRELLPRPSSRKGKTSKRVHFVRNIIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+ VLRKMR+ G  DKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMANVLRKMRSAGVSDKKK  110



>gb|KDP22263.1| hypothetical protein JCGZ_26094 [Jatropha curcas]
Length=107

 Score =   184 bits (468),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 104/110 (95%), Gaps = 3/110 (3%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP   N+GLFVGLN+GH+VTKKELAPRPS+RKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAP---NTGLFVGLNKGHIVTKKELAPRPSNRKGKTSKRVHFVRNLIREVAGFAPYEKRI  57

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS V+RKMR  GGG+KKK
Sbjct  58   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVVRKMRGAGGGEKKK  107



>ref|XP_009419935.1| PREDICTED: 60S ribosomal protein L36-3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009419936.1| PREDICTED: 60S ribosomal protein L36-3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009419937.1| PREDICTED: 60S ribosomal protein L36-3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009419938.1| PREDICTED: 60S ribosomal protein L36-3-like [Musa acuminata subsp. 
malaccensis]
Length=110

 Score =   184 bits (468),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q N+GLFVGLN+GH+VTK+EL PRPS+RKGKTSKR++FV+++IREVAGFAPYEKRI
Sbjct  1    MAPPQPNTGLFVGLNKGHIVTKRELPPRPSNRKGKTSKRVHFVRNIIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+ VLRKMR+ G  DKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMANVLRKMRSAGVSDKKK  110



>ref|XP_010922348.1| PREDICTED: 60S ribosomal protein L36-3-like [Elaeis guineensis]
 ref|XP_010922349.1| PREDICTED: 60S ribosomal protein L36-3-like [Elaeis guineensis]
 ref|XP_010922350.1| PREDICTED: 60S ribosomal protein L36-3-like [Elaeis guineensis]
Length=110

 Score =   184 bits (466),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q N+GLFVGLN+GHVVTK+EL PRPS RKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPPQPNTGLFVGLNKGHVVTKRELPPRPSSRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+ VLRKMR+ G  +KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMANVLRKMRSAGVAEKKK  110



>ref|NP_001044760.1| Os01g0840700 [Oryza sativa Japonica Group]
 dbj|BAB93221.1| putative 60S ribosomal protein L36 [Oryza sativa Japonica Group]
 dbj|BAF06674.1| Os01g0840700 [Oryza sativa Japonica Group]
 gb|EEE55646.1| hypothetical protein OsJ_04027 [Oryza sativa Japonica Group]
Length=110

 Score =   184 bits (466),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SGLFVG+N+GHVVTK+EL PRPSDRKGK++KR+NFV+ LIREV GFAPYEKRI
Sbjct  1    MAPPQPKSGLFVGINKGHVVTKRELPPRPSDRKGKSTKRVNFVRGLIREVVGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+GV+RKMR+ G  DKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMAGVIRKMRSAGTTDKKK  110



>gb|AEY84977.1| 60S ribosomal protein L36 [Wolffia australiana]
Length=110

 Score =   183 bits (465),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPK  N+GLFVGLN+GH+VTK+EL PRPSDRKGKTSKR++FV+++IREVAGFAPYEKRI
Sbjct  1    MAPKPPNTGLFVGLNKGHIVTKRELPPRPSDRKGKTSKRVHFVRNVIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALK+AKRKLGTHKRAK+KREEM+ VLRKMRA G  +KKK
Sbjct  61   TELLKVGKDKRALKLAKRKLGTHKRAKKKREEMANVLRKMRAAGVSEKKK  110



>ref|XP_010543315.1| PREDICTED: 60S ribosomal protein L36-3 [Tarenaya hassleriana]
Length=110

 Score =   183 bits (465),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MA  QA SGLFVGLN+GH+VTK+EL PRPSDRKGKTSKR  F++SLIREVAGFAPYEKRI
Sbjct  1    MAAAQAKSGLFVGLNKGHIVTKRELPPRPSDRKGKTSKRTLFIRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMRA G  +KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSNVLRKMRAGGVSEKKK  110



>ref|XP_010558320.1| PREDICTED: 60S ribosomal protein L36-2-like [Tarenaya hassleriana]
Length=110

 Score =   183 bits (464),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MA  QA SGLFVGLN+GH+VTK+EL PRPS+RKGKTSKR  F++SLIREVAGFAPYEKRI
Sbjct  1    MAAPQAKSGLFVGLNKGHIVTKRELPPRPSNRKGKTSKRTLFIRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMRA G  DKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRAGGVSDKKK  110



>dbj|BAJ98221.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02448.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96719.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=111

 Score =   183 bits (464),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SGLFVG+N+GHVVTK+EL PRPSDRKGK +KR++FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRKGKGTKRVHFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ G G +KK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRSAGTGTEKK  110



>ref|XP_006827643.1| hypothetical protein AMTR_s00009p00248470 [Amborella trichopoda]
 gb|ERM95059.1| hypothetical protein AMTR_s00009p00248470 [Amborella trichopoda]
Length=110

 Score =   182 bits (463),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP   N+GLFVGLN+GH+VTKKE+APRPSDRKGK+SKR  FV+SLIREV GFAPYEKRI
Sbjct  1    MAPSLPNTGLFVGLNKGHIVTKKEIAPRPSDRKGKSSKRELFVRSLIREVVGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ G G+KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRSAGVGEKKK  110



>ref|XP_010553286.1| PREDICTED: 60S ribosomal protein L36-2-like [Tarenaya hassleriana]
 ref|XP_010553287.1| PREDICTED: 60S ribosomal protein L36-2-like [Tarenaya hassleriana]
Length=111

 Score =   182 bits (463),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 101/111 (91%), Gaps = 1/111 (1%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MA  QA SGLFVGLN+GHVVT++ELAPRPS RKGKTSKR  F++SLIREVAGFAPYEKRI
Sbjct  1    MAAPQAKSGLFVGLNKGHVVTRRELAPRPSSRKGKTSKRTLFIRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGG-GDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMRA GG  DKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSNVLRKMRAGGGVSDKKK  111



>ref|XP_010931250.1| PREDICTED: 60S ribosomal protein L36-3-like [Elaeis guineensis]
 ref|XP_010931251.1| PREDICTED: 60S ribosomal protein L36-3-like [Elaeis guineensis]
Length=110

 Score =   182 bits (463),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q N+GLFVGLN+GH+VTK+EL PRPS RKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPPQPNTGLFVGLNKGHIVTKRELPPRPSSRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+ VLRKMR+ G  +KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMANVLRKMRSAGVTEKKK  110



>ref|XP_004309360.1| PREDICTED: 60S ribosomal protein L36-2-like [Fragaria vesca subsp. 
vesca]
Length=110

 Score =   182 bits (463),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  +GLFVGLN+GHV TKKELAPRP DRKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPPQPKTGLFVGLNKGHVTTKKELAPRPFDRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ G  +KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRSGGTTEKKK  110



>pdb|3J61|II Chain i, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAW50980.1| ribosomal protein L36 [Triticum aestivum]
Length=112

 Score =   182 bits (463),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 103/112 (92%), Gaps = 2/112 (2%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SGLFVG+N+GHVVTK+EL PRPSDRKGK +KR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRKGKGTKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGG--GDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ GG  GDKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRSAGGGAGDKKK  112



>ref|XP_010528374.1| PREDICTED: 60S ribosomal protein L36-2-like [Tarenaya hassleriana]
Length=110

 Score =   182 bits (463),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MA  QA SGLFVGLN+GHVVT++ELAPRPS RKGKTSKR  F++SLIREVAGFAPYEKRI
Sbjct  1    MAAPQAKSGLFVGLNKGHVVTRRELAPRPSSRKGKTSKRTLFIRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMRA G  +KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSNVLRKMRAGGVSEKKK  110



>ref|XP_010553284.1| PREDICTED: 60S ribosomal protein L36-2 [Tarenaya hassleriana]
 ref|XP_010553285.1| PREDICTED: 60S ribosomal protein L36-2 [Tarenaya hassleriana]
Length=110

 Score =   182 bits (463),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            M   QA SGLFVGLN+GHVVT++ELAPRPS RKGKTSKR  F++SLIREVAGFAPYEKRI
Sbjct  1    MTTPQAKSGLFVGLNKGHVVTRRELAPRPSSRKGKTSKRTLFIRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMRA G  DKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSNVLRKMRAGGVSDKKK  110



>gb|EAY76455.1| hypothetical protein OsI_04390 [Oryza sativa Indica Group]
Length=110

 Score =   182 bits (463),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SGLFVG+N+GHVVTK+EL PRPSDRKGK++KR+NFV+ LIREV GFAPYEKRI
Sbjct  1    MAPPQPKSGLFVGINKGHVVTKRELPPRPSDRKGKSTKRVNFVRGLIREVVGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM GV+RKMR+ G  DKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMVGVIRKMRSAGTTDKKK  110



>ref|XP_009420092.1| PREDICTED: 60S ribosomal protein L36-3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009420093.1| PREDICTED: 60S ribosomal protein L36-3-like [Musa acuminata subsp. 
malaccensis]
Length=110

 Score =   182 bits (463),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            M P Q N+GLFVGLN+GH+VTK+EL PRP  RKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MTPSQPNTGLFVGLNKGHIVTKRELPPRPCSRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+ VLRKMR+ G  DKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMANVLRKMRSAGVSDKKK  110



>ref|XP_009412547.1| PREDICTED: 60S ribosomal protein L36-3-like [Musa acuminata subsp. 
malaccensis]
Length=110

 Score =   182 bits (462),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q N+GLFVGLN+GH+VT++EL PRPS RKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPPQPNTGLFVGLNKGHIVTRRELPPRPSSRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+ VLRKMR+ G  +KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMANVLRKMRSAGVSEKKK  110



>ref|XP_006644985.1| PREDICTED: 60S ribosomal protein L36-2-like [Oryza brachyantha]
Length=109

 Score =   182 bits (461),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 101/110 (92%), Gaps = 1/110 (1%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SGLFVG+NRGHVVTK+EL PRPSDRKGK +KR+NFV+ LIREVAGFAPYEKRI
Sbjct  1    MAP-QPKSGLFVGINRGHVVTKRELPPRPSDRKGKNTKRVNFVRGLIREVAGFAPYEKRI  59

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+GV+RKMR+ G  DKKK
Sbjct  60   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMAGVIRKMRSAGTTDKKK  109



>ref|XP_007206165.1| hypothetical protein PRUPE_ppa013654mg [Prunus persica]
 ref|XP_008241117.1| PREDICTED: 60S ribosomal protein L36-2-like [Prunus mume]
 gb|EMJ07364.1| hypothetical protein PRUPE_ppa013654mg [Prunus persica]
Length=110

 Score =   182 bits (461),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP    SG+FVGLN+GH+VTK+ELAPRPSDRKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPAAPKSGIFVGLNKGHIVTKRELAPRPSDRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ G  +KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRSGGVTEKKK  110



>ref|XP_010232542.1| PREDICTED: 60S ribosomal protein L36-3-like [Brachypodium distachyon]
Length=110

 Score =   182 bits (461),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SGLFVG+N+GHVVTK+EL PRPSDRKGK++KR+ FV++LIREVAGFAPYEKRI
Sbjct  1    MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRKGKSTKRVLFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ G  DKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRSGGVADKKK  110



>gb|KJB34108.1| hypothetical protein B456_006G048500 [Gossypium raimondii]
Length=101

 Score =   181 bits (459),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MA KQ N+GLFVGLN+GHVVTKKELAPRPS+RKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MATKQPNTGLFVGLNKGHVVTKKELAPRPSNRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMR  101



>ref|NP_001055753.1| Os05g0459900 [Oryza sativa Japonica Group]
 gb|AAT39164.1| putative 60S ribosomal protein L36 [Oryza sativa Japonica Group]
 dbj|BAF17667.1| Os05g0459900 [Oryza sativa Japonica Group]
 gb|EAY98318.1| hypothetical protein OsI_20226 [Oryza sativa Indica Group]
 dbj|BAG86843.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63983.1| hypothetical protein OsJ_18810 [Oryza sativa Japonica Group]
Length=113

 Score =   181 bits (458),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SGLFVG+N+GHVVTK+EL PRPSDRKGK++KR+ FV++LIREVAGFAPYEKRI
Sbjct  1    MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRKGKSTKRVTFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGG  194
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+GVLRKMR+ GG
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMAGVLRKMRSGGG  105



>ref|XP_008784534.1| PREDICTED: 60S ribosomal protein L36-3-like [Phoenix dactylifera]
Length=109

 Score =   180 bits (457),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 102/110 (93%), Gaps = 1/110 (1%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q N+GLFVGLN+GH+VTK+EL PRPS RKGKTSKR++FV+SLIREVAGFAPYEKRI
Sbjct  1    MAP-QPNTGLFVGLNKGHIVTKRELPPRPSSRKGKTSKRVHFVRSLIREVAGFAPYEKRI  59

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+ VLRKMR+ G  +KKK
Sbjct  60   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMANVLRKMRSAGVTEKKK  109



>gb|AES62519.2| 60S ribosomal protein L36 [Medicago truncatula]
Length=115

 Score =   180 bits (457),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ ++GLFVGLN+GH+VTKKELAPRPS RKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPKQPSTGLFVGLNKGHIVTKKELAPRPSARKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMR  101



>ref|XP_003563645.1| PREDICTED: 60S ribosomal protein L36-3-like [Brachypodium distachyon]
Length=110

 Score =   180 bits (456),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP    +GLFVG+N+GHVVTK+EL PRPSDRKGK +KR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPATPKTGLFVGINKGHVVTKRELPPRPSDRKGKITKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ G  DKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRSAGVADKKK  110



>ref|XP_006654512.1| PREDICTED: 60S ribosomal protein L36-2-like [Oryza brachyantha]
Length=113

 Score =   180 bits (457),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 102/113 (90%), Gaps = 3/113 (3%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SGLFVG+N+GHVVTK+EL PRPSDRKGK +KR+ FV++LIREVAGFAPYEKRI
Sbjct  1    MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRKGKATKRVTFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGG---GDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+GVLRKMR+ GG    DKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMAGVLRKMRSGGGHAHTDKKK  113



>ref|XP_003592269.1| 60S ribosomal protein L36 [Medicago truncatula]
Length=151

 Score =   181 bits (460),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 106/116 (91%), Gaps = 1/116 (1%)
 Frame = -3

