BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF022J09

Length=756
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AGZ20104.1|  copper methylamine oxidase-like protein                 277   6e-84   Camellia sinensis [black tea]
gb|KCW86673.1|  hypothetical protein EUGRSUZ_B032971                    264   3e-83   Eucalyptus grandis [rose gum]
emb|CDP13211.1|  unnamed protein product                                262   3e-83   Coffea canephora [robusta coffee]
gb|KHN13432.1|  Copper methylamine oxidase                              267   2e-80   Glycine soja [wild soybean]
ref|NP_001237782.1|  peroxisomal copper-containing amine oxidase        266   4e-80   
ref|XP_006584631.1|  PREDICTED: peroxisomal copper-containing ami...    267   6e-80   
emb|CBI14968.3|  unnamed protein product                                272   6e-80   Vitis vinifera
ref|XP_003551224.1|  PREDICTED: peroxisomal primary amine oxidase...    266   1e-79   Glycine max [soybeans]
ref|XP_010646479.1|  PREDICTED: copper amine oxidase 1 isoform X2       265   1e-79   Vitis vinifera
emb|CAN62304.1|  hypothetical protein VITISV_023689                     265   1e-79   Vitis vinifera
ref|XP_010044582.1|  PREDICTED: peroxisomal primary amine oxidase...    266   1e-79   Eucalyptus grandis [rose gum]
ref|XP_002273532.2|  PREDICTED: copper amine oxidase 1 isoform X1       266   2e-79   Vitis vinifera
ref|XP_007044778.1|  Copper amine oxidase family protein isoform 2      265   3e-79   
ref|XP_010248627.1|  PREDICTED: copper amine oxidase 1-like             265   3e-79   Nelumbo nucifera [Indian lotus]
ref|XP_010251089.1|  PREDICTED: copper amine oxidase 1-like isofo...    264   6e-79   Nelumbo nucifera [Indian lotus]
ref|XP_006438284.1|  hypothetical protein CICLE_v10030749mg             263   6e-79   
ref|XP_010251088.1|  PREDICTED: copper amine oxidase 1-like isofo...    264   8e-79   Nelumbo nucifera [Indian lotus]
ref|XP_006483934.1|  PREDICTED: copper amine oxidase 1-like             264   9e-79   Citrus sinensis [apfelsine]
ref|XP_006438285.1|  hypothetical protein CICLE_v10030749mg             263   1e-78   Citrus clementina [clementine]
ref|XP_007044777.1|  Copper amine oxidase family protein isoform 1      264   1e-78   
ref|XP_004509661.1|  PREDICTED: copper methylamine oxidase-like i...    263   1e-78   Cicer arietinum [garbanzo]
ref|XP_006438286.1|  hypothetical protein CICLE_v10030749mg             263   2e-78   
ref|XP_008777611.1|  PREDICTED: copper amine oxidase 1-like             247   2e-78   Phoenix dactylifera
ref|XP_009600855.1|  PREDICTED: copper amine oxidase 1-like             263   2e-78   Nicotiana tomentosiformis
ref|XP_011045265.1|  PREDICTED: copper amine oxidase 1-like isofo...    261   2e-78   Populus euphratica
ref|XP_010102489.1|  Putative primary amine oxidase 2                   261   2e-78   
ref|XP_011045264.1|  PREDICTED: copper amine oxidase 1-like isofo...    262   3e-78   Populus euphratica
ref|XP_002314600.1|  copper amine oxidase family protein                261   3e-78   Populus trichocarpa [western balsam poplar]
ref|XP_002277961.1|  PREDICTED: copper amine oxidase 1-like             263   3e-78   Vitis vinifera
gb|KDO82258.1|  hypothetical protein CISIN_1g004080mg                   260   5e-78   Citrus sinensis [apfelsine]
ref|XP_009802912.1|  PREDICTED: peroxisomal primary amine oxidase...    262   5e-78   Nicotiana sylvestris
gb|KEH20158.1|  copper amine oxidase, enzyme domain protein             260   6e-78   Medicago truncatula
gb|AES96091.2|  copper amine oxidase, enzyme domain protein             261   7e-78   Medicago truncatula
gb|KDP31040.1|  hypothetical protein JCGZ_11416                         261   7e-78   Jatropha curcas
gb|KEH20159.1|  copper amine oxidase, enzyme domain protein             261   7e-78   Medicago truncatula
gb|KEH20163.1|  copper amine oxidase, enzyme domain protein             260   7e-78   Medicago truncatula
ref|XP_003613133.1|  Copper amine oxidase                               261   8e-78   
gb|KDO82257.1|  hypothetical protein CISIN_1g004080mg                   261   8e-78   Citrus sinensis [apfelsine]
gb|KEH20157.1|  copper amine oxidase, enzyme domain protein             261   8e-78   Medicago truncatula
ref|XP_002527922.1|  copper amine oxidase, putative                     261   1e-77   Ricinus communis
ref|XP_002318664.1|  hypothetical protein POPTR_0012s08630g             260   1e-77   
gb|KCW83296.1|  hypothetical protein EUGRSUZ_B00228                     266   2e-77   Eucalyptus grandis [rose gum]
ref|XP_008389732.1|  PREDICTED: copper amine oxidase 1-like isofo...    261   2e-77   Malus domestica [apple tree]
ref|XP_008389733.1|  PREDICTED: copper amine oxidase 1-like isofo...    260   2e-77   
ref|XP_004239124.1|  PREDICTED: copper amine oxidase 1                  260   2e-77   Solanum lycopersicum
ref|XP_002322194.2|  hypothetical protein POPTR_0015s09450g             260   2e-77   
gb|KJB50258.1|  hypothetical protein B456_008G160800                    260   2e-77   Gossypium raimondii
ref|XP_003519633.1|  PREDICTED: copper amine oxidase 1-like             260   2e-77   Glycine max [soybeans]
ref|XP_011047815.1|  PREDICTED: copper amine oxidase 1-like isofo...    260   2e-77   Populus euphratica
ref|XP_004489782.1|  PREDICTED: copper methylamine oxidase-like         259   3e-77   Cicer arietinum [garbanzo]
gb|AIS23648.1|  amine oxidase 5                                         260   3e-77   Malus domestica [apple tree]
ref|XP_002511334.1|  copper amine oxidase, putative                     260   3e-77   Ricinus communis
gb|KJB50254.1|  hypothetical protein B456_008G160800                    260   3e-77   Gossypium raimondii
ref|XP_011047814.1|  PREDICTED: copper amine oxidase 1-like isofo...    259   3e-77   Populus euphratica