Query  550  IARLRPSQNQIERG-MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKS  374
            ++ +R S+  +  G MAPKQ ++GLFVGLN+GH+VTKKELAPRPS RKGKTSKR++FV++
Sbjct  22   LSGVRVSEITVTTGEMAPKQPSTGLFVGLNKGHIVTKKELAPRPSARKGKTSKRVHFVRN  81

Query  373  LIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
            LIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR
Sbjct  82   LIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMR  137



>ref|XP_002511852.1| 60S ribosomal protein L36e, putative [Ricinus communis]
 gb|EEF50521.1| 60S ribosomal protein L36e, putative [Ricinus communis]
Length=106

 Score =   180 bits (456),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 100/110 (91%), Gaps = 4/110 (4%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MA KQ NSGLFVGLN+GH VTKKELAPRPSDRKG    R++FV+ LIREVAGFAPYEKRI
Sbjct  1    MASKQPNSGLFVGLNKGHKVTKKELAPRPSDRKG----RVSFVRGLIREVAGFAPYEKRI  56

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMRA GGG+KKK
Sbjct  57   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRAGGGGEKKK  106



>ref|XP_008369879.1| PREDICTED: 60S ribosomal protein L36-3-like [Malus domestica]
 ref|XP_008364843.1| PREDICTED: 60S ribosomal protein L36-3-like [Malus domestica]
 ref|XP_009338754.1| PREDICTED: 60S ribosomal protein L36-3-like [Pyrus x bretschneideri]
 ref|XP_009338755.1| PREDICTED: 60S ribosomal protein L36-3-like [Pyrus x bretschneideri]
Length=107

 Score =   180 bits (456),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 101/109 (93%), Gaps = 2/109 (2%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP    SG+FVGLN+GH+VTK+EL PRPSDRKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPAAPKSGIFVGLNKGHIVTKRELPPRPSDRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKK  182
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+  GGDKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRS--GGDKK  107



>emb|CDM84897.1| unnamed protein product [Triticum aestivum]
Length=112

 Score =   179 bits (455),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 102/112 (91%), Gaps = 2/112 (2%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SGLFVG+N+GHVVTK+EL PRPSDRKGK +KR+ FV++LIREVAGFAPYEKRI
Sbjct  1    MAPLQPKSGLFVGINKGHVVTKRELPPRPSDRKGKGTKRVLFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGG--DKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ GGG  DKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRSGGGGATDKKK  112



>ref|XP_009421339.1| PREDICTED: 60S ribosomal protein L36-3-like [Musa acuminata subsp. 
malaccensis]
Length=110

 Score =   179 bits (454),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  +GLFVGLN+GH+VTK+EL PRPS RKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPPQPKTGLFVGLNKGHIVTKRELPPRPSGRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+ VLRKMR+ G  +KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMANVLRKMRSAGVSEKKK  110



>ref|XP_003568301.1| PREDICTED: 60S ribosomal protein L36-3-like [Brachypodium distachyon]
Length=111

 Score =   179 bits (454),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 1/111 (1%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SGLFVG+N+GHVVTK+EL PRPSDRKGK +KR+ FV++LIREVAGFAPYEKRI
Sbjct  1    MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRKGKGTKRVLFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATG-GGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ G G DKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRSAGTGTDKKK  111



>ref|XP_008810595.1| PREDICTED: 60S ribosomal protein L36-3-like [Phoenix dactylifera]
 ref|XP_010920605.1| PREDICTED: 60S ribosomal protein L36-3-like [Elaeis guineensis]
 ref|XP_010920606.1| PREDICTED: 60S ribosomal protein L36-3-like [Elaeis guineensis]
Length=109

 Score =   179 bits (453),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 102/110 (93%), Gaps = 1/110 (1%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q N+GLFVGLN+GH+VTK+EL PRPS RKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAP-QPNTGLFVGLNKGHIVTKRELPPRPSSRKGKTSKRVHFVRNLIREVAGFAPYEKRI  59

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+ VLRKMR+ G  +KKK
Sbjct  60   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMANVLRKMRSAGVTEKKK  109



>ref|XP_008776722.1| PREDICTED: 60S ribosomal protein L36-3-like [Phoenix dactylifera]
Length=110

 Score =   178 bits (452),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q N+GLFVG+N+GH+VTK+EL  RPS RKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPSQPNTGLFVGINKGHIVTKRELPLRPSSRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+ VLRKMR+ G  +KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMANVLRKMRSAGVAEKKK  110



>ref|XP_002458740.1| hypothetical protein SORBIDRAFT_03g039390 [Sorghum bicolor]
 gb|EES03860.1| hypothetical protein SORBIDRAFT_03g039390 [Sorghum bicolor]
Length=112

 Score =   178 bits (452),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 102/112 (91%), Gaps = 2/112 (2%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP QA SGLFVG+N+GHVVTK+EL  RPSDRKGK +KR+ FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPTQAKSGLFVGINKGHVVTKRELPLRPSDRKGKATKRVTFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGG--DKKK  179
            TELLKVGKDKRALK+AKRKLGTHKRAK+KREEM+ V+RKMR+ GGG  DKKK
Sbjct  61   TELLKVGKDKRALKLAKRKLGTHKRAKKKREEMANVVRKMRSGGGGVADKKK  112



>dbj|BAJ92829.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=112

 Score =   178 bits (452),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 2/112 (2%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SGLFVG+N+GHVVTK+EL PRPSDRKGK +KR+ FV++LIREVAGFAPYEKRI
Sbjct  1    MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRKGKGTKRVLFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGG--GDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ GG   DKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRSGGGAAADKKK  112



>gb|ABK21348.1| unknown [Picea sitchensis]
 gb|ABK21383.1| unknown [Picea sitchensis]
 gb|ABK21513.1| unknown [Picea sitchensis]
 gb|ABK21531.1| unknown [Picea sitchensis]
 gb|ABK21681.1| unknown [Picea sitchensis]
 gb|ABK22315.1| unknown [Picea sitchensis]
 gb|ABK22334.1| unknown [Picea sitchensis]
 gb|ABK24964.1| unknown [Picea sitchensis]
 gb|ABK26177.1| unknown [Picea sitchensis]
 gb|ABK26197.1| unknown [Picea sitchensis]
 gb|ABR16244.1| unknown [Picea sitchensis]
 gb|ABR17541.1| unknown [Picea sitchensis]
 gb|ABR17659.1| unknown [Picea sitchensis]
 gb|ABR17978.1| unknown [Picea sitchensis]
 gb|ABR18085.1| unknown [Picea sitchensis]
 gb|ACN40045.1| unknown [Picea sitchensis]
Length=110

 Score =   178 bits (451),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SG+FVGLNRGH+VTK+ELAPRPS  KGK SKR +FV+ LIREVAGFAPYEKRI
Sbjct  1    MAPAQPKSGIFVGLNRGHIVTKRELAPRPSANKGKRSKRTDFVRKLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAK+KLGTHKRAK+KREEMS VLRKMRA G  +KKK
Sbjct  61   TELLKVGKDKRALKVAKKKLGTHKRAKKKREEMSNVLRKMRAAGTTEKKK  110



>ref|XP_008388314.1| PREDICTED: 60S ribosomal protein L36-3-like [Malus domestica]
Length=107

 Score =   177 bits (450),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 100/109 (92%), Gaps = 2/109 (2%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP    SG+FVGLN+GH+VTK+EL PRPSDRKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPAAPKSGIFVGLNKGHIVTKRELPPRPSDRKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKK  182
            TELLKVGKDKRALKVAKRKLGTHKRAK+KRE MS VLRKMR+  GGDKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREXMSNVLRKMRS--GGDKK  107



>ref|XP_004970529.1| PREDICTED: 60S ribosomal protein L36-2-like isoform X2 [Setaria 
italica]
Length=111

 Score =   177 bits (450),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 101/111 (91%), Gaps = 1/111 (1%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP QA SGLFVG+N+GH+VTK+EL  RPSDRKGK +KR+ FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPTQAKSGLFVGINKGHIVTKRELPLRPSDRKGKATKRVTFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGG-GDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+ V+RKMR+ GG  DKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMANVVRKMRSGGGAADKKK  111



>ref|XP_009143472.1| PREDICTED: 60S ribosomal protein L36-2 [Brassica rapa]
 emb|CDX91371.1| BnaC04g07790D [Brassica napus]
 emb|CDX74946.1| BnaA05g06920D [Brassica napus]
Length=112

 Score =   177 bits (450),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MA  Q  +GLFVGLN+GHVVT++ELAPRP+ RKGKTSKR  F++SLIREVAGFAPYEKRI
Sbjct  1    MATPQVKTGLFVGLNKGHVVTRRELAPRPNSRKGKTSKRTLFIRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGG  191
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMR+ GGG
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGGG  106



>ref|XP_009133194.1| PREDICTED: 60S ribosomal protein L36-2-like [Brassica rapa]
Length=112

 Score =   176 bits (447),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MA  Q  +GLFVGLN+GHVVT++ELAPRP+ RKGKTSKR  F++SLIREVAGFAPYEKRI
Sbjct  1    MATPQVKTGLFVGLNKGHVVTRRELAPRPNSRKGKTSKRTLFIRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMR+ GG   +K
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGGATTEK  110



>emb|CDX79744.1| BnaC03g20800D [Brassica napus]
Length=112

 Score =   176 bits (447),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MA  Q  +GLFVGLN+GHVVT++ELAPRP+ RKGKTSKR  F++SLIREVAGFAPYEKRI
Sbjct  1    MAAPQVKTGLFVGLNKGHVVTRRELAPRPNSRKGKTSKRTLFIRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMR+ GG   +K
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGGATTEK  110



>gb|ABR25361.1| 60S ribosomal protein l-36-2 [Oryza sativa Indica Group]
Length=111

 Score =   176 bits (447),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = -3

Query  502  PKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITE  323
            P Q  SGLFVG+N+GHVVTK+EL PRPSDRKGK++KR+ FV++LIREVAGFAPYEKRITE
Sbjct  1    PSQPKSGLFVGINKGHVVTKRELPPRPSDRKGKSTKRVTFVRNLIREVAGFAPYEKRITE  60

Query  322  LLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGG  194
            LLKVGKDKRALKVAKRKLGTHKRAK+KREEM+GVLRKMR+ GG
Sbjct  61   LLKVGKDKRALKVAKRKLGTHKRAKKKREEMAGVLRKMRSGGG  103



>ref|XP_009141676.1| PREDICTED: 60S ribosomal protein L36-2-like [Brassica rapa]
 emb|CDY65259.1| BnaA04g29060D [Brassica napus]
 emb|CDX93362.1| BnaC04g45340D [Brassica napus]
Length=112

 Score =   176 bits (446),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MA  Q  +GLFVGLN+GHV T++ELAPRP+ RKGKTSKR  F++SLIREVAGFAPYEKRI
Sbjct  1    MAAPQVKTGLFVGLNKGHVTTRRELAPRPNSRKGKTSKRTLFIRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGG  191
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMR+ GGG
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGGG  106



>ref|XP_010505352.1| PREDICTED: 60S ribosomal protein L36-2-like [Camelina sativa]
 ref|XP_010505353.1| PREDICTED: 60S ribosomal protein L36-2-like [Camelina sativa]
Length=112

 Score =   176 bits (445),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            M      +GLFVGLN+GHVVT++ELAPRP+ RKGKTSKR  F++SLIREVAGFAPYEKRI
Sbjct  1    MTTPAVKTGLFVGLNKGHVVTRRELAPRPNSRKGKTSKRTLFIRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGG  191
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR+ GGG
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRSGGGG  106



>ref|XP_006410950.1| hypothetical protein EUTSA_v10017455mg [Eutrema salsugineum]
 gb|ESQ52403.1| hypothetical protein EUTSA_v10017455mg [Eutrema salsugineum]
Length=112

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MA  Q  +GLFVGLN+GHVVT++ELAPRP+ RKGKTSKR  F+++LIREV+GFAPYEKRI
Sbjct  1    MAAPQVKTGLFVGLNKGHVVTRRELAPRPNSRKGKTSKRTLFIRTLIREVSGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGG  191
             ELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR+ GGG
Sbjct  61   QELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRSGGGG  106



>gb|ABK21274.1| unknown [Picea sitchensis]
 gb|ABK23083.1| unknown [Picea sitchensis]
 gb|ABK23794.1| unknown [Picea sitchensis]
 gb|ABK23848.1| unknown [Picea sitchensis]
 gb|ABK24958.1| unknown [Picea sitchensis]
Length=110

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SG+FVGLNRGHVVT ++LAPRPS  KGK SKR +FV+ LIREVAGFAPYEKRI
Sbjct  1    MAPAQPKSGIFVGLNRGHVVTNRDLAPRPSANKGKRSKRTDFVRKLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAK+KLGTHKRAK+KREEMS VLRKMRA G  +KKK
Sbjct  61   TELLKVGKDKRALKVAKKKLGTHKRAKKKREEMSNVLRKMRAAGTTEKKK  110



>emb|CDY07780.1| BnaA03g17310D [Brassica napus]
Length=218

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  517  ERGMAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYE  338
            E  MA  Q  +GLFVGLN+GHVVT++ELAPRP+ RKGKTSKR  F++SLIREVAGFAPYE
Sbjct  104  EETMATPQVKTGLFVGLNKGHVVTRRELAPRPNSRKGKTSKRTLFIRSLIREVAGFAPYE  163

Query  337  KRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            KRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMR+ GG   +K
Sbjct  164  KRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGGATTEK  216



>gb|EMT26739.1| 60S ribosomal protein L36-2 [Aegilops tauschii]
Length=113

 Score =   175 bits (443),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SGLFVG+N+GHVVTK+EL PRPSDRKGK +KR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRKGKGTKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRA  203
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRS  102



>ref|XP_009103881.1| PREDICTED: 60S ribosomal protein L36-2 [Brassica rapa]
 emb|CDX67572.1| BnaA07g16120D [Brassica napus]
Length=112

 Score =   174 bits (442),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            M   Q  +GLFVGLN+GHVVT++ELAPRP  RKGKTSKR  F++SLIREVAGFAPYEKRI
Sbjct  1    MTTPQVKTGLFVGLNKGHVVTRRELAPRPRARKGKTSKRTLFIRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGG  191
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMR+ GGG
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGGG  106