ref|XP_007158407.1|  hypothetical protein PHAVU_002G150400g             259   4e-77   Phaseolus vulgaris [French bean]
gb|KHN00390.1|  Copper methylamine oxidase                              259   4e-77   Glycine soja [wild soybean]
ref|XP_011046219.1|  PREDICTED: copper amine oxidase 1-like             259   5e-77   Populus euphratica
gb|KHG02854.1|  Copper methylamine oxidase                              259   5e-77   Gossypium arboreum [tree cotton]
ref|XP_007225246.1|  hypothetical protein PRUPE_ppa001698mg             259   5e-77   Prunus persica
ref|XP_008380537.1|  PREDICTED: copper amine oxidase 1-like             259   6e-77   
ref|XP_007158406.1|  hypothetical protein PHAVU_002G150400g             258   6e-77   Phaseolus vulgaris [French bean]
ref|XP_007153778.1|  hypothetical protein PHAVU_003G064200g             258   7e-77   Phaseolus vulgaris [French bean]
ref|XP_008221920.1|  PREDICTED: copper amine oxidase 1-like             259   8e-77   Prunus mume [ume]
gb|KHG02564.1|  Primary amine oxidase                                   258   9e-77   Gossypium arboreum [tree cotton]
gb|AIS23644.1|  amine oxidase 1                                         258   1e-76   Malus domestica [apple tree]
gb|KJB15626.1|  hypothetical protein B456_002G186900                    258   1e-76   Gossypium raimondii
ref|XP_009362949.1|  PREDICTED: copper amine oxidase 1-like             257   4e-76   Pyrus x bretschneideri [bai li]
ref|XP_006357609.1|  PREDICTED: copper amine oxidase 1-like             257   4e-76   Solanum tuberosum [potatoes]
ref|XP_008367500.1|  PREDICTED: copper amine oxidase 1-like             257   5e-76   
ref|XP_010682433.1|  PREDICTED: copper amine oxidase 1-like             256   5e-76   Beta vulgaris subsp. vulgaris [field beet]
gb|AIS23647.1|  amine oxidase 4                                         256   6e-76   Malus domestica [apple tree]
ref|XP_009345773.1|  PREDICTED: copper amine oxidase 1-like             256   6e-76   Pyrus x bretschneideri [bai li]
ref|XP_004301007.1|  PREDICTED: copper amine oxidase 1-like             256   7e-76   Fragaria vesca subsp. vesca
gb|AFK48029.1|  unknown                                                 239   9e-76   Lotus japonicus
ref|XP_004309984.2|  PREDICTED: copper amine oxidase 1-like             255   1e-75   Fragaria vesca subsp. vesca
ref|XP_006476867.1|  PREDICTED: copper amine oxidase 1-like isofo...    254   3e-75   Citrus sinensis [apfelsine]
gb|KDO69506.1|  hypothetical protein CISIN_1g004084mg                   254   4e-75   Citrus sinensis [apfelsine]
ref|XP_006439904.1|  hypothetical protein CICLE_v10018950mg             254   4e-75   Citrus clementina [clementine]
ref|XP_007036329.1|  Copper amine oxidase family protein isoform 1      254   4e-75   
ref|XP_008464520.1|  PREDICTED: copper amine oxidase 1 isoform X2       252   5e-75   Cucumis melo [Oriental melon]
ref|XP_006476868.1|  PREDICTED: copper amine oxidase 1-like isofo...    252   5e-75   Citrus sinensis [apfelsine]
emb|CDP12746.1|  unnamed protein product                                254   6e-75   Coffea canephora [robusta coffee]
ref|XP_008464519.1|  PREDICTED: copper amine oxidase 1 isoform X1       254   6e-75   Cucumis melo [Oriental melon]
ref|XP_006845257.1|  hypothetical protein AMTR_s00005p00262140          253   2e-74   Amborella trichopoda
ref|XP_011101289.1|  PREDICTED: copper amine oxidase 1-like             252   2e-74   Sesamum indicum [beniseed]
ref|XP_010100391.1|  Copper methylamine oxidase                         253   2e-74   
ref|XP_010027284.1|  PREDICTED: copper amine oxidase 1                  252   2e-74   Eucalyptus grandis [rose gum]
gb|AES71447.2|  copper amine oxidase, enzyme domain protein             247   2e-74   Medicago truncatula
ref|XP_008239321.1|  PREDICTED: copper amine oxidase 1-like             252   2e-74   Prunus mume [ume]
ref|XP_010532283.1|  PREDICTED: copper amine oxidase 1-like             252   3e-74   Tarenaya hassleriana [spider flower]
ref|XP_010907652.1|  PREDICTED: copper amine oxidase 1                  252   3e-74   Elaeis guineensis
gb|EPS71193.1|  hypothetical protein M569_03564                         236   5e-74   Genlisea aurea
ref|XP_006581907.1|  PREDICTED: copper amine oxidase 1-like isofo...    250   6e-74   Glycine max [soybeans]
ref|XP_003527002.1|  PREDICTED: copper amine oxidase 1-like isofo...    251   7e-74   Glycine max [soybeans]
ref|XP_010533488.1|  PREDICTED: copper amine oxidase 1-like             251   9e-74   Tarenaya hassleriana [spider flower]
gb|KHG07734.1|  Primary amine oxidase                                   250   9e-74   Gossypium arboreum [tree cotton]
ref|XP_004155025.1|  PREDICTED: copper methylamine oxidase-like         250   1e-73   
gb|KEH35029.1|  copper amine oxidase, enzyme domain protein             248   2e-73   Medicago truncatula
ref|XP_004501882.1|  PREDICTED: copper methylamine oxidase-like         249   2e-73   Cicer arietinum [garbanzo]
ref|XP_003601196.1|  Primary amine oxidase                              248   2e-73   
ref|XP_003601195.1|  Primary amine oxidase                              249   2e-73   Medicago truncatula
ref|XP_004138093.1|  PREDICTED: copper methylamine oxidase-like         249   2e-73   
gb|KJB19706.1|  hypothetical protein B456_003G116000                    249   4e-73   Gossypium raimondii
ref|XP_007138024.1|  hypothetical protein PHAVU_009G174800g             246   3e-72   Phaseolus vulgaris [French bean]
ref|XP_004289862.2|  PREDICTED: copper amine oxidase 1-like             245   5e-72   Fragaria vesca subsp. vesca
gb|ACN27241.1|  unknown                                                 232   7e-72   Zea mays [maize]
ref|XP_011071936.1|  PREDICTED: copper amine oxidase 1-like             245   1e-71   Sesamum indicum [beniseed]
ref|XP_006411505.1|  hypothetical protein EUTSA_v100163161mg            233   2e-71   
ref|XP_010678856.1|  PREDICTED: copper amine oxidase 1-like isofo...    243   3e-71   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU22171.1|  hypothetical protein MIMGU_mgv1a001639mg                243   4e-71   Erythranthe guttata [common monkey flower]
gb|KHN18421.1|  Copper methylamine oxidase                              242   4e-71   Glycine soja [wild soybean]
gb|KJB19705.1|  hypothetical protein B456_003G116000                    243   7e-71   Gossypium raimondii
ref|XP_003550715.1|  PREDICTED: copper amine oxidase 1-like isofo...    242   8e-71   Glycine max [soybeans]
dbj|BAD95322.1|  putative copper amine oxidase                          235   3e-70   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001169559.1|  uncharacterized protein LOC100383438               231   4e-70   
ref|XP_010322539.1|  PREDICTED: copper amine oxidase 1-like             240   6e-70   Solanum lycopersicum
ref|XP_006351050.1|  PREDICTED: copper amine oxidase 1-like             240   6e-70   
ref|XP_009606421.1|  PREDICTED: copper amine oxidase 1-like             240   6e-70   Nicotiana tomentosiformis
ref|XP_002881856.1|  hypothetical protein ARALYDRAFT_903619             240   6e-70   Arabidopsis lyrata subsp. lyrata
ref|XP_009618867.1|  PREDICTED: copper amine oxidase 1-like isofo...    238   1e-69   Nicotiana tomentosiformis
gb|ABR16250.1|  unknown                                                 239   2e-69   Picea sitchensis
ref|XP_009403621.1|  PREDICTED: copper amine oxidase 1-like             239   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010678857.1|  PREDICTED: copper amine oxidase 1-like isofo...    238   2e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009778427.1|  PREDICTED: copper amine oxidase 1-like             239   2e-69   Nicotiana sylvestris
gb|AAD23730.1|  putative copper amine oxidase                           239   2e-69   Arabidopsis thaliana [mouse-ear cress]
emb|CAN76391.1|  hypothetical protein VITISV_023592                     239   2e-69   Vitis vinifera
ref|NP_181777.2|  copper amine oxidase family protein                   238   2e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006347431.1|  PREDICTED: copper amine oxidase 1-like             238   3e-69   Solanum tuberosum [potatoes]
ref|XP_010517774.1|  PREDICTED: copper amine oxidase 1-like             238   6e-69   Camelina sativa [gold-of-pleasure]
ref|XP_004244763.1|  PREDICTED: copper amine oxidase 1-like             238   6e-69   Solanum lycopersicum
dbj|BAF49520.1|  N-methylputrescine oxidase                             237   8e-69   Nicotiana tabacum [American tobacco]
ref|XP_009618862.1|  PREDICTED: copper amine oxidase 1-like isofo...    237   8e-69   Nicotiana tomentosiformis
ref|XP_002448036.1|  hypothetical protein SORBIDRAFT_06g020020          237   9e-69   Sorghum bicolor [broomcorn]
ref|XP_010506075.1|  PREDICTED: copper amine oxidase 1-like isofo...    237   1e-68   Camelina sativa [gold-of-pleasure]
ref|NP_001053078.1|  Os04g0476100                                       232   1e-68   
ref|XP_009133538.1|  PREDICTED: copper amine oxidase 1-like             236   1e-68   Brassica rapa
ref|XP_009773282.1|  PREDICTED: copper amine oxidase 1-like             236   1e-68   Nicotiana sylvestris
gb|KFK37100.1|  hypothetical protein AALP_AA4G213000                    236   1e-68   Arabis alpina [alpine rockcress]
ref|XP_006293724.1|  hypothetical protein CARUB_v10022684mg             236   2e-68   Capsella rubella
ref|XP_009379966.1|  PREDICTED: copper amine oxidase 1-like             236   2e-68   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ87935.1|  predicted protein                                      231   2e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010508564.1|  PREDICTED: copper amine oxidase 1-like             236   3e-68   Camelina sativa [gold-of-pleasure]
ref|XP_003581353.1|  PREDICTED: copper amine oxidase 1-like             235   4e-68   Brachypodium distachyon [annual false brome]
emb|CAE05498.2|  OSJNBa0022H21.18                                       234   5e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001774529.1|  predicted protein                                  234   6e-68   
emb|CAH67316.1|  OSIGBa0106G07.12                                       233   1e-67   Oryza sativa [red rice]
emb|CDY35376.1|  BnaA03g19840D                                          236   1e-67   Brassica napus [oilseed rape]
ref|XP_006652410.1|  PREDICTED: copper amine oxidase 1-like             233   2e-67   
gb|EAZ31082.1|  hypothetical protein OsJ_15179                          234   2e-67   Oryza sativa Japonica Group [Japonica rice]
gb|EAY94528.1|  hypothetical protein OsI_16305                          233   2e-67   Oryza sativa Indica Group [Indian rice]
ref|XP_008668433.1|  PREDICTED: uncharacterized protein LOC100383...    233   3e-67   
ref|XP_009404245.1|  PREDICTED: copper amine oxidase 1-like             233   3e-67   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY47975.1|  BnaA04g24530D                                          232   5e-67   Brassica napus [oilseed rape]
ref|XP_004975956.1|  PREDICTED: copper amine oxidase 1-like             232   5e-67   Setaria italica
ref|XP_009142070.1|  PREDICTED: LOW QUALITY PROTEIN: copper amine...    232   5e-67   Brassica rapa
gb|EMS63127.1|  Primary amine oxidase                                   231   5e-67   Triticum urartu
ref|XP_001753509.1|  predicted protein                                  230   6e-67   
emb|CDY14839.1|  BnaC04g48360D                                          232   6e-67   Brassica napus [oilseed rape]