>ref|XP_010937642.1| PREDICTED: 60S ribosomal protein L36-3-like [Elaeis guineensis]
Length=109

 Score =   174 bits (441),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 101/110 (92%), Gaps = 1/110 (1%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q N+G+FVGLN+GH VTK+EL PRPS RKGKTSKR++FV+++IREVAGFAPYEKRI
Sbjct  1    MAP-QPNTGIFVGLNKGHNVTKRELPPRPSSRKGKTSKRVHFVRNVIREVAGFAPYEKRI  59

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+ VLRKMR+ G  +KKK
Sbjct  60   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMANVLRKMRSAGVTEKKK  109



>ref|XP_010427033.1| PREDICTED: 60S ribosomal protein L36-2 [Camelina sativa]
Length=112

 Score =   174 bits (441),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            M   Q  +GLFVGLN+GHVVT++ELAPRP  RKGKTSKR  F++SLIREVAGFAPYEKRI
Sbjct  1    MTTPQVKTGLFVGLNKGHVVTRRELAPRPRSRKGKTSKRTIFIRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRK R+ GGG  +K
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKSRSAGGGATEK  110



>ref|XP_009116070.1| PREDICTED: 60S ribosomal protein L36-2 [Brassica rapa]
 emb|CDX78201.1| BnaA09g33960D [Brassica napus]
Length=112

 Score =   174 bits (441),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            M   Q  +GLFVGLN+GHVVT++ELAPRP  RKG+TSKR  F++SLIREVAGFAPYEKRI
Sbjct  1    MTAPQVKTGLFVGLNKGHVVTRRELAPRPRARKGQTSKRTLFIRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMR+ GGG  +K
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGGGATEK  110



>ref|XP_010509313.1| PREDICTED: 60S ribosomal protein L36-2-like [Camelina sativa]
Length=112

 Score =   174 bits (441),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            M      +GLFVGLN+GHVVT++ELAPRP+ RKGKTSKR  F++SLIREVAGFAPYEKRI
Sbjct  1    MTTPAVKTGLFVGLNKGHVVTRRELAPRPNSRKGKTSKRTLFIRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGG  191
            +ELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR+ GGG
Sbjct  61   SELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRSGGGG  106



>ref|XP_010517031.1| PREDICTED: 60S ribosomal protein L36-2-like [Camelina sativa]
Length=111

 Score =   174 bits (441),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            M      +GLFVGLN+GHVVT++ELAPRP+ RKGKTSKR  F++SLIREVAGFAPYEKRI
Sbjct  1    MTTPAVKTGLFVGLNKGHVVTRRELAPRPNSRKGKTSKRTLFIRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGG  191
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRK+R+ GGG
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKLRSGGGG  106



>gb|EMS49232.1| 60S ribosomal protein L36-2 [Triticum urartu]
Length=141

 Score =   175 bits (443),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SGLFVG+N+GHVVTK+EL PRPSDRKGK +KR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRKGKGTKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMR  101



>gb|EMT04101.1| hypothetical protein F775_43985 [Aegilops tauschii]
Length=101

 Score =   173 bits (438),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SGLFVG+N+GHVVTK+EL PRPSDRKGK +KR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRKGKGTKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKM  209
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKM
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKM  100



>ref|XP_006295258.1| hypothetical protein CARUB_v10024358mg [Capsella rubella]
 gb|EOA28156.1| hypothetical protein CARUB_v10024358mg [Capsella rubella]
Length=112

 Score =   172 bits (437),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            M      +GLFVGLN+GHVVT++ELAP P+ RKGKTSKR  F++SLIREVAGFAPYEKRI
Sbjct  1    MTTPAVKTGLFVGLNKGHVVTRRELAPLPNSRKGKTSKRTLFIRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGG  191
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR+ GGG
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRSGGGG  106



>gb|EMS68428.1| 60S ribosomal protein L36-3 [Triticum urartu]
Length=121

 Score =   172 bits (437),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 102/121 (84%), Gaps = 11/121 (9%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKG----------KTSKRINFVKSLIREV  359
            MAP Q  SGLFVG+N+GHVVTK+EL PRPSDRKG          K +KR++FV++LIREV
Sbjct  1    MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRKGLVIEDAHGHQKGTKRVHFVRNLIREV  60

Query  358  AGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATG-GGDKK  182
            AGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ G G DKK
Sbjct  61   AGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRSAGTGTDKK  120

Query  181  K  179
            K
Sbjct  121  K  121



>gb|AAV83991.1| putative 60S ribosomal protein L36 [Saccharum officinarum]
Length=111

 Score =   172 bits (436),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 99/111 (89%), Gaps = 1/111 (1%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SGLFVG+N+GHVVTK+EL PRPS RKGK +KR++ V+ LIREVAGFAPYEKRI
Sbjct  1    MAPPQPKSGLFVGINKGHVVTKRELPPRPSHRKGKATKRVSMVRGLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGG-GDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+GVL+KMR+ G   DKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMAGVLKKMRSAGTHTDKKK  111



>ref|XP_004970528.1| PREDICTED: 60S ribosomal protein L36-2-like isoform X1 [Setaria 
italica]
Length=127

 Score =   172 bits (437),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP QA SGLFVG+N+GH+VTK+EL  RPSDRKGK +KR+ FV+SLIREVAGFAPYEKRI
Sbjct  1    MAPTQAKSGLFVGINKGHIVTKRELPLRPSDRKGKATKRVTFVRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRA  203
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+ V+RKMR 
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMANVVRKMRC  102



>ref|NP_001284558.1| uncharacterized protein LOC103504721 [Zea mays]
 ref|XP_008648267.1| PREDICTED: 60S ribosomal protein L36-like isoform X1 [Zea mays]
 gb|ACF86300.1| unknown [Zea mays]
 gb|ACF86303.1| unknown [Zea mays]
 gb|ACG35960.1| 60S ribosomal protein L36-2 [Zea mays]
 gb|AFW78264.1| 60S ribosomal protein L36 isoform 1 [Zea mays]
 gb|AFW78265.1| 60S ribosomal protein L36 isoform 2 [Zea mays]
Length=111

 Score =   171 bits (434),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 99/111 (89%), Gaps = 1/111 (1%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SGLFVG+N+GHVVTK+EL PRP  RKGK++KR++ V+ LIREVAGFAPYEKRI
Sbjct  1    MAPPQPKSGLFVGINKGHVVTKRELPPRPCHRKGKSTKRVSMVRGLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGG-GDKKK  179
            TELLKVGKDKRALK+AKRKLGTHKRAK+KREEM+GVLRKMR+ G   DKKK
Sbjct  61   TELLKVGKDKRALKLAKRKLGTHKRAKKKREEMAGVLRKMRSAGTHTDKKK  111



>ref|XP_004961851.1| PREDICTED: 60S ribosomal protein L36-3-like isoform X3 [Setaria 
italica]
 ref|XP_004961852.1| PREDICTED: 60S ribosomal protein L36-3-like isoform X4 [Setaria 
italica]
Length=111

 Score =   171 bits (433),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 97/111 (87%), Gaps = 1/111 (1%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SGLFVG+N+GHVVTK+EL PRPS RKGK +KR+  V+ LIREVAGFAPYEKRI
Sbjct  1    MAPPQPKSGLFVGINKGHVVTKRELPPRPSHRKGKATKRVTMVRGLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGG-GDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+ VLRKMR+ G   DKKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMANVLRKMRSAGTHTDKKK  111



>ref|XP_010504144.1| PREDICTED: 60S ribosomal protein L36-2-like [Camelina sativa]
Length=112

 Score =   171 bits (432),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            M      +GLFVGLN+GHVVT++ELAPRP  RKGKTSKR  F++SLIREVAGFAPYEKRI
Sbjct  1    MTTPPVKTGLFVGLNKGHVVTRRELAPRPRSRKGKTSKRTLFIRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGG  191
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRK R++GGG
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKSRSSGGG  106



>ref|XP_006292075.1| hypothetical protein CARUB_v10018270mg [Capsella rubella]
 gb|EOA24973.1| hypothetical protein CARUB_v10018270mg [Capsella rubella]
Length=114

 Score =   171 bits (432),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            M   Q  +GLFVGLN+GHVVT++ELAPRP  RKGKTSKR  F++SLIREVAGFAPYEKRI
Sbjct  1    MTAPQVKTGLFVGLNKGHVVTRRELAPRPRSRKGKTSKRTLFIRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRA  203
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMR+
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRS  102



>ref|XP_010515876.1| PREDICTED: 60S ribosomal protein L36-2-like [Camelina sativa]
Length=112

 Score =   170 bits (431),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            M      +GLFVGLN+GHVVT++ELAPRP  RKGKTSKR  F++SLIREVAGFAPYEKRI
Sbjct  1    MTTPPVKTGLFVGLNKGHVVTRRELAPRPRSRKGKTSKRTLFIRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGG  191
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRK R+ GGG
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKSRSAGGG  106



>ref|XP_006403658.1| hypothetical protein EUTSA_v10010840mg [Eutrema salsugineum]
 ref|XP_006403659.1| hypothetical protein EUTSA_v10010840mg [Eutrema salsugineum]
 gb|ESQ45111.1| hypothetical protein EUTSA_v10010840mg [Eutrema salsugineum]
 gb|ESQ45112.1| hypothetical protein EUTSA_v10010840mg [Eutrema salsugineum]
Length=112

 Score =   169 bits (428),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            M   Q  +GLFVGLN+GHVVT++ELAPRP  RKGKTSKR  F+++LIREV+GFAPYEKRI
Sbjct  1    MTTPQVKTGLFVGLNKGHVVTRRELAPRPRSRKGKTSKRTLFIRTLIREVSGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGG  191
             ELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRK+R+ GGG
Sbjct  61   QELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKIRSGGGG  106



>ref|NP_850697.1| 60S ribosomal protein L36-2 [Arabidopsis thaliana]
 ref|NP_001030855.1| 60S ribosomal protein L36-2 [Arabidopsis thaliana]
 ref|NP_001078279.1| 60S ribosomal protein L36-2 [Arabidopsis thaliana]
 sp|Q9M352.1|RL362_ARATH RecName: Full=60S ribosomal protein L36-2 [Arabidopsis thaliana]
 emb|CAB88336.1| 60S RIBOSOMAL PROTEIN L36 homolog [Arabidopsis thaliana]
 gb|AAL32869.1| 60S RIBOSOMAL PROTEIN L36 homolog [Arabidopsis thaliana]
 gb|AAM10141.1| 60S ribosomal protein L36-like protein [Arabidopsis thaliana]
 gb|AEE79135.1| 60S ribosomal protein L36-2 [Arabidopsis thaliana]
 gb|AEE79136.1| 60S ribosomal protein L36-2 [Arabidopsis thaliana]
 gb|AEE79137.1| 60S ribosomal protein L36-2 [Arabidopsis thaliana]
Length=112

 Score =   169 bits (428),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            M   Q  +GLFVGLN+GHVVT++ELAPRP  RKGKTSKR  F+++LI+EVAG APYEKRI
Sbjct  1    MTTPQVKTGLFVGLNKGHVVTRRELAPRPRSRKGKTSKRTIFIRNLIKEVAGQAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMR+ GGG  +K
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGGGATEK  110



>ref|XP_002877939.1| 60S ribosomal protein L36 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54198.1| 60S ribosomal protein L36 [Arabidopsis lyrata subsp. lyrata]
Length=110

 Score =   169 bits (427),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            M   Q  +GLFVGLN+GHVVT++ELAPRP  RKGKTSKR  F+++LI+EVAG APYEKRI
Sbjct  1    MTTPQVKTGLFVGLNKGHVVTRRELAPRPRSRKGKTSKRTIFIRNLIKEVAGMAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS  LRKMR  GGG  +K
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSTLRKMRCGGGGATEK  110



>emb|CDX73528.1| BnaC08g24750D [Brassica napus]
Length=115

 Score =   169 bits (427),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            M   Q  +GLFVGLN+GHVVT++ELAPRP  RKG+TSKR  F++SLIREVAGFAPYEKRI
Sbjct  1    MTAPQVKTGLFVGLNKGHVVTRRELAPRPRARKGQTSKRTLFIRSLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRA  203
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMR+
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRS  102



>gb|ACG34217.1| 60S ribosomal protein L36-2 [Zea mays]
Length=111

 Score =   168 bits (426),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SGLFVG+N+GHVVTK+EL PRP  RKGK++KR++ V+ LIREVAGFAPYEKRI
Sbjct  1    MAPPQPKSGLFVGINKGHVVTKRELPPRPCHRKGKSTKRVSMVRGLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATG  197
            TELLKVGKDKRALK+AKRKLGTHKRAK+KREEM+GVLRK R+ G
Sbjct  61   TELLKVGKDKRALKLAKRKLGTHKRAKKKREEMAGVLRKTRSAG  104



>ref|XP_004961850.1| PREDICTED: 60S ribosomal protein L36-3-like isoform X2 [Setaria 
italica]
Length=116

 Score =   168 bits (426),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SGLFVG+N+GHVVTK+EL PRPS RKGK +KR+  V+ LIREVAGFAPYEKRI
Sbjct  1    MAPPQPKSGLFVGINKGHVVTKRELPPRPSHRKGKATKRVTMVRGLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRAT  200
            TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+ VLRKMR  
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMANVLRKMRCV  103



>ref|NP_181296.1| 60S ribosomal protein L36-1 [Arabidopsis thaliana]
 ref|NP_001078017.1| 60S ribosomal protein L36-1 [Arabidopsis thaliana]
 sp|O80929.1|RL361_ARATH RecName: Full=60S ribosomal protein L36-1 [Arabidopsis thaliana]
 gb|AAC23630.1| 60S ribosomal protein L36 [Arabidopsis thaliana]
 gb|AAK97691.1| At2g37600/F13M22.10 [Arabidopsis thaliana]
 gb|AAL31109.1| At2g37600/F13M22.10 [Arabidopsis thaliana]
 gb|AAM64334.1| 60S ribosomal protein L36-1 [Arabidopsis thaliana]
 gb|AEC09423.1| 60S ribosomal protein L36-1 [Arabidopsis thaliana]
 gb|AEC09424.1| 60S ribosomal protein L36-1 [Arabidopsis thaliana]
Length=113