emb|CDY22564.1|  BnaC03g23740D                                          233   1e-66   Brassica napus [oilseed rape]
gb|KEH27747.1|  copper amine oxidase, enzyme domain protein             230   2e-66   Medicago truncatula
ref|XP_001757203.1|  predicted protein                                  229   2e-66   
gb|KJB50256.1|  hypothetical protein B456_008G160800                    229   4e-66   Gossypium raimondii
gb|KJB50255.1|  hypothetical protein B456_008G160800                    229   4e-66   Gossypium raimondii
gb|KJB50257.1|  hypothetical protein B456_008G160800                    229   5e-66   Gossypium raimondii
ref|XP_007155469.1|  hypothetical protein PHAVU_003G204000g             232   1e-65   Phaseolus vulgaris [French bean]
ref|XP_001759255.1|  predicted protein                                  227   2e-65   
gb|EMT09520.1|  Copper methylamine oxidase                              226   2e-64   
emb|CAE02362.2|  OSJNBb0016B03.15                                       225   2e-64   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006600617.1|  PREDICTED: copper amine oxidase 1-like isofo...    223   4e-64   Glycine max [soybeans]
gb|EMS61925.1|  Copper methylamine oxidase                              223   8e-64   Triticum urartu
ref|NP_001173054.1|  Os02g0593150                                       209   5e-62   
ref|XP_009618866.1|  PREDICTED: copper amine oxidase 1-like isofo...    217   1e-61   Nicotiana tomentosiformis
gb|EEC76708.1|  hypothetical protein OsI_14715                          212   8e-60   Oryza sativa Indica Group [Indian rice]
gb|EAZ29581.1|  hypothetical protein OsJ_13655                          212   1e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002985875.1|  hypothetical protein SELMODRAFT_123165             203   1e-56   
ref|XP_002984811.1|  hypothetical protein SELMODRAFT_121227             203   1e-56   
gb|EEE57286.1|  hypothetical protein OsJ_07344                          202   1e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002979456.1|  hypothetical protein SELMODRAFT_153358             200   8e-56   
ref|XP_002462763.1|  hypothetical protein SORBIDRAFT_02g031550          197   1e-54   
ref|XP_002977869.1|  hypothetical protein SELMODRAFT_443642             190   7e-52   Selaginella moellendorffii
ref|XP_007211293.1|  hypothetical protein PRUPE_ppa002116mg             181   6e-49   
gb|KDO82259.1|  hypothetical protein CISIN_1g004080mg                   178   8e-48   Citrus sinensis [apfelsine]
ref|XP_007044779.1|  Copper amine oxidase family protein isoform 3      176   7e-47   
gb|KDO69507.1|  hypothetical protein CISIN_1g004084mg                   174   2e-46   Citrus sinensis [apfelsine]
ref|XP_007036330.1|  Copper amine oxidase family protein isoform 2      174   3e-46   
gb|KJB19704.1|  hypothetical protein B456_003G116000                    169   1e-44   Gossypium raimondii
ref|WP_027094208.1|  tyramine oxidase                                   154   2e-39   Cohnella thermotolerans
ref|WP_025696771.1|  tyramine oxidase                                   151   9e-39   Paenibacillus durus
ref|WP_036584415.1|  tyramine oxidase                                   150   4e-38   Paenibacillus darwinianus
gb|EEC73513.1|  hypothetical protein OsI_07883                          149   6e-38   Oryza sativa Indica Group [Indian rice]
ref|WP_008317043.1|  Cu2+-containing amine oxidase                      146   9e-37   Leptolyngbya sp. PCC 6406
ref|WP_015845121.1|  tyramine oxidase                                   142   3e-35   Paenibacillus sp. JDR-2
ref|WP_017299862.1|  tyramine oxidase                                   141   8e-35   Nodosilinea nodulosa
ref|WP_007920030.1|  tyramine oxidase                                   141   9e-35   Ktedonobacter racemifer
gb|ETX01504.1|  hypothetical protein ETSY2_37115                        136   1e-34   Candidatus Entotheonella gemina
ref|WP_035986372.1|  tyramine oxidase                                   140   2e-34   Leptolyngbya sp. KIOST-1
ref|WP_008314860.1|  Cu2+-containing amine oxidase                      139   3e-34   Leptolyngbya sp. PCC 6406
ref|WP_039728302.1|  MULTISPECIES: tyramine oxidase                     139   4e-34   Lyngbya confervoides
ref|WP_041436864.1|  tyramine oxidase                                   139   5e-34   
gb|ABD03718.1|  putative copper methylamine oxidase                     139   5e-34   Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_011430198.1|  tyramine oxidase                                   139   6e-34   Synechococcus sp. JA-3-3Ab
ref|WP_015124381.1|  Cu2+-containing amine oxidase                      138   1e-33   Synechococcus sp. PCC 6312
ref|WP_036002001.1|  tyramine oxidase                                   138   1e-33   [Leptolyngbya] sp. JSC-1
ref|WP_012627324.1|  tyramine oxidase                                   137   2e-33   Cyanothece sp. PCC 7425
ref|WP_015186652.1|  Copper amine oxidase domain-containing protein     137   2e-33   Gloeocapsa sp. PCC 7428
ref|WP_006456034.1|  tyramine oxidase                                   136   4e-33   Synechococcus sp. PCC 7335
ref|WP_036531589.1|  tyramine oxidase                                   136   7e-33   Neosynechococcus sphagnicola
emb|CEG30995.1|  Primary amine oxidase precursor                        136   7e-33   Bacillus simplex
ref|WP_012935344.1|  tyramine oxidase                                   135   8e-33   Conexibacter woesei
ref|WP_041858942.1|  hypothetical protein                               135   1e-32   
ref|WP_006520181.1|  Cu2+-containing amine oxidase                      135   1e-32   Leptolyngbya sp. PCC 7375
gb|ABJ81915.1|  Amine oxidase (copper-containing)                       135   1e-32   Candidatus Solibacter usitatus Ellin6076