 Score =   168 bits (425),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            M      +GLFVGLN+GHVVT++ELAPRP+ RKGKTSKR  F++ LIREVAG APYEKRI
Sbjct  1    MTTPAVKTGLFVGLNKGHVVTRRELAPRPNSRKGKTSKRTIFIRKLIREVAGMAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGG  191
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMR+ GG 
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSLGGA  106



>ref|XP_006286404.1| hypothetical protein CARUB_v10002302mg [Capsella rubella]
 gb|EOA19302.1| hypothetical protein CARUB_v10002302mg [Capsella rubella]
Length=109

 Score =   167 bits (424),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -3

Query  487  SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVG  308
            +GLFVGLN+GHVVTK+E  PRP++RKGKTSKR  F++SLIREVAGFAPYEKRITELLKVG
Sbjct  4    TGLFVGLNKGHVVTKREQPPRPNNRKGKTSKRTLFIRSLIREVAGFAPYEKRITELLKVG  63

Query  307  KDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGG  194
            KDKRALKVAKRKLGTHKRAKRKREEMS VLRKMR+ GG
Sbjct  64   KDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGG  101



>ref|XP_010490699.1| PREDICTED: 60S ribosomal protein L36-3-like [Camelina sativa]
Length=110

 Score =   167 bits (424),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = -3

Query  487  SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVG  308
            +GLFVGLN+GH+VTK+E  PRP++RKGKTSKR  F++SLIREVAGFAPYEKRI+ELLKVG
Sbjct  4    TGLFVGLNKGHIVTKREQPPRPNNRKGKTSKRTLFIRSLIREVAGFAPYEKRISELLKVG  63

Query  307  KDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGG  191
            KDKRALKVAKRKLGTHKRAKRKREEMS VLRKMR+ GGG
Sbjct  64   KDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGGG  102



>ref|XP_002881517.1| 60S ribosomal protein L36 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002881520.1| 60S ribosomal protein L36 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57776.1| 60S ribosomal protein L36 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57779.1| 60S ribosomal protein L36 [Arabidopsis lyrata subsp. lyrata]
Length=112

 Score =   167 bits (424),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            M      +GLFVGLN+GHVVT++ELAPRP+ RKGKTSKR  F++++I+EVAG APYEKRI
Sbjct  1    MTTPAVKTGLFVGLNKGHVVTRRELAPRPNSRKGKTSKRTIFIRNVIKEVAGLAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRK+R+ GGG  +K
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKIRSGGGGAAEK  110



>ref|XP_010423862.1| PREDICTED: 60S ribosomal protein L36-3 [Camelina sativa]
Length=109

 Score =   167 bits (423),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -3

Query  487  SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVG  308
            +GLFVGLN+GH+VTK+E  PRP++RKGKTSKR  F++SLIREVAGFAPYEKRITELLKVG
Sbjct  4    TGLFVGLNKGHIVTKREQPPRPNNRKGKTSKRTLFIRSLIREVAGFAPYEKRITELLKVG  63

Query  307  KDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGG  194
            KDKRALKVAKRKLGTHKRAKRKREEMS VLRKMR+ GG
Sbjct  64   KDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGG  101



>ref|NP_001149704.1| LOC100283331 [Zea mays]
 ref|XP_008655008.1| PREDICTED: LOC100283331 isoform X1 [Zea mays]
 ref|XP_008655009.1| PREDICTED: LOC100283331 isoform X1 [Zea mays]
 gb|ACG24103.1| 60S ribosomal protein L36-2 [Zea mays]
 gb|ACG24571.1| 60S ribosomal protein L36-2 [Zea mays]
 gb|ACG35366.1| 60S ribosomal protein L36-2 [Zea mays]
 gb|ACG36444.1| 60S ribosomal protein L36-2 [Zea mays]
 gb|ACN36359.1| unknown [Zea mays]
 gb|AFW82222.1| 60S ribosomal protein L36 isoform 1 [Zea mays]
 gb|AFW82223.1| 60S ribosomal protein L36 isoform 2 [Zea mays]
 gb|AFW82224.1| 60S ribosomal protein L36 isoform 3 [Zea mays]
Length=111

 Score =   167 bits (422),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 97/111 (87%), Gaps = 1/111 (1%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SGLFVG+N+GHVVTK+EL  RPS RKGK +KR++ V+ LIREVAGFAPYEKRI
Sbjct  1    MAPPQPKSGLFVGINKGHVVTKRELPLRPSHRKGKATKRVSMVRGLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGG-GDKKK  179
            TELLKVGKDKRALK+AKRKLGTHKRAK+KREEM GVLRKMR+ G   DKKK
Sbjct  61   TELLKVGKDKRALKLAKRKLGTHKRAKKKREEMMGVLRKMRSAGTHTDKKK  111



>ref|XP_002870974.1| 60S ribosomal protein L36 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47233.1| 60S ribosomal protein L36 [Arabidopsis lyrata subsp. lyrata]
Length=108

 Score =   165 bits (417),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = -3

Query  487  SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVG  308
            +GLFVGLN+GHVVTK+E  PRP++RKGKTSKR  F++SLI+EVAG APYEKRITELLKVG
Sbjct  4    TGLFVGLNKGHVVTKREQPPRPNNRKGKTSKRTLFIRSLIKEVAGQAPYEKRITELLKVG  63

Query  307  KDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            KDKRALKVAKRKLGTHKRAKRKREEMS VLRKMR+ GGG  +K
Sbjct  64   KDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGGGASEK  106



>gb|EMT02216.1| 60S ribosomal protein L36-2 [Aegilops tauschii]
Length=150

 Score =   163 bits (413),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 102/150 (68%), Gaps = 40/150 (27%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKG--------------------------  407
            MAP Q  SGLFVG+N+GHVVTK+EL PRPSDRKG                          
Sbjct  1    MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRKGAYSCVQAGEMLTFIAVFCACLNTILV  60

Query  406  ------------KTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGT  263
                        K +KR+ FV++LIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGT
Sbjct  61   YVYLCCSYDPEEKGTKRVLFVRNLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGT  120

Query  262  HKRAKRKREEMSGVLRKMRATGGG--DKKK  179
            HKRAK+KREEMS VLRKMR+ GGG  DKKK
Sbjct  121  HKRAKKKREEMSSVLRKMRSGGGGAADKKK  150



>ref|NP_195865.1| 60S ribosomal protein L36-3 [Arabidopsis thaliana]
 sp|Q9LZ57.1|RL363_ARATH RecName: Full=60S ribosomal protein L36-3 [Arabidopsis thaliana]
 gb|AAG40038.1|AF324687_1 AT5g02450 [Arabidopsis thaliana]
 gb|AAG41464.1|AF326882_1 putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AAK00384.1|AF339702_1 putative 60S ribosomal protein [Arabidopsis thaliana]
 emb|CAB85982.1| 60S ribosomal protein-like [Arabidopsis thaliana]
 gb|AAL15336.1| AT5g02450/T22P11_40 [Arabidopsis thaliana]
 gb|AAM64602.1| 60S ribosomal protein-like [Arabidopsis thaliana]
 gb|AAM91454.1| AT5g02450/T22P11_40 [Arabidopsis thaliana]
 gb|AED90473.1| 60S ribosomal protein L36-3 [Arabidopsis thaliana]
Length=108

 Score =   161 bits (408),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = -3

Query  487  SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVG  308
            +GLFVGLN+GHVVTK+E  PRP++RKGKTSKR  F+++LI+EVAG APYEKRITELLKVG
Sbjct  4    TGLFVGLNKGHVVTKREQPPRPNNRKGKTSKRTIFIRNLIKEVAGQAPYEKRITELLKVG  63

Query  307  KDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            KDKRALKVAKRKLGTHKRAKRKREEMS VLRKMR+ G G  +K
Sbjct  64   KDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGAGASEK  106



>gb|KDO38035.1| hypothetical protein CISIN_1g037449mg [Citrus sinensis]
Length=98

 Score =   159 bits (402),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 88/91 (97%), Gaps = 0/91 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLN+G++VTKKEL PR +DRKGKTSKR++FV+++IREVAGFAPYEKRI
Sbjct  1    MAPKQPNTGLFVGLNKGYIVTKKELQPRSADRKGKTSKRVHFVRTVIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKRE  236
            TELLKVGKDKRALKVAKRKLGTHKRAK+KRE
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKKRE  91



>gb|ACG39797.1| 60S ribosomal protein L36-2 [Zea mays]
Length=148

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 93/102 (91%), Gaps = 1/102 (1%)
 Frame = -3

Query  481  LFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKD  302
            LFVG+N+GHVVTK+EL PRP  RKGK++KR++ V+ LIREVAGFAPYEKRITELLKVGKD
Sbjct  47   LFVGINKGHVVTKRELPPRPCHRKGKSTKRVSMVRGLIREVAGFAPYEKRITELLKVGKD  106

Query  301  KRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGG-GDKKK  179
            KRALK+AKRKLGTHKRAK+KREEM+GVLRKMR+ G   DKKK
Sbjct  107  KRALKLAKRKLGTHKRAKKKREEMAGVLRKMRSAGTHTDKKK  148



>ref|XP_006422473.1| hypothetical protein CICLE_v10029636mg [Citrus clementina]
 gb|ESR35713.1| hypothetical protein CICLE_v10029636mg [Citrus clementina]
Length=105

 Score =   158 bits (399),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLN+GH+VTKKEL PRP+DRKGKTSKR++FV+++IREVAGFAPYEK I
Sbjct  1    MAPKQPNTGLFVGLNKGHIVTKKELPPRPADRKGKTSKRVHFVRTVIREVAGFAPYEKMI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRK  242
            TELLKVGKDKRALKVAKRKLGTHKRAK+K
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHKRAKKK  89



>ref|XP_001758751.1| predicted protein [Physcomitrella patens]
 gb|EDQ76257.1| predicted protein [Physcomitrella patens]
Length=110

 Score =   156 bits (394),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP   ++G+ VGL+RGH VTK+++A RPS  KGK  KR + V++LIREVAGFAPYEKRI
Sbjct  1    MAPSVVSNGIAVGLHRGHQVTKRDIAQRPSASKGKLGKRTSMVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTH RAKRKREEM+ VLRKMRA G  +KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHLRAKRKREEMTTVLRKMRAGGHAEKKK  110



>ref|XP_001766383.1| predicted protein [Physcomitrella patens]
 gb|EDQ68711.1| predicted protein [Physcomitrella patens]
Length=110

 Score =   155 bits (393),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP   ++G+ VGL+RGH VTK+++A RPS  KGK  KR + V++LIREVAGFAPYEKRI
Sbjct  1    MAPSVVSNGIAVGLHRGHQVTKRDIAKRPSASKGKLGKRTSMVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGKDKRALKVAKRKLGTH RAKRKREEM+ VLRKMRA G  +KKK
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHLRAKRKREEMTTVLRKMRAGGHAEKKK  110



>ref|XP_002966421.1| hypothetical protein SELMODRAFT_439710 [Selaginella moellendorffii]
 ref|XP_002978143.1| hypothetical protein SELMODRAFT_271281 [Selaginella moellendorffii]
 gb|EFJ20800.1| hypothetical protein SELMODRAFT_271281 [Selaginella moellendorffii]
 gb|EFJ32448.1| hypothetical protein SELMODRAFT_439710 [Selaginella moellendorffii]
Length=105

 Score =   151 bits (381),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP  A+SG+ +GLN+GH VTK+  A RP D KGK  KR  FV+ LIREV GFAPYEKRI
Sbjct  1    MAPNVASSGIAIGLNKGHAVTKRTPAKRPIDMKGKGQKRTLFVRKLIREVVGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATG  197
            TELLKVGKDKRALKVAKRKLGTH RAK+KREEMS VLRKMR++G
Sbjct  61   TELLKVGKDKRALKVAKRKLGTHLRAKKKREEMSTVLRKMRSSG  104



>emb|CDY07570.1| BnaC06g14940D [Brassica napus]
Length=114

 Score =   151 bits (381),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 88/108 (81%), Gaps = 2/108 (2%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKR--INFVKSLIREVAGFAPYEK  335
            M   Q  +GLFVGLN+GHVVT++ELAPRP  RKG  S     + ++   REVAGFAPYEK
Sbjct  1    MTTPQVKTGLFVGLNKGHVVTRRELAPRPRARKGSLSWYNLSHVLRKQAREVAGFAPYEK  60

Query  334  RITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGG  191
            RITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMR+ GGG
Sbjct  61   RITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGGG  108



>gb|AFK41147.1| unknown [Medicago truncatula]
Length=100

 Score =   150 bits (379),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ ++GLFVGLN+GH+VTKKELAPRPS RKGKTSKR++FV++LIREVAGFAPYEKRI
Sbjct  1    MAPKQPSTGLFVGLNKGHIVTKKELAPRPSARKGKTSKRVHFVRNLIREVAGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTH  260
            TELLKVGKDKRALKVAKR+LGTH
Sbjct  61   TELLKVGKDKRALKVAKRRLGTH  83



>ref|XP_010456363.1| PREDICTED: 60S ribosomal protein L36-3-like [Camelina sativa]
Length=140

 Score =   152 bits (383),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 92/130 (71%), Gaps = 31/130 (24%)
 Frame = -3

Query  487  SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYE----------  338
            +GLFVGLN+GHVVTK+E  PRP++RKGKTSKR  F++SLIREVAGFAPYE          
Sbjct  4    TGLFVGLNKGHVVTKREQPPRPNNRKGKTSKRTLFIRSLIREVAGFAPYEKRITELLKKT  63

Query  337  ---------------------KRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGV  221
                                 KRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS V
Sbjct  64   SKRTLFIRSLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSV  123

Query  220  LRKMRATGGG  191
            LRKMR+ GG 
Sbjct  124  LRKMRSGGGA  133



>ref|XP_006443526.1| hypothetical protein CICLE_v10023595mg [Citrus clementina]
 gb|ESR56766.1| hypothetical protein CICLE_v10023595mg [Citrus clementina]
Length=110