ref|WP_040597665.1|  tyramine oxidase                                   135   1e-32   Patulibacter medicamentivorans
gb|EHN12772.1|  Monoamine oxidase                                       135   1e-32   Patulibacter medicamentivorans
ref|WP_012873420.1|  tyramine oxidase                                   134   2e-32   Sphaerobacter thermophilus
ref|WP_036480875.1|  tyramine oxidase                                   134   4e-32   
ref|WP_026159538.1|  hypothetical protein                               133   5e-32   
ref|WP_029635581.1|  hypothetical protein                               133   5e-32   
gb|AIA11119.1|  Copper amine oxidase, enzyme domain protein             125   7e-32   uncultured bacterium
ref|WP_035742293.1|  tyramine oxidase                                   128   2e-31   
ref|WP_024819190.1|  tyramine oxidase                                   132   2e-31   Arthrobacter sp. 31Y
ref|WP_043457655.1|  tyramine oxidase                                   132   2e-31   
ref|WP_034315126.1|  tyramine oxidase                                   132   2e-31   Bacillus simplex
ref|WP_028930454.1|  tyramine oxidase                                   132   2e-31   Pseudonocardia asaccharolytica
ref|WP_035741463.1|  tyramine oxidase                                   128   3e-31   
ref|WP_009633550.1|  Cu2+-containing amine oxidase                      131   4e-31   Synechocystis sp. PCC 7509
ref|WP_042206338.1|  tyramine oxidase                                   131   4e-31   Paenibacillus durus
ref|WP_029018078.1|  hypothetical protein                               131   4e-31   
ref|WP_019310622.1|  tyramine oxidase                                   130   6e-31   Kocuria
ref|WP_037709969.1|  tyramine oxidase                                   130   8e-31   Streptomyces mirabilis
ref|WP_043709977.1|  tyramine oxidase                                   130   1e-30   
ref|WP_020471082.1|  hypothetical protein                               129   1e-30   Zavarzinella formosa
ref|WP_036725089.1|  tyramine oxidase                                   129   1e-30   Paenibacillus forsythiae
ref|WP_018685630.1|  hypothetical protein                               129   1e-30   Actinokineospora enzanensis
ref|WP_028063099.1|  tyramine oxidase                                   129   1e-30   Solirubrobacter soli
ref|WP_039923589.1|  tyramine oxidase                                   129   1e-30   
ref|WP_003805961.1|  copper-containing amine oxidase                    127   2e-30   
gb|ERK69570.1|  histamine oxidase                                       129   2e-30   Leifsonia aquatica ATCC 14665
ref|XP_005964261.1|  PREDICTED: copper amine oxidase 1-like             129   3e-30   Pantholops hodgsonii [Tibetan antelope]
ref|WP_028276189.1|  histamine oxidase                                  129   3e-30   Arthrobacter sp. I3
ref|WP_033288818.1|  tyramine oxidase                                   128   3e-30   Amycolatopsis jejuensis
ref|WP_037078438.1|  tyramine oxidase                                   128   3e-30   Pseudonocardia spinosispora
ref|WP_024477500.1|  histamine oxidase                                  128   3e-30   Arthrobacter sp. CAL618
ref|WP_028271227.1|  histamine oxidase                                  128   3e-30   Arthrobacter sp. UNC362MFTsu5.1
ref|WP_009075996.1|  tyramine oxidase                                   128   3e-30   Actinobacteria
ref|WP_035743334.1|  tyramine oxidase                                   128   4e-30   Arthrobacter sp. MA-N2
ref|WP_018774097.1|  tyramine oxidase                                   128   4e-30   Arthrobacter sp. 131MFCol6.1
ref|WP_043836428.1|  tyramine oxidase                                   127   5e-30   Amycolatopsis orientalis
ref|WP_037817779.1|  tyramine oxidase                                   127   6e-30   Streptomyces sp. NRRL F-3213
gb|EFL10175.1|  tyramine oxidase                                        128   6e-30   Streptomyces sp. AA4
ref|WP_037715216.1|  tyramine oxidase                                   127   6e-30   Actinobacteria
ref|WP_034299865.1|  hypothetical protein                               120   7e-30   
ref|WP_028074137.1|  tyramine oxidase                                   127   9e-30   
ref|WP_026556508.1|  tyramine oxidase                                   127   9e-30   Arthrobacter sp. 35W
ref|WP_026556533.1|  tyramine oxidase                                   127   9e-30   Arthrobacter sp. 35W
ref|WP_026421607.1|  tyramine oxidase                                   127   9e-30   Actinokineospora inagensis
ref|WP_011693327.1|  tyramine oxidase                                   127   9e-30   Arthrobacter sp. FB24
ref|WP_018770046.1|  tyramine oxidase                                   127   9e-30   Arthrobacter sp. 162MFSha1.1
ref|WP_027416719.1|  tyramine oxidase                                   127   9e-30   Aneurinibacillus terranovensis
ref|WP_026538164.1|  histamine oxidase                                  127   1e-29   Arthrobacter sp. 9MFCol3.1
ref|WP_028921142.1|  tyramine oxidase                                   127   1e-29   Pseudonocardia acaciae
ref|WP_015320499.1|  Cu2+-containing amine oxidase                      127   1e-29   Natronococcus occultus
sp|Q07123.1|AMO2_ARTS1  RecName: Full=Copper methylamine oxidase;...    127   1e-29   Arthrobacter sp. P1
ref|WP_043484145.1|  histamine oxidase                                  127   1e-29   Arthrobacter sp. SPG23
ref|WP_019483707.1|  tyramine oxidase                                   127   1e-29   Arthrobacter sp. TB 23
sp|Q07121.1|AMO1_ARTS1  RecName: Full=Primary amine oxidase; AltN...    127   1e-29   Arthrobacter sp. P1
ref|WP_028267210.1|  histamine oxidase                                  127   1e-29   
ref|WP_017651781.1|  tyramine oxidase                                   127   1e-29   Fortiea contorta
ref|WP_026844103.1|  tyramine oxidase                                   127   1e-29   Geodermatophilaceae bacterium URHA0031
ref|WP_037362055.1|  tyramine oxidase                                   126   2e-29   Amycolatopsis orientalis
gb|EMP12147.1|  primary amine oxidase                                   126   2e-29   Gordonia sp. NB4-1Y
ref|WP_037411516.1|  tyramine oxidase                                   126   2e-29   Solirubrobacter sp. URHD0082
ref|WP_043807325.1|  histamine oxidase                                  126   2e-29   
gb|ABM10664.1|  amine oxidase, copper-containing                        126   2e-29   Paenarthrobacter aurescens TC1
ref|WP_018778238.1|  tyramine oxidase                                   126   2e-29   Arthrobacter sp. 161MFSha2.1
ref|WP_039731529.1|  tyramine oxidase                                   126   2e-29   
ref|WP_043742548.1|  tyramine oxidase                                   126   2e-29   
ref|WP_016205391.1|  tyramine oxidase                                   126   2e-29   Bacillus nealsonii
ref|WP_026543389.1|  histamine oxidase                                  126   2e-29   Paenarthrobacter nicotinovorans
ref|XP_008907114.1|  hypothetical protein PPTG_13290                    126   2e-29   
gb|ETI44133.1|  hypothetical protein F443_11140                         126   2e-29   
ref|WP_004562824.1|  tyramine oxidase                                   125   3e-29   
gb|ETO72786.1|  hypothetical protein F444_11200                         126   3e-29   
ref|WP_036338604.1|  tyramine oxidase                                   126   3e-29   
ref|WP_035837338.1|  histamine oxidase                                  125   3e-29   
ref|WP_034290510.1|  tyramine oxidase                                   125   3e-29   
pdb|1UI7|A  Chain A, Site-Directed Mutagenesis Of His433 Involved...    125   3e-29   
pdb|3WA2|X  Chain X, High Resolution Crystal Structure Of Copper ...    125   3e-29   
pdb|2CWT|A  Chain A, Catalytic Base Deletion In Copper Amine Oxid...    125   3e-29   
ref|WP_043806367.1|  histamine oxidase                                  125   3e-29   
pdb|1IVV|A  Chain A, Crystal Structure Of Copper Amine Oxidase Fr...    125   3e-29   
ref|WP_003799421.1|  tyramine oxidase                                   125   3e-29   
pdb|2YX9|A  Chain A, Crystal Structure Of D298k Copper Amine Oxid...    125   3e-29   
gb|KGT47861.1|  hypothetical protein GW12_10980                         122   3e-29   
ref|WP_034266611.1|  tyramine oxidase                                   125   3e-29   
ref|WP_038549924.1|  histamine oxidase                                  125   3e-29   
ref|WP_018760783.1|  tyramine oxidase                                   125   3e-29   
ref|WP_039243055.1|  histamine oxidase                                  125   4e-29   
ref|WP_024819386.1|  histamine oxidase                                  125   4e-29   
pdb|2E2U|A  Chain A, Substrate Schiff-base Analogue Of Copper Ami...    125   4e-29   
ref|WP_014922900.1|  tyramine oxidase                                   125   4e-29   
pdb|1SIH|A  Chain A, Agao In Covalent Complex With The Inhibitor ...    125   4e-29   
ref|WP_043455865.1|  histamine oxidase                                  125   4e-29   
ref|WP_034584673.1|  tyramine oxidase                                   122   4e-29   
ref|WP_041339143.1|  tyramine oxidase                                   125   4e-29   
ref|WP_036335313.1|  tyramine oxidase                                   125   4e-29   
ref|WP_005168021.1|  Monoamine oxidase                                  125   5e-29   
ref|WP_024818298.1|  histamine oxidase                                  125   5e-29   
ref|WP_012411235.1|  tyramine oxidase                                   125   5e-29   
gb|AHY48354.1|  Cu2+-containing amine oxidase                           125   5e-29   
ref|WP_015938722.1|  tyramine oxidase                                   125   5e-29   
ref|WP_026547874.1|  histamine oxidase                                  125   6e-29   
ref|WP_043710196.1|  tyramine oxidase                                   125   6e-29   
ref|WP_043470977.1|  histamine oxidase                                  125   7e-29   
gb|AFY34999.1|  Copper amine oxidase domain-containing protein          125   7e-29   
ref|WP_043806482.1|  histamine oxidase                                  125   7e-29   
ref|WP_034306167.1|  tyramine oxidase                                   124   7e-29   
gb|ABM10002.1|  amine oxidase (copper-containing)                       125   7e-29   
gb|AFR27483.1|  Cu2+-containing amine oxidase                           125   7e-29   
ref|WP_026104174.1|  tyramine oxidase                                   125   7e-29   
ref|WP_042341482.1|  tyramine oxidase                                   125   7e-29   
ref|WP_016333935.1|  primary-amine oxidase                              124   7e-29   
ref|WP_033349571.1|  tyramine oxidase                                   124   7e-29   
ref|WP_035876493.1|  histamine oxidase                                  124   8e-29   
ref|WP_041312973.1|  tyramine oxidase                                   124   8e-29   
ref|WP_028921006.1|  hypothetical protein                               124   1e-28   
ref|WP_014740127.1|  tyramine oxidase                                   124   1e-28   
emb|CCH30742.1|  Histamine oxidase                                      124   1e-28   
ref|WP_028065493.1|  tyramine oxidase                                   124   1e-28   
ref|WP_009377663.1|  tyramine oxidase                                   124   2e-28   
ref|WP_003350826.1|  tyramine oxidase                                   124   2e-28   