 Score =   149 bits (376),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            M PKQ+N+GLFVGL++GHV+ KKEL  R +D KGKTSK ++F +++IREVAGFA Y+K I
Sbjct  1    MVPKQSNTGLFVGLSKGHVMNKKELPSRSADCKGKTSKGVHFERNVIREVAGFASYKKGI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
             ELLKVGKDKR LKVAK+KLG HKR K KREEMS VLR  RATGG +K K
Sbjct  61   NELLKVGKDKRTLKVAKKKLGAHKRTKMKREEMSNVLRWTRATGGEEKTK  110



>ref|NP_566987.1| 60S ribosomal protein L36-2 [Arabidopsis thaliana]
 gb|AAM63733.1| 60S RIBOSOMAL PROTEIN L36 homolog [Arabidopsis thaliana]
 gb|AEE79134.1| 60S ribosomal protein L36-2 [Arabidopsis thaliana]
Length=103

 Score =   145 bits (366),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 87/110 (79%), Gaps = 9/110 (8%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            M   Q  +GLFVGLN+GHVVT++ELAPRP  RKGKTSKR  F+++LI+EVAG APYEKRI
Sbjct  1    MTTPQVKTGLFVGLNKGHVVTRRELAPRPRSRKGKTSKRTIFIRNLIKEVAGQAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TEL         LKVAKRKLGTHKRAKRKREEMS VLRKMR+ GGG  +K
Sbjct  61   TEL---------LKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGGGATEK  101



>ref|XP_002976225.1| hypothetical protein SELMODRAFT_267958 [Selaginella moellendorffii]
 gb|EFJ22485.1| hypothetical protein SELMODRAFT_267958 [Selaginella moellendorffii]
Length=105

 Score =   145 bits (365),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP  A+ G+ +GLN+GHVVTK+  A RP   +GK  KR  FV+ LIREV GFAPYEKRI
Sbjct  1    MAPSVASGGIAIGLNKGHVVTKRTPAKRPIAMRGKGQKRTLFVRKLIREVVGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATG  197
            TELLKVGKDKRALKVAKRKLG+H RAK+KREEMS VLRKMR++G
Sbjct  61   TELLKVGKDKRALKVAKRKLGSHLRAKKKREEMSTVLRKMRSSG  104



>pir||T14304 ribosomal protein - carrot (fragment)
 gb|AAB01095.1| putative ribosomal protein, partial [Daucus carota]
Length=111

 Score =   145 bits (366),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = -3

Query  514  RGMAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEK  335
            R MAPKQ N+GLFVGLN+GH+VTKKELAPRPSDRKGKTSKR +FV++LIREVAGF PYEK
Sbjct  4    RNMAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGKTSKRTHFVRNLIREVAGFXPYEK  63

Query  334  RITELLKVGKDKRALKVAKRKLGTHKRAK  248
            RITELLKVGKDKRALKV + K+G  + +K
Sbjct  64   RITELLKVGKDKRALKVRQEKVGHSQESK  92



>ref|XP_006493829.1| PREDICTED: 60S ribosomal protein L36-2-like [Citrus sinensis]
Length=110

 Score =   145 bits (365),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MA KQ NS LFVGLN+GHVVTKKEL   P+D KGKTSK ++F +++IR+  GFA YEK I
Sbjct  1    MALKQPNSSLFVGLNKGHVVTKKELPRCPADGKGKTSKIVHFERNVIRQGTGFAIYEKMI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVGK K ALK+AKRKL THKRAK K EEMS VLR++RAT GG+KKK
Sbjct  61   TELLKVGKYKSALKLAKRKLSTHKRAKMKSEEMSSVLRRIRATRGGEKKK  110



>sp|P52866.2|RL36_DAUCA RecName: Full=60S ribosomal protein L36 [Daucus carota]
Length=106

 Score =   143 bits (361),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPKQ N+GLFVGLN+GH+VTKKELAPRPSDRKGKTSKR +FV++LIREVAGF PYEKRI
Sbjct  1    MAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGKTSKRTHFVRNLIREVAGFXPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRK  242
            TELLKVGKDKRALKV + K+G  + +K +
Sbjct  61   TELLKVGKDKRALKVRQEKVGHSQESKEE  89



>ref|XP_002987131.1| hypothetical protein SELMODRAFT_125537 [Selaginella moellendorffii]
 gb|EFJ11707.1| hypothetical protein SELMODRAFT_125537 [Selaginella moellendorffii]
Length=118

 Score =   142 bits (358),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP  A+ G+ +GLN+GHVVTK+  A RP   +GK  KR  FV+ LIREV GFAPYEKRI
Sbjct  1    MAPSVASGGIAIGLNKGHVVTKRMPAKRPIAMRGKGQKRTLFVRKLIREVVGFAPYEKRI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
            TELLKVGKDKRALKVAKRKLG+H RAK+KREEMS VLRKMR
Sbjct  61   TELLKVGKDKRALKVAKRKLGSHLRAKKKREEMSTVLRKMR  101



>gb|KFK24742.1| hypothetical protein AALP_AA8G018600 [Arabis alpina]
Length=273

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -3

Query  472  GLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKRA  293
            G    +  TK+E  PRP+ RKGKTSKR  F+K+LIREVAGFAPYEKRITELLKVGKDKRA
Sbjct  176  GFTSQYWFTKREQPPRPNKRKGKTSKRTIFIKNLIREVAGFAPYEKRITELLKVGKDKRA  235

Query  292  LKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            LKVAKRKLGTHKRAKRKREEMS VLRK+RA G  +KKK
Sbjct  236  LKVAKRKLGTHKRAKRKREEMSSVLRKLRAGGVAEKKK  273



>ref|XP_002953563.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ45536.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=99

 Score =   140 bits (353),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -3

Query  487  SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVG  308
            SGL VGLN+GHVVTK+E A RPS  KG+ SKR+ FV+ +IREVAG APYEKRI ELLKVG
Sbjct  4    SGLAVGLNKGHVVTKREQALRPSRTKGRLSKRVKFVREVIREVAGLAPYEKRIMELLKVG  63

Query  307  KDKRALKVAKRKLGTHKRAKRKREEMSGVLRKM  209
            KDKRALKVAKRKLGTH R KRKREE++G++RKM
Sbjct  64   KDKRALKVAKRKLGTHIRGKRKREELAGLMRKM  96



>ref|XP_006450712.1| hypothetical protein CICLE_v10010663mg, partial [Citrus clementina]
 gb|ESR63952.1| hypothetical protein CICLE_v10010663mg, partial [Citrus clementina]
Length=136

 Score =   140 bits (353),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -3

Query  511  GMAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKR  332
             +APK  N+ LFVGLN+GHVVTKKEL PRP++RKGKTSKR++F +++IREVAGF PYEK 
Sbjct  37   AIAPKLPNTDLFVGLNKGHVVTKKELPPRPANRKGKTSKRVHFERNVIREVAGFTPYEKT  96

Query  331  ITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSG  224
            ITELLKV +DKRALK AKRKL TH+  K K EEMS 
Sbjct  97   ITELLKVDEDKRALKAAKRKLSTHEGTKTKCEEMSN  132



>gb|KDO79856.1| hypothetical protein CISIN_1g041684mg, partial [Citrus sinensis]
Length=100

 Score =   139 bits (349),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -3

Query  511  GMAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKR  332
             +APK  N+ LFVGLN+GHVVTKKEL PRP++RKGKTSKR++F +++IREVAGF PYEK 
Sbjct  1    AIAPKLPNTDLFVGLNKGHVVTKKELLPRPANRKGKTSKRVHFERNVIREVAGFTPYEKT  60

Query  331  ITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSG  224
            ITELLKV +DKRALK AKRKL TH+  K K EEMS 
Sbjct  61   ITELLKVDEDKRALKAAKRKLSTHEGTKTKCEEMSN  96



>ref|WP_036770920.1| hypothetical protein, partial [Pontibacillus halophilus]
Length=99

 Score =   137 bits (345),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -3

Query  499  KQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITEL  320
            K   +GL VGLN+GHVVTK+E A RPS  KG+  KR+ FV+ +IR+VAG APYEKRI EL
Sbjct  1    KMVATGLAVGLNKGHVVTKREQAVRPSRTKGRLGKRVKFVREVIRDVAGLAPYEKRIMEL  60

Query  319  LKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
            LKVGKDKRALKVAKRKLGTH R KRKREE++G++RKM+
Sbjct  61   LKVGKDKRALKVAKRKLGTHIRGKRKREELAGLMRKMK  98



>gb|EMS54664.1| 60S ribosomal protein L36-1 [Triticum urartu]
Length=172

 Score =   139 bits (350),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  493  ANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLK  314
            A SGLFVG+N+GHVVTK+EL PRP +RKGK +KR++F ++LIREVA FAPYEKRITELLK
Sbjct  18   AKSGLFVGINKGHVVTKRELPPRPCERKGKGTKRVHFARNLIREVAEFAPYEKRITELLK  77

Query  313  VGKDKRALKVAKRKLGTHKRAKRKR  239
            VGKDKRALKVAKRKLGTHKRAK+K+
Sbjct  78   VGKDKRALKVAKRKLGTHKRAKKKK  102



>ref|XP_001703188.1| ribosomal protein L36, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDO96564.1| ribosomal protein L36, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
Length=98

 Score =   136 bits (343),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = -3

Query  487  SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVG  308
            +GL VGLN+GHVVTK+E A RPS  KG+  KR+ FV+ +IR+VAG APYEKRI ELLKVG
Sbjct  4    TGLAVGLNKGHVVTKREQAVRPSRTKGRLGKRVKFVREVIRDVAGLAPYEKRIMELLKVG  63

Query  307  KDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
            KDKRALKVAKRKLGTH R KRKREE++G++RKM+
Sbjct  64   KDKRALKVAKRKLGTHIRGKRKREELAGLMRKMK  97



>gb|KDO42554.1| hypothetical protein CISIN_1g038355mg, partial [Citrus sinensis]
Length=93

 Score =   134 bits (337),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  HVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKRALKVAK  278
            H+VT KEL PRP D KGKTSKRI+F +++IREVAGFAPYEKRI  LLKVGKDKRALK+AK
Sbjct  1    HIVTNKELLPRPVDPKGKTSKRIHFERNVIREVAGFAPYEKRIDALLKVGKDKRALKLAK  60

Query  277  RKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            RKL T++RAK K  EMS VL +MRATGGG KKK
Sbjct  61   RKLCTYERAKMKHGEMSNVLCRMRATGGGKKKK  93



>ref|XP_006492010.1| PREDICTED: 60S ribosomal protein L36-2-like [Citrus sinensis]
Length=110

 Score =   134 bits (338),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MA KQ N+ LFV  N+GHVVTKKEL    +D KGKTSK ++F +++IR+  GFA YEK I
Sbjct  1    MALKQPNTSLFVRSNKGHVVTKKELPRCLADGKGKTSKIVHFERNVIRQGTGFALYEKMI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            TELLKVG  K ALK+AKRKL THKRAK K EEMS VLR+MRAT GG+KKK
Sbjct  61   TELLKVGNYKSALKLAKRKLSTHKRAKMKSEEMSSVLRRMRATRGGEKKK  110



>ref|XP_006436937.1| hypothetical protein CICLE_v10033467mg, partial [Citrus clementina]
 gb|ESR50177.1| hypothetical protein CICLE_v10033467mg, partial [Citrus clementina]
Length=95

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -3

Query  463  RGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKRALKV  284
            +GH+VTKKEL PRP DRKGKTSKR++F +++I EV+GFAPYEKRI  LLKVGKDKRALK+
Sbjct  1    QGHIVTKKELLPRPVDRKGKTSKRVHFERNVIGEVSGFAPYEKRIDALLKVGKDKRALKL  60

Query  283  AKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            AKRKL T++R K K  EMS VL +MRATGGG KKK
Sbjct  61   AKRKLCTYERGKMKHGEMSNVLCRMRATGGGKKKK  95



>ref|XP_004510960.1| PREDICTED: 60S ribosomal protein L36-3-like isoform X1 [Cicer 
arietinum]
Length=112

 Score =   134 bits (337),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = -3

Query  406  KTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS  227
            KTSKR++FV++LIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS
Sbjct  37   KTSKRVHFVRNLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMS  96

Query  226  GVLRKMRATGGGDKKK  179
             VLRKMRA G GDKKK
Sbjct  97   NVLRKMRAGGAGDKKK  112



>ref|XP_005782836.1| hypothetical protein EMIHUDRAFT_442529 [Emiliania huxleyi CCMP1516]
 gb|EOD30407.1| hypothetical protein EMIHUDRAFT_442529 [Emiliania huxleyi CCMP1516]
Length=114

 Score =   133 bits (334),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = -3

Query  487  SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVG  308
            +GL VG+++GHV+T ++L P+PS RKGK +KR+ FV+ ++REVAG+APYEKR  ELLKVG
Sbjct  19   TGLAVGMDKGHVLTSRDLKPKPSYRKGKLNKRVAFVREIVREVAGYAPYEKRTMELLKVG  78

Query  307  KDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRA  203
            K+KRALKV K KLGTHKRAK KREEMSGVLR  R 
Sbjct  79   KEKRALKVLKNKLGTHKRAKAKREEMSGVLRAQRT  113



>ref|XP_005649688.1| ribosomal protein L36 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE25144.1| ribosomal protein L36 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
Length=100

 Score =   132 bits (333),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 82/99 (83%), Gaps = 4/99 (4%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP    +G+ VGL++GH VTKKE   RP+ RKG+ SKR+ FV+ ++REVAG APYEKR+
Sbjct  1    MAP----TGIAVGLHKGHGVTKKEKVARPAQRKGRLSKRVKFVREIVREVAGLAPYEKRV  56

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRK  212
            TELLKVGKDKRALK+ K+KLGTH RAK+KREEMS ++RK
Sbjct  57   TELLKVGKDKRALKLCKKKLGTHLRAKKKREEMSALMRK  95



>ref|XP_011396354.1| 60S ribosomal protein L36-3 [Auxenochlorella protothecoides]
 gb|KFM23481.1| 60S ribosomal protein L36-3 [Auxenochlorella protothecoides]
Length=98

 Score =   132 bits (332),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -3

Query  493  ANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLK  314
            A +G+ VGL +GHVVTK+E   RP++RKG+ SKR+ FV+ +I+EVAG  PYEKR+ ELLK
Sbjct  2    AKAGIAVGLAKGHVVTKREKVARPAERKGRASKRVKFVRDIIKEVAGQTPYEKRVMELLK  61