ref|WP_032385619.1|  hypothetical protein                               124   2e-28   
ref|XP_005703912.1|  primary-amine oxidase                              124   2e-28   
ref|WP_037336996.1|  tyramine oxidase                                   123   2e-28   
ref|WP_033318483.1|  hypothetical protein                               124   2e-28   
ref|WP_015595580.1|  tyramine oxidase                                   123   2e-28   
gb|EEB83863.1|  amine oxidase (copper-containing)                       117   2e-28   
ref|WP_017200065.1|  tyramine oxidase                                   123   2e-28   
ref|WP_005179100.1|  putative copper-containing amine oxidase           123   2e-28   
ref|WP_028066479.1|  tyramine oxidase                                   123   2e-28   
ref|WP_038514355.1|  tyramine oxidase                                   123   3e-28   
ref|WP_044853065.1|  tyramine oxidase                                   123   3e-28   
ref|WP_037305302.1|  tyramine oxidase                                   123   3e-28   
ref|WP_010144585.1|  tyramine oxidase                                   123   3e-28   
ref|WP_009881574.1|  tyramine oxidase                                   123   3e-28   
ref|WP_007029111.1|  tyramine oxidase                                   122   4e-28   
ref|WP_007144763.1|  tyramine oxidase                                   123   4e-28   
ref|WP_035485230.1|  tyramine oxidase                                   123   4e-28   
gb|EWM22333.1|  copper amine oxidase                                    123   4e-28   
ref|WP_020636390.1|  tyramine oxidase                                   122   4e-28   
ref|WP_002616189.1|  nickel transporter                                 122   4e-28   
ref|WP_016730365.1|  tyramine oxidase                                   122   4e-28   
ref|WP_026552762.1|  histamine oxidase                                  122   4e-28   
ref|WP_034284434.1|  tyramine oxidase                                   122   5e-28   
ref|WP_012714637.1|  tyramine oxidase                                   122   5e-28   
ref|WP_014513326.1|  tyramine oxidase                                   122   5e-28   
ref|WP_018393282.1|  hypothetical protein                               122   5e-28   
pdb|1UI8|A  Chain A, Site-directed Mutagenesis Of His592 Involved...    122   6e-28   
ref|WP_005556120.1|  tyramine oxidase                                   122   6e-28   
ref|WP_043427296.1|  tyramine oxidase                                   122   7e-28   
ref|WP_041457930.1|  tyramine oxidase                                   122   7e-28   
ref|XP_008907589.1|  hypothetical protein PPTG_13573                    122   7e-28   
gb|ETP41443.1|  hypothetical protein F442_11410                         122   7e-28   
ref|WP_025780611.1|  histamine oxidase                                  122   8e-28   
ref|WP_015217010.1|  Copper amine oxidase domain-containing protein     122   8e-28   
gb|AFW94818.1|  amine oxidase                                           122   8e-28   
gb|ETI43485.1|  hypothetical protein F443_11515                         122   8e-28   
ref|WP_043643838.1|  tyramine oxidase                                   122   9e-28   
ref|WP_028676864.1|  tyramine oxidase                                   121   9e-28   
ref|WP_026005433.1|  histamine oxidase                                  122   1e-27   
ref|WP_011777249.1|  tyramine oxidase                                   121   1e-27   
ref|WP_028390396.1|  tyramine oxidase                                   121   1e-27   
gb|EXF24973.1|  Histamine oxidase                                       121   1e-27   
ref|XP_009515861.1|  hypothetical protein PHYSODRAFT_343894             121   1e-27   
ref|WP_036475588.1|  tyramine oxidase                                   121   1e-27   
ref|WP_037040542.1|  tyramine oxidase                                   121   1e-27   
ref|WP_039705665.1|  hypothetical protein                               121   1e-27   
ref|WP_027749196.1|  tyramine oxidase                                   121   1e-27   
ref|WP_034285194.1|  tyramine oxidase                                   121   1e-27   
ref|WP_040019527.1|  tyramine oxidase                                   121   1e-27   
ref|WP_044571418.1|  histamine oxidase                                  121   1e-27   
ref|WP_022928833.1|  tyramine oxidase                                   121   1e-27   
ref|WP_043834413.1|  tyramine oxidase                                   121   1e-27   
ref|WP_003803495.1|  tyramine oxidase                                   121   2e-27   
ref|XP_009515875.1|  hypothetical protein PHYSODRAFT_343895             122   2e-27   
ref|WP_006090340.1|  tyramine oxidase                                   121   2e-27   
ref|WP_034341918.1|  hypothetical protein                               120   2e-27   
ref|WP_037049762.1|  tyramine oxidase                                   120   2e-27   
gb|AHG88986.1|  Copper amine oxidase domain-containing protein          121   2e-27   
ref|WP_018330660.1|  hypothetical protein                               120   2e-27   
ref|WP_040270524.1|  tyramine oxidase                                   120   2e-27   
gb|AJT42947.1|  tyramine oxidase                                        120   2e-27   
ref|WP_020673325.1|  hypothetical protein                               120   3e-27   
ref|WP_010523912.1|  tyramine oxidase                                   120   3e-27   
ref|WP_003895293.1|  primary amine oxidase                              120   3e-27   
ref|WP_011729366.1|  tyramine oxidase                                   120   4e-27   
ref|WP_043806534.1|  tyramine oxidase                                   120   4e-27   
gb|ABM07053.1|  copper methylamine oxidase                              120   4e-27   