Query  313  VGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
            VGKDKRALK+ KRKLGTH RAKRKREEMS +LRK++
Sbjct  62   VGKDKRALKLCKRKLGTHLRAKRKREEMSTLLRKVK  97



>gb|KDD74326.1| ribosomal protein L36e [Helicosporidium sp. ATCC 50920]
Length=98

 Score =   132 bits (332),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = -3

Query  493  ANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLK  314
            AN G+ VGL +GHVVTK+E+ PRPS RKG+ +KR+ F++++IREVAG APYE+R+ ELLK
Sbjct  2    ANQGIAVGLAKGHVVTKREVIPRPSTRKGRPTKRVTFIRNIIREVAGQAPYERRVMELLK  61

Query  313  VGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRK  212
            +G+DK+ALK+ KRKLGTH RAK+KREE+S ++RK
Sbjct  62   IGRDKKALKLCKRKLGTHLRAKKKREELSQLMRK  95



>ref|XP_002463626.1| hypothetical protein SORBIDRAFT_01g003200 [Sorghum bicolor]
 gb|EER90624.1| hypothetical protein SORBIDRAFT_01g003200 [Sorghum bicolor]
Length=159

 Score =   134 bits (336),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 86/122 (70%), Gaps = 14/122 (11%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKG------------KTSKRINFVKSLIR  365
            M P  A +GLFVGLN+GHVVTK++L PRPS  KG            K +KR  FV+ +IR
Sbjct  1    MEPPPAKTGLFVGLNKGHVVTKRKLQPRPSTYKGLPEHIVFWGEFQKATKRACFVRHVIR  60

Query  364  EVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR--ATGGG  191
            E+AG APYEKRIT LL+V KDKRALKVAKRKLGTHKRAK+K EEM  + R+ R  A   G
Sbjct  61   EIAGLAPYEKRITALLRVCKDKRALKVAKRKLGTHKRAKKKHEEMLNLHRRKREPAFDSG  120

Query  190  DK  185
            DK
Sbjct  121  DK  122



>sp|Q9LRB8.1|RL36_ULVCO RecName: Full=60S ribosomal protein L36 [Ulva compressa]
 pir||JC7579 ribosomal protein L36 - green alga (Enteromorpha prolifera)
 dbj|BAA96853.1| ribosomal protein L36 [Enteromorpha compressa]
Length=101

 Score =   131 bits (330),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -3

Query  481  LFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKD  302
            + VGLN+GH VTKK   PRPS RKG  S+R+  V++++REVAG+APYE+R+ ELLKVGKD
Sbjct  4    IAVGLNKGHQVTKKAGTPRPSRRKGFLSQRVKKVRAVVREVAGWAPYERRVMELLKVGKD  63

Query  301  KRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGD  188
            KRALK+ KRKLGTH R K+KREEM+GVLRKM+A   G+
Sbjct  64   KRALKMCKRKLGTHMRGKKKREEMAGVLRKMQAASKGE  101



>ref|XP_002507140.1| 60S ribosomal protein L36 [Micromonas sp. RCC299]
 gb|ACO68398.1| 60S ribosomal protein L36 [Micromonas sp. RCC299]
Length=102

 Score =   127 bits (318),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  487  SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVG  308
             G+ VGL++GHVV+K++LA RPS RKGK  KR+  ++ LIR+V G APYEKR+ ELLKVG
Sbjct  2    DGIAVGLHKGHVVSKRKLAARPSQRKGKLGKRVKMIRDLIRDVVGSAPYEKRLMELLKVG  61

Query  307  KDKRALKVAKRKLGTHKRAKRKREEMSGVLRKM  209
            +DKRALK+AKRKLGTH R K+KREEM  +LRKM
Sbjct  62   RDKRALKLAKRKLGTHLRGKKKREEMGNLLRKM  94



>ref|XP_006420273.1| hypothetical protein CICLE_v10006778mg [Citrus clementina]
 gb|ESR33513.1| hypothetical protein CICLE_v10006778mg [Citrus clementina]
Length=102

 Score =   126 bits (317),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 80/109 (73%), Gaps = 15/109 (14%)
 Frame = -3

Query  505  APKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRIT  326
            APKQ NS LFVGL                DRKGKTSKR++F +++IREVAGFA YEKRI 
Sbjct  9    APKQLNSCLFVGL---------------IDRKGKTSKRVHFERNVIREVAGFASYEKRID  53

Query  325  ELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
             LLKVGKDKRALK+AKRKL T++RAK K  EMS VL +MRATGGG KKK
Sbjct  54   ALLKVGKDKRALKLAKRKLCTYERAKMKHGEMSNVLCRMRATGGGKKKK  102



>ref|XP_010495043.1| PREDICTED: 60S ribosomal protein L36-3-like [Camelina sativa]
Length=128

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -3

Query  412  KGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREE  233
            K KTSKR  F++SLIREVAGFAPYEKRI+ELLKVGKDKRALKVAKRKLGTHKRAKRKREE
Sbjct  47   KQKTSKRTLFIRSLIREVAGFAPYEKRISELLKVGKDKRALKVAKRKLGTHKRAKRKREE  106

Query  232  MSGVLRKMRATGGG  191
            MS VLRKMR+ GGG
Sbjct  107  MSSVLRKMRSGGGG  120



>dbj|BAJ87211.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=76

 Score =   125 bits (313),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -3

Query  400  SKRINFVKSLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGV  221
            +KR++FV+SLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS V
Sbjct  2    TKRVHFVRSLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSV  61

Query  220  LRKMRATGGGDKKK  179
            LRKMR+ G G +KK
Sbjct  62   LRKMRSAGTGTEKK  75



>gb|AFK35178.1| unknown [Lotus japonicus]
Length=86

 Score =   124 bits (312),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 1/72 (1%)
 Frame = -3

Query  391  INFVKSLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRK  212
            ++FV+SLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRK
Sbjct  15   VHFVRSLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSNVLRK  74

Query  211  MRATGG-GDKKK  179
            MR+ GG GDKKK
Sbjct  75   MRSGGGAGDKKK  86



>gb|KFK36650.1| hypothetical protein AALP_AA4G152200 [Arabis alpina]
Length=168

 Score =   126 bits (317),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 89/166 (54%), Gaps = 56/166 (34%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKR------INFVK-SLIREVA--  356
            M   Q  +GLFVGLN+GHV T++ELAPRP+ RKG    R      I F K  L R++   
Sbjct  1    MTTPQVKTGLFVGLNKGHVTTRRELAPRPNSRKGVLKSRSFPIQTIRFSKICLARDLCLE  60

Query  355  -----------------------------------------------GFAPYEKRITELL  317
                                                           GFAPYEKRITELL
Sbjct  61   LGLVYICSGWIEVERFDVVEFCSVKCCVEVKTSKRTIFIRTLIREVAGFAPYEKRITELL  120

Query  316  KVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
            KVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMR+ GG   +K
Sbjct  121  KVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGGAATEK  166



>ref|XP_004986151.1| PREDICTED: uncharacterized protein LOC101772435 [Setaria italica]
Length=202

 Score =   127 bits (320),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            M P  A + LFVG+N GHV+TK+EL PRPS  KGK+ +R  FV+ +IREVAG APYEK I
Sbjct  1    MPPPPAKTVLFVGVNEGHVITKRELPPRPSASKGKSGRRTWFVRHVIREVAGLAPYEKHI  60

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKM  209
              LL+  +DKRALK+AKRKLGTH+R+K+KRE M  VLR+M
Sbjct  61   IGLLRNCRDKRALKLAKRKLGTHRRSKKKREGMLDVLRRM  100



>ref|XP_003074843.1| Rpl36 60S ribosomal protein L36, probable (IC) [Ostreococcus 
tauri]
 emb|CAL52103.2| Ribosomal protein L36e [Ostreococcus tauri]
Length=101

 Score =   124 bits (312),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -3

Query  481  LFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKD  302
            + VGL++GH VTK+E+APRP  RKG+  KR+  ++SLIR+VAG APYE+R+ ELLK G+D
Sbjct  1    MSVGLDKGHAVTKREIAPRPGSRKGRCGKRVGMIRSLIRDVAGSAPYERRLIELLKNGRD  60

Query  301  KRALKVAKRKLGTHKRAKRKREEMSGVLRK  212
            KRALK+AKRKLGTH R K+KREEM  ++RK
Sbjct  61   KRALKLAKRKLGTHLRGKKKREEMGNIMRK  90



>ref|XP_003056517.1| 60S ribosomal protein L36 [Micromonas pusilla CCMP1545]
 gb|EEH59893.1| 60S ribosomal protein L36 [Micromonas pusilla CCMP1545]
Length=99

 Score =   123 bits (309),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = -3

Query  484  GLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGK  305
            G+ VGL +GHVV+K ELA RP+ RKG+  KR+  ++ L+R+V G APYEKR+ ELLKVG+
Sbjct  3    GIAVGLQKGHVVSKHELAARPARRKGRLGKRVKMIRELVRDVVGNAPYEKRLMELLKVGR  62

Query  304  DKRALKVAKRKLGTHKRAKRKREEMSGVLRKM  209
            DKRALK+AKRKLGTH R K+KREEM  +LRKM
Sbjct  63   DKRALKLAKRKLGTHIRGKKKREEMGNLLRKM  94



>ref|XP_001416206.1| 60S ribosomal protein L36, probable [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO94499.1| 60S ribosomal protein L36, probable [Ostreococcus lucimarinus 
CCE9901]
Length=105

 Score =   122 bits (306),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -3

Query  481  LFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKD  302
            + VGL++GH VTK+ELA +P  RKG+  KR+  ++ LIREVAG APYEKR+ ELLK G+D
Sbjct  5    ISVGLDKGHAVTKRELAAKPGSRKGRCGKRVGMIRGLIREVAGSAPYEKRLVELLKNGRD  64

Query  301  KRALKVAKRKLGTHKRAKRKREEMSGVLRK  212
            KRALK+AKRKLGTH RAK+KREEM  ++RK
Sbjct  65   KRALKLAKRKLGTHLRAKKKREEMGNLMRK  94



>gb|KIY96786.1| 60S ribosomal protein L36 [Monoraphidium neglectum]
 gb|KIZ05117.1| 60S ribosomal protein L36 [Monoraphidium neglectum]
Length=110

 Score =   122 bits (305),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -3

Query  493  ANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLK  314
            A SGL  GLN+GHVVT +  A RPS RKG   K++  V+ +IR+VAG APYEKR+ ELLK
Sbjct  2    AKSGLAAGLNKGHVVTPRTTALRPSRRKGYLGKKVKEVREIIRDVAGLAPYEKRVVELLK  61

Query  313  VGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKK  182
            VGKDKRALKVAK+KLGTH R KRKREE++  +RK +     ++K
Sbjct  62   VGKDKRALKVAKKKLGTHLRGKRKREELASYMRKQQKKEAAEQK  105



>gb|KDO66027.1| hypothetical protein CISIN_1g035914mg [Citrus sinensis]
Length=93

 Score =   120 bits (300),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 79/110 (72%), Gaps = 17/110 (15%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            M PKQ+N+GLFVGL+                 KGKTSK ++F +++IREVAGFA Y+K I
Sbjct  1    MVPKQSNTGLFVGLS-----------------KGKTSKGVDFERNVIREVAGFASYKKGI  43

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK  179
             +LLKVGKDKR LKVAK+KLG HKRAK KREEMS VLR  RATGG +K K
Sbjct  44   NKLLKVGKDKRTLKVAKKKLGAHKRAKMKREEMSNVLRWTRATGGEEKTK  93



>ref|XP_005850248.1| hypothetical protein CHLNCDRAFT_141923 [Chlorella variabilis]
 gb|EFN58146.1| hypothetical protein CHLNCDRAFT_141923 [Chlorella variabilis]
Length=93

 Score =   119 bits (298),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 74/95 (78%), Gaps = 8/95 (8%)
 Frame = -3

Query  487  SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVG  308
            +G+ VGL +GHVVTKKE        K + SKR+  V+ ++REVAG APYEKR+ ELLKVG
Sbjct  5    AGIAVGLQKGHVVTKKE--------KARQSKRVKLVRDIVREVAGQAPYEKRLMELLKVG  56

Query  307  KDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRA  203
            +DKRALKVAKRKLGTHKR K KREEMS +LRKM A
Sbjct  57   RDKRALKVAKRKLGTHKRGKAKREEMSALLRKMAA  91



>ref|XP_004961849.1| PREDICTED: 60S ribosomal protein L36-3-like isoform X1 [Setaria 
italica]
Length=139

 Score =   120 bits (301),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 77/102 (75%), Gaps = 2/102 (2%)
 Frame = -3

Query  481  LFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKD  302
            L VGL+     T   L     D + K +KR+  V+ LIREVAGFAPYEKRITELLKVGKD
Sbjct  39   LLVGLSFSLDGTFSVLTSYYHDLQ-KATKRVTMVRGLIREVAGFAPYEKRITELLKVGKD  97

Query  301  KRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGG-GDKKK  179
            KRALKVAKRKLGTHKRAK+KREEM+ VLRKMR+ G   DKKK
Sbjct  98   KRALKVAKRKLGTHKRAKKKREEMANVLRKMRSAGTHTDKKK  139



>ref|XP_001626706.1| predicted protein [Nematostella vectensis]
 gb|EDO34606.1| predicted protein [Nematostella vectensis]
Length=106

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 76/101 (75%), Gaps = 3/101 (3%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAPK     + VGL +GH VTK    P+PS RKG ++KR+ FV+ ++REV GFAPYEKR+
Sbjct  1    MAPKVE---MAVGLQKGHKVTKNVTKPKPSRRKGASNKRVKFVRDVVREVVGFAPYEKRV  57

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
             ELL++GKDKRALK  K++LGTH R KRKREE++ VL  MR
Sbjct  58   MELLRIGKDKRALKFCKKRLGTHVRGKRKREEITSVLAAMR  98



>gb|AGH70180.1| 60S ribosomal protein L36 [Placozoa sp. H4]
Length=100

 Score =   118 bits (295),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -3

Query  481  LFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKD  302
            + VGLN+GH VTK  + PRPS RKG TSKR+  ++ L+REV GFAPYEKR+ ELLKVG+D
Sbjct  5    MAVGLNKGHRVTKIAVKPRPSRRKGTTSKRVRAIRELMREVTGFAPYEKRVMELLKVGRD  64

Query  301  KRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
            KRALK  K+++G H R+KRKREE+  VL++MR
Sbjct  65   KRALKFIKKRVGNHTRSKRKREELGRVLQQMR  96



>emb|CDM81131.1| unnamed protein product [Triticum aestivum]
Length=82

 Score =   117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  406  KTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS  227
            K +KR+ FV++LIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS
Sbjct  4    KGTKRVQFVRNLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMS  63

Query  226  GVLRKMRA  203
             VLRKMR+
Sbjct  64   SVLRKMRS  71



>ref|XP_002111013.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV27017.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=100

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = -3

Query  481  LFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKD  302
            + VGLN+GH VTK  +  RPS RKG TSKR+ FV+ L+REV+GFAPYEKR+ ELLKVG+D
Sbjct  5    MAVGLNKGHRVTKIAVKRRPSRRKGTTSKRVRFVRELVREVSGFAPYEKRVMELLKVGRD  64

Query  301  KRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
            KRALK  K+++G H R+KRKR+E+  +L++MR
Sbjct  65   KRALKFIKKRVGNHTRSKRKRDELGRILQQMR  96



>gb|AFG65289.1| hypothetical protein CL823Contig1_01, partial [Pinus taeda]
 gb|AFG65290.1| hypothetical protein CL823Contig1_01, partial [Pinus taeda]
Length=80

 Score =   117 bits (293),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -3

Query  532  SQNQIERGMAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAG  353
            S+ + E  MAP Q  SG+FVGLN+GH+VTK+ELAPRPS  KGK SKR +FV+ LIREVAG
Sbjct  4    SRKKEEATMAPAQPKSGIFVGLNKGHIVTKRELAPRPSANKGKRSKRTDFVRKLIREVAG  63

Query  352  FAPYEKRITELLKVGKD  302
            FAPYEKRITELLKVGKD
Sbjct  64   FAPYEKRITELLKVGKD  80



>ref|XP_005703824.1| 60S ribosomal protein L36e [Galdieria sulphuraria]
 gb|EME27304.1| 60S ribosomal protein L36e [Galdieria sulphuraria]
Length=103

 Score =   117 bits (292),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 79/97 (81%), Gaps = 5/97 (5%)
 Frame = -3

Query  487  SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVG  308
            SG+ VGLN+GHVVTK++L+ +    +G+  KR  FV+ +IREV GFAPYEKRI ELL+VG
Sbjct  10   SGIAVGLNKGHVVTKRKLSTKG---RGRVKKRSRFVREVIREVCGFAPYEKRIVELLRVG  66

Query  307  KDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATG  197
            KDKRALK AK++LGTH RAK+KR+EM+ VLR  R+TG
Sbjct  67   KDKRALKYAKKRLGTHLRAKKKRDEMATVLR--RSTG  101



>gb|ACO11656.1| 60S ribosomal protein L36 [Caligus rogercresseyi]
Length=102

 Score =   115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 75/101 (74%), Gaps = 3/101 (3%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP+     + VGL++GH  TK EL  RP+ RKG ++ R  F++ L+REVAGF+PYE+R 
Sbjct  1    MAPRYE---MCVGLDKGHKTTKNELKKRPASRKGMSTTRTRFIRDLVREVAGFSPYERRA  57

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
             ELL++ KDKR LK  K+++G+H RAKRKREEMS VL+ MR
Sbjct  58   MELLRISKDKRCLKFLKKRIGSHIRAKRKREEMSNVLQAMR  98



>gb|ESA02313.1| hypothetical protein GLOINDRAFT_38702 [Rhizophagus irregularis 
DAOM 181602]
Length=102

 Score =   115 bits (287),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 77/101 (76%), Gaps = 2/101 (2%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MA KQ  SG+ VGLN+GH V+ +E  P+PS RKG  S R+ FV+ LIREVAG+APYEKR+
Sbjct  1    MADKQ--SGIVVGLNKGHKVSAREARPKPSRRKGVLSHRVKFVRELIREVAGYAPYEKRV  58

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
             ELLK  KDKRA K+AK++LGT  RAKRK EE+S ++ + R
Sbjct  59   MELLKNSKDKRARKLAKKRLGTFVRAKRKVEELSNIIAESR  99



>ref|XP_009025143.1| hypothetical protein HELRODRAFT_67827 [Helobdella robusta]
 gb|ESN96142.1| hypothetical protein HELRODRAFT_67827 [Helobdella robusta]
Length=103

 Score =   115 bits (287),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = -3

Query  481  LFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKD  302
            + VGL +GH V+K     RPS RKG  +K   FV+ L+R+V GFAPYEKR  ELLKVGKD
Sbjct  7    MAVGLKKGHKVSKLAKRKRPSTRKGTQTKHAKFVRDLVRDVCGFAPYEKRSMELLKVGKD  66

Query  301  KRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
            KRALK  KR+LGTH R KRKREEMS V++KMR
Sbjct  67   KRALKFCKRRLGTHLRGKRKREEMSTVIQKMR  98



>ref|XP_005536754.1| 60S ribosomal protein L36 [Cyanidioschyzon merolae strain 10D]
 dbj|BAM80718.1| 60S ribosomal protein L36 [Cyanidioschyzon merolae strain 10D]
Length=98

 Score =   114 bits (286),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = -3

Query  490  NSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKV  311
            + G+ VG  +GH VTK+ L  RP+ RKG+ SKR  FV++LIREV GFAPYE+RI ELL++
Sbjct  5    SEGVAVGKQKGHQVTKRVLPVRPAQRKGQLSKRTQFVRALIREVVGFAPYERRIMELLRI  64

Query  310  GKDKRALKVAKRKLGTHKRAKRKREEMSGVLRK  212
            GKDKRALK AKR+LGT  RAKRK  E++  LR+
Sbjct  65   GKDKRALKFAKRRLGTQTRAKRKISELADALRR  97



>gb|EXX78590.1| ribosomal 60S subunit protein L36A [Rhizophagus irregularis DAOM 
197198w]
Length=109

 Score =   115 bits (287),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 78/106 (74%), Gaps = 5/106 (5%)
 Frame = -3

Query  508  MAPKQAN-----SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAP  344
            MA KQA      SG+ VGLN+GH V+ +E  P+PS RKG  S R+ FV+ LIREVAG+AP
Sbjct  1    MADKQAKEKKPKSGIVVGLNKGHKVSAREARPKPSRRKGVLSHRVKFVRELIREVAGYAP  60

Query  343  YEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
            YEKR+ ELLK  KDKRA K+AK++LGT  RAKRK EE+S ++ + R
Sbjct  61   YEKRVMELLKNSKDKRARKLAKKRLGTFVRAKRKVEELSNIIAESR  106



>gb|AEB54643.1| ribosomal protein L36 [Procambarus clarkii]
Length=119

 Score =   115 bits (287),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 73/101 (72%), Gaps = 3/101 (3%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP+     + VGLN+GH VTK    P+PS RKGK +K   FV+ +IREV GFAPYEKR 
Sbjct  1    MAPRYE---MAVGLNKGHKVTKNTRKPKPSSRKGKITKHNKFVRDIIREVMGFAPYEKRT  57

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
             ELLKV KDKRALK  K++LGTH RAKRKREEM  V+ + R
Sbjct  58   IELLKVSKDKRALKFLKKRLGTHIRAKRKREEMQRVMGQQR  98



>gb|ABG74908.1| ribosomal protein L36e [Artemia franciscana]
Length=105

 Score =   114 bits (285),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = -3

Query  490  NSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKV  311
            N  L VGLN+GH  TK   APRPS R GK SK   F+KS++ EV G APYEKR  ELLKV
Sbjct  5    NFDLAVGLNKGHKTTKNVQAPRPSRRIGKQSKHNKFIKSIVTEVVGHAPYEKRAMELLKV  64

Query  310  GKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
             KDKRALK  K++LGTH RAK+KREE+  VL +MR
Sbjct  65   SKDKRALKFLKKRLGTHIRAKKKREELGNVLTQMR  99



>ref|XP_006442634.1| hypothetical protein CICLE_v10023654mg [Citrus clementina]
 gb|ESR55874.1| hypothetical protein CICLE_v10023654mg [Citrus clementina]
Length=77

 Score =   113 bits (282),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -3

Query  478  FVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDK  299
               + +GH+VTKKEL PRP DRKGKTSKR++F +++IREVAGFAPYEKRI  LLKVGKDK
Sbjct  4    ICWIKQGHIVTKKELLPRPVDRKGKTSKRVHFERNVIREVAGFAPYEKRINALLKVGKDK  63

Query  298  RALKVAKRKLGTH  260
            RALK+AKRKL TH
Sbjct  64   RALKLAKRKLCTH  76



>ref|XP_002602280.1| hypothetical protein BRAFLDRAFT_279545 [Branchiostoma floridae]
 gb|EEN58292.1| hypothetical protein BRAFLDRAFT_279545 [Branchiostoma floridae]
Length=103

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -3

Query  481  LFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKD  302
            + VGLN+GH +TK    PRPS RKGK +KR  FV+ L+REV GFAPYE+R  ELLKV KD
Sbjct  7    MCVGLNKGHKITKNVQKPRPSRRKGKLTKRAKFVRDLVREVTGFAPYERRTMELLKVSKD  66

Query  301  KRALKVAKRKLGTHKRAKRKREEMSGVL  218
            KRALK  K+++GT +RAKRKREEM  V+
Sbjct  67   KRALKFLKKRVGTLQRAKRKREEMQNVI  94



>gb|EPZ34903.1| 60S ribosomal protein L36-B [Rozella allomycis CSF55]
Length=105

 Score =   113 bits (283),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = -3

Query  490  NSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKV  311
            NSG+ VGLN+G  VTK+ L  +PS RKG   KR  FV+ LIREVAGFAPYEKRI ELLK 
Sbjct  6    NSGIAVGLNKGRDVTKRALPQKPSQRKGFCGKRTQFVRGLIREVAGFAPYEKRIMELLKN  65

Query  310  GKDKRALKVAKRKLGTHKRAKRKREEMSGVL  218
            G+DKRA K+ KR+LGT +RAKRK EE++ V+
Sbjct  66   GRDKRARKLTKRRLGTLRRAKRKIEELNNVI  96



>ref|XP_006678782.1| hypothetical protein BATDEDRAFT_88084 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF81011.1| hypothetical protein BATDEDRAFT_88084 [Batrachochytrium dendrobatidis 
JAM81]
Length=112

 Score =   113 bits (283),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = -3

Query  502  PKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITE  323
            P    +G+  G+N+GHV T+K+LAP+P ++KG   KR  FV+ L+REV GF+PYEKR+ E
Sbjct  7    PPVQKTGIAAGINKGHVTTRKQLAPKPVNKKGVLGKRTKFVRDLVREVVGFSPYEKRVME  66

Query  322  LLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
            LLK  KDKRA KVAK++LGT +RAKRK EE+S V+ + R
Sbjct  67   LLKNSKDKRARKVAKKRLGTLRRAKRKVEELSNVIAESR  105



>gb|AAN52381.1| ribosomal protein L36 [Branchiostoma belcheri]
Length=103

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -3

Query  481  LFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKD  302
            + VGLN+GH +TK    PRPS RKGK +K + FV+ L+REV GFAPYE+R  ELLKV KD
Sbjct  7    MCVGLNKGHKITKNVQKPRPSRRKGKLTKHVKFVRDLVREVTGFAPYERRTMELLKVSKD  66

Query  301  KRALKVAKRKLGTHKRAKRKREEMSGVL  218
            KRALK  K+++GT +RAKRKREEM  V+
Sbjct  67   KRALKFLKKRVGTLQRAKRKREEMQNVI  94



>gb|KGG51704.1| 60S ribosomal protein L36 [Microsporidia sp. UGP3]
Length=109

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = -3

Query  484  GLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGK  305
            G+ VGLN+GHV  +K L P+PS+RKG    R+ FV+SLIREV GFAPYEKRI ELLK  K
Sbjct  13   GIVVGLNKGHVTARKALPPKPSNRKGHLGTRVKFVRSLIREVVGFAPYEKRIMELLKNNK  72

Query  304  DKRALKVAKRKLGTHKRAKRKREEMSGVL  218
            DKRA K+AK +LGT+ R K+K EE+S V+
Sbjct  73   DKRARKLAKARLGTYIRGKKKVEELSNVI  101



>sp|Q4PM12.1|RL36_IXOSC RecName: Full=60S ribosomal protein L36 [Ixodes scapularis]
 gb|AAY66953.1| ribosomal protein L36 [Ixodes scapularis]
Length=110

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = -3

Query  481  LFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKD  302
            L VGL +GH VTK E  PRPS RKG  SK   FV+ LIREV GFAP+E+R  ELLKV KD
Sbjct  7    LAVGLGKGHKVTKNEYKPRPSRRKGALSKHTRFVRDLIREVCGFAPFERRAMELLKVSKD  66

Query  301  KRALKVAKRKLGTHKRAKRKREEMSGVL  218
            KRALK  K++LGTH R KRKR+E+S VL
Sbjct  67   KRALKFIKKRLGTHLRGKRKRDELSNVL  94



>gb|EPX71888.1| 60S ribosomal protein L36 [Schizosaccharomyces octosporus yFS286]
 gb|EPX72414.1| 60S ribosomal protein L36 [Schizosaccharomyces octosporus yFS286]
Length=99

 Score =   112 bits (280),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 78/101 (77%), Gaps = 5/101 (5%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP     GL VGLN+G  +TK++L  RPS RKG+ SKR  FV+S++REVAGFAPYE+R+
Sbjct  1    MAP-----GLVVGLNKGKALTKRQLPERPSRRKGQQSKRTTFVRSIVREVAGFAPYERRV  55

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
             EL++  +DKRA K+AK++LGT KRAK K EE++GV++  R
Sbjct  56   MELIRNSQDKRARKLAKKRLGTLKRAKGKIEELTGVIQSSR  96



>ref|XP_006449933.1| hypothetical protein CICLE_v10017552mg, partial [Citrus clementina]
 gb|ESR63173.1| hypothetical protein CICLE_v10017552mg, partial [Citrus clementina]
Length=85

 Score =   112 bits (279),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 72/88 (82%), Gaps = 3/88 (3%)
 Frame = -3

Query  469  LNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKRAL  290
            + +GH+VTKKEL PRP DRKGKTSKR++F +++IREV+GFAPYEKRI  LLKVGKDKRAL
Sbjct  1    IKQGHIVTKKELLPRPVDRKGKTSKRVHFERNVIREVSGFAPYEKRIDALLKVGKDKRAL  60

Query  289  KVAKRKLGTHKRAKRKREEMSGVLRKMR  206
            K+AKRKL T++  +R   E S ++R  R
Sbjct  61   KLAKRKLCTYESLQR---ESSALMRGQR  85



>gb|ACO12212.1| 60S ribosomal protein L36 [Lepeophtheirus salmonis]
 gb|ADD38254.1| 60S ribosomal protein L36 [Lepeophtheirus salmonis]
Length=102

 Score =   112 bits (279),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 74/101 (73%), Gaps = 3/101 (3%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP+     + +GL++GH  TK EL  +PS RKG  + R  F++ ++REVAGF+PYE+R 
Sbjct  1    MAPRYE---MCIGLDKGHKTTKNELKKKPSSRKGMVTTRSRFIRDIVREVAGFSPYERRA  57

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
             ELL++ KDKR LK  K+++G+H RA+RKREEMS VL+ MR
Sbjct  58   MELLRISKDKRCLKFLKKRIGSHVRARRKREEMSAVLQAMR  98



>emb|CCQ18647.1| 60S ribosomal protein L36 [Sycon ciliatum]
Length=104

 Score =   112 bits (279),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = -3

Query  481  LFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKD  302
            + VGLN+GH VTK     RP  RKG  +KR+ FV+ ++REV GFAPYEKR  ELLKVGKD
Sbjct  7    MAVGLNKGHKVTKNAAKSRPVRRKGTLNKRVKFVRDIVREVVGFAPYEKRAMELLKVGKD  66

Query  301  KRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
            KRALK  K++LG H R KRKR+E+S  L+ MR
Sbjct  67   KRALKFVKKRLGAHIRGKRKRDELSAHLQAMR  98



>ref|NP_587850.1| 60S ribosomal protein L36 [Schizosaccharomyces pombe 972h-]
 sp|Q92365.2|RL36A_SCHPO RecName: Full=60S ribosomal protein L36-A [Schizosaccharomyces 
pombe 972h-]
 emb|CAA20698.1| 60S ribosomal protein L36 [Schizosaccharomyces pombe]
Length=99

 Score =   112 bits (279),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 79/101 (78%), Gaps = 5/101 (5%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP     GL VGLN+G V+TK++L  RPS RKG+ SKR +FV+S++REVAGFAPYE+R+
Sbjct  1    MAP-----GLVVGLNKGKVLTKRQLPERPSRRKGQLSKRTSFVRSIVREVAGFAPYERRV  55

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
             EL++  +DKRA K+AK++LGT KRAK K EE++ V++  R
Sbjct  56   MELIRNSQDKRARKLAKKRLGTLKRAKGKIEELTSVIQSSR  96



>gb|ACG47156.1| 60S ribosomal protein L36-2 [Zea mays]
Length=90

 Score =   111 bits (278),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP Q  SGLFVG+N+GHVVTK+EL PRP  RKGK++KR++ V+ LIREVAGFAPYEKRI
Sbjct  1    MAPPQPKSGLFVGINKGHVVTKRELPPRPCHRKGKSTKRVSMVRGLIREVAGFAPYEKRI  60

Query  328  TELLKVGK  305
            TELLKVGK
Sbjct  61   TELLKVGK  68



>gb|EDL08532.1| mCG17441 [Mus musculus]
Length=105

 Score =   112 bits (279),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = -3

Query  481  LFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKD  302
            + VGLN+GH VTK    PR S R+G+ +K   FV+ +IREV GFAPYE+R  ELLKV KD
Sbjct  7    MAVGLNKGHKVTKNVSEPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKD  66

Query  301  KRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
            KRALK  K+++GTH RAKRKREE+S VL  MR
Sbjct  67   KRALKFIKKRVGTHIRAKRKREELSNVLAAMR  98



>gb|EDL38178.1| mCG5564 [Mus musculus]
Length=118

 Score =   112 bits (279),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 73/107 (68%), Gaps = 3/107 (3%)
 Frame = -3

Query  538  RPSQNQIERGMAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREV  359
            RP    I   MA +     + VGLN+GH VTK    PR S R+G+ +K   FV+ +IREV
Sbjct  4    RPPSESISTAMALRYP---MAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREV  60

Query  358  AGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVL  218
             GFAPYE+R  ELLKV KDKRALK  K+++GTH RAKRKREE+S VL
Sbjct  61   CGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNVL  107



>gb|EDL30578.1| mCG14445 [Mus musculus]
Length=104

 Score =   111 bits (278),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = -3

Query  475  VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR  296
            VGLN+GH VTK    PR S R+G  +K   FV+ +IREV GFAPYE+R  ELLKV KDKR
Sbjct  9    VGLNKGHKVTKNVSKPRHSRRRGCLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKR  68

Query  295  ALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGD  188
            ALK  K+++GTH RAKRKREE+S VL  MR     D
Sbjct  69   ALKFIKKRVGTHIRAKRKREELSNVLAVMRKAAKKD  104



>gb|EPY49944.1| 60S ribosomal protein L36 [Schizosaccharomyces cryophilus OY26]
 gb|EPY54015.1| 60S ribosomal protein L36 [Schizosaccharomyces cryophilus OY26]
Length=99

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 78/101 (77%), Gaps = 5/101 (5%)
 Frame = -3

Query  508  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI  329
            MAP     GL VGLN+G  +TK++L  RPS RKG  SKR +FV+S++REVAGFAPYE+R+
Sbjct  1    MAP-----GLVVGLNKGKALTKRQLPERPSRRKGHQSKRTSFVRSVVREVAGFAPYERRV  55

Query  328  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
             EL++  +DKRA K+AK++LGT KRAK K EE++GV++  R
Sbjct  56   MELIRNSQDKRARKLAKKRLGTLKRAKGKIEELTGVIQSSR  96



>ref|XP_006776262.1| PREDICTED: 60S ribosomal protein L36-like [Myotis davidii]
Length=105

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -3

Query  475  VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR  296
            VGLN+GH VTK    PR S R+G+ +K   FV+ +IREV GFAPYE+R TELLKV KDKR
Sbjct  9    VGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRATELLKVSKDKR  68

Query  295  ALKVAKRKLGTHKRAKRKREEMSGVL  218
            ALK  K+++GTH RAKRKREE+S VL
Sbjct  69   ALKFIKKRVGTHIRAKRKREELSNVL  94



>ref|XP_003448819.1| PREDICTED: 60S ribosomal protein L36-like [Oreochromis niloticus]
 ref|XP_004569377.1| PREDICTED: 60S ribosomal protein L36-like isoform X1 [Maylandia 
zebra]
 ref|XP_004569378.1| PREDICTED: 60S ribosomal protein L36-like isoform X2 [Maylandia 
zebra]
 ref|XP_006803655.1| PREDICTED: 60S ribosomal protein L36-like [Neolamprologus brichardi]
Length=105

 Score =   110 bits (276),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -3

Query  475  VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR  296
            VGLN+GH VTK   AP+ S R+G+ +K   FV+ +IREV GFAPYE+R  ELLKV KDKR
Sbjct  9    VGLNKGHPVTKNVTAPKHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKR  68

Query  295  ALKVAKRKLGTHKRAKRKREEMSGVL  218
            ALK  K+++GTH RAKRKREE+S VL
Sbjct  69   ALKFIKKRIGTHIRAKRKREELSNVL  94



>ref|XP_003369234.1| 60S ribosomal protein L36 [Trichinella spiralis]
 gb|EFV51123.1| 60S ribosomal protein L36 [Trichinella spiralis]
Length=158

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = -3

Query  481  LFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKD  302
            L VGLN+GH VT  +   +PS RKGK  KR+ FV+ LIREV GFAPYE+R  ELL++ KD
Sbjct  51   LAVGLNKGHKVTPYKKRIKPSSRKGKLHKRVKFVRDLIREVCGFAPYERRAMELLRISKD  110

Query  301  KRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
            K+ALK  KR++G+H+RAK KR+EM GVL  MR
Sbjct  111  KKALKYLKRRIGSHRRAKSKRDEMQGVLIAMR  142



>gb|ACN09945.1| 60S ribosomal protein L36 [Salmo salar]
 gb|ACN12292.1| 60S ribosomal protein L36 [Salmo salar]
Length=105

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = -3

Query  481  LFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKD  302
            + VGLN+GH VTK   AP+ + R+G+ +K   FV+ +IREV GFAPYE+R  ELLKV KD
Sbjct  7    MAVGLNKGHPVTKNVTAPKHARRRGRLTKHSKFVRDMIREVCGFAPYERRAMELLKVSKD  66

Query  301  KRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
            KRALK  K+++GTH RAKRKREE+S VL  MR
Sbjct  67   KRALKFIKKRIGTHIRAKRKREELSIVLSAMR  98



>ref|XP_005948486.1| PREDICTED: 60S ribosomal protein L36-like [Haplochromis burtoni]
Length=105

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -3

Query  475  VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR  296
            VGLN+GH VTK   AP+ S R+G+ +K   FV+ +IREV GFAPYE+R  ELLKV KDKR
Sbjct  9    VGLNKGHPVTKNVAAPKHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKR  68

Query  295  ALKVAKRKLGTHKRAKRKREEMSGVL  218
            ALK  K+++GTH RAKRKREE+S VL
Sbjct  69   ALKFIKKRIGTHIRAKRKREELSNVL  94



>ref|XP_004067689.1| PREDICTED: 60S ribosomal protein L36 [Oryzias latipes]
 ref|XP_004067690.1| PREDICTED: 60S ribosomal protein L36 [Oryzias latipes]
 ref|XP_004067691.1| PREDICTED: 60S ribosomal protein L36 [Oryzias latipes]
Length=105

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -3

Query  475  VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR  296
            VGLN+GH VTK   AP+ S R+G+ +K   FV+ +IREV GFAPYE+R  ELLKV KDKR
Sbjct  9    VGLNKGHPVTKNVAAPKHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKR  68

Query  295  ALKVAKRKLGTHKRAKRKREEMSGVL  218
            ALK  K+++GTH RAKRKREE+S VL
Sbjct  69   ALKFIKKRIGTHIRAKRKREELSNVL  94



>ref|XP_009495627.1| 50S ribosomal protein L36e [Fonticula alba]
 gb|KCV70021.1| 50S ribosomal protein L36e [Fonticula alba]
Length=102

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = -3

Query  487  SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVG  308
            SG  +G+N GH+VT +EL  RP  RKG  SKR+  V+ LIREVAG APYEKRI ELL+VG
Sbjct  6    SGKSLGINAGHIVTVRELPTRPVQRKGVVSKRVKHVRELIREVAGLAPYEKRIIELLRVG  65

Query  307  KDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR  206
            KDKRA ++ K++LGT  RAKRK +EMS +L + R
Sbjct  66   KDKRARRLTKKRLGTLVRAKRKVDEMSAILVQQR  99



>ref|XP_005989906.1| PREDICTED: 60S ribosomal protein L36 [Latimeria chalumnae]
Length=105

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -3

Query  475  VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR  296
            +GLN+GHVVTK    PR   R+G+ +K   FV+ +IREV GFAPYE+R  ELLKV KDKR
Sbjct  9    IGLNKGHVVTKNVSKPRQCRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKR  68

Query  295  ALKVAKRKLGTHKRAKRKREEMSGVL  218
            ALK  K+++GTH RAKRKREE+S +L
Sbjct  69   ALKFIKKRVGTHIRAKRKREELSNIL  94



>ref|XP_005713313.1| 60S ribosomal protein L36 [Chondrus crispus]
 emb|CDF33510.1| 60S ribosomal protein L36 [Chondrus crispus]
Length=97

 Score =   110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 74/96 (77%), Gaps = 1/96 (1%)
 Frame = -3

Query  487  SGLFVGLNRGHVVTKK-ELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKV  311
            +G+ VG+N+GH+VTK+  LA R S  KG+ + R   V+ +++EV GF+PYEKRI ELL++
Sbjct  2    AGIAVGINKGHIVTKRIPLAKRSSHTKGRVTVRGEVVRQVMKEVVGFSPYEKRIIELLRI  61

Query  310  GKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRA  203
            GKDKRALK AK++LGTH RAKRKREEMS  LR  R 
Sbjct  62   GKDKRALKFAKKRLGTHIRAKRKREEMSEALRSKRG  97



>gb|EIE83316.1| 50S ribosomal protein L36e [Rhizopus delemar RA 99-880]
Length=101

 Score =   110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = -3

Query  493  ANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLK  314
            A SG+ VG+N+GH+  ++EL  +PS++ G  SKR  FVKS++REVAG+APYE+R+ EL+K
Sbjct  4    AKSGIAVGINKGHITARRELKAKPSNKIGAASKRTTFVKSIVREVAGYAPYERRLMELIK  63

Query  313  VGKDKRALKVAKRKLGTHKRAKRKREEMSGVL  218
              KDKRA K+ K KLGT  RAK+K EE+ GV+
Sbjct  64   NSKDKRAKKLCKSKLGTFVRAKKKIEELQGVI  95



>ref|XP_008280071.1| PREDICTED: 60S ribosomal protein L36 [Stegastes partitus]
 ref|XP_010739625.1| PREDICTED: 60S ribosomal protein L36 [Larimichthys crocea]
Length=105

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -3

Query  475  VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR  296
            VGLN+GH VTK   AP+ S R+G+ +K   FV+ +IREV GFAPYE+R  ELLKV KDKR
Sbjct  9    VGLNKGHPVTKNVTAPKHSRRRGRLTKHSKFVRDMIREVCGFAPYERRAMELLKVSKDKR  68

Query  295  ALKVAKRKLGTHKRAKRKREEMSGVL  218
            ALK  K+++GTH RAKRKREE+S VL
Sbjct  69   ALKFIKKRIGTHIRAKRKREELSNVL  94



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880