ref|WP_040728048.1|  tyramine oxidase                                   119   4e-27   
ref|WP_014877840.1|  tyramine oxidase                                   120   4e-27   
ref|WP_009078783.1|  tyramine oxidase                                   119   4e-27   
ref|WP_041312313.1|  tyramine oxidase                                   119   5e-27   
gb|AGB23966.1|  Cu2+-containing amine oxidase                           119   5e-27   
ref|WP_036454811.1|  tyramine oxidase                                   119   6e-27   
ref|XP_009515100.1|  hypothetical protein PHYSODRAFT_539188             119   6e-27   
gb|ELQ86689.1|  primary amine oxidase                                   119   6e-27   
gb|KJF19252.1|  Histamine oxidase                                       119   7e-27   
ref|WP_037368234.1|  tyramine oxidase                                   119   7e-27   
ref|XP_009515103.1|  hypothetical protein PHYSODRAFT_247622             119   8e-27   
ref|XP_005702395.1|  primary-amine oxidase                              118   8e-27   
ref|WP_032366965.1|  tyramine oxidase                                   119   9e-27   
ref|WP_039731313.1|  tyramine oxidase                                   119   9e-27   
ref|WP_043742191.1|  tyramine oxidase                                   119   9e-27   
ref|WP_041242048.1|  tyramine oxidase                                   118   1e-26   
gb|AJP05492.1|  tyramine oxidase                                        118   1e-26   
ref|WP_020874939.1|  hypothetical protein                               112   1e-26   
ref|WP_044379234.1|  tyramine oxidase                                   118   1e-26   
gb|ADB74456.1|  Primary-amine oxidase                                   118   1e-26   
ref|WP_037709039.1|  tyramine oxidase                                   118   1e-26   
ref|WP_029431775.1|  tyramine oxidase                                   118   2e-26   
ref|WP_040431327.1|  tyramine oxidase                                   118   2e-26   
ref|WP_037805791.1|  tyramine oxidase                                   118   2e-26   
ref|WP_038680250.1|  tyramine oxidase                                   118   2e-26   
ref|WP_026266296.1|  tyramine oxidase                                   118   2e-26   
ref|WP_024084556.1|  tyramine oxidase                                   118   2e-26   
ref|WP_015140710.1|  Cu2+-containing amine oxidase                      118   2e-26   
ref|WP_033292479.1|  tyramine oxidase                                   117   2e-26   
ref|WP_010612233.1|  tyramine oxidase                                   117   2e-26   
ref|WP_008356972.1|  tyramine oxidase                                   118   2e-26   
ref|WP_020510980.1|  hypothetical protein                               117   2e-26   
ref|WP_037080446.1|  hypothetical protein                               117   2e-26   
ref|WP_007694497.1|  tyramine oxidase                                   117   2e-26   
sp|Q59118.3|AMOH_ARTGO  RecName: Full=Histamine oxidase; AltName:...    117   3e-26   
ref|WP_027133873.1|  hypothetical protein                               117   3e-26   
ref|WP_027941288.1|  tyramine oxidase                                   117   3e-26   
ref|WP_044440882.1|  hypothetical protein                               117   3e-26   
ref|WP_014377254.1|  tyramine oxidase                                   117   3e-26   
ref|WP_035756669.1|  histamine oxidase                                  117   3e-26   
ref|WP_036331439.1|  hypothetical protein                               117   4e-26   
gb|ETK31731.1|  tyramine oxidase                                        117   4e-26   
ref|WP_018395580.1|  hypothetical protein                               117   4e-26   
ref|WP_015889407.1|  tyramine oxidase                                   117   4e-26   
gb|AII05461.1|  tyramine oxidase                                        117   5e-26   
ref|WP_031465870.1|  tyramine oxidase                                   116   5e-26   
ref|WP_043120134.1|  hypothetical protein                               116   5e-26   
ref|WP_038993072.1|  histamine oxidase                                  116   6e-26   
ref|WP_036398013.1|  histamine oxidase                                  116   6e-26   
ref|WP_011278970.1|  tyramine oxidase                                   116   7e-26   
ref|WP_037408872.1|  tyramine oxidase                                   116   7e-26   
dbj|BAE48148.1|  histamine oxidase                                      116   7e-26   
gb|AGQ16873.1|  histamine oxidase                                       116   7e-26   
ref|WP_006066801.1|  tyramine oxidase                                   116   8e-26   
ref|WP_037243707.1|  tyramine oxidase                                   116   9e-26   
ref|WP_036534611.1|  tyramine oxidase                                   116   9e-26   
ref|WP_010997581.1|  tyramine oxidase                                   116   9e-26   
ref|WP_033288996.1|  tyramine oxidase                                   115   1e-25   
ref|WP_026536743.1|  tyramine oxidase                                   115   1e-25   
ref|WP_039714126.1|  tyramine oxidase                                   115   1e-25   
ref|WP_035770172.1|  hypothetical protein                               115   1e-25   
ref|WP_043709465.1|  tyramine oxidase                                   115   1e-25   
ref|WP_015155560.1|  Copper amine oxidase domain-containing protein     115   1e-25   
ref|WP_013675838.1|  tyramine oxidase                                   115   1e-25   
ref|WP_005238602.1|  tyramine oxidase                                   115   1e-25   
ref|WP_037198339.1|  tyramine oxidase                                   115   1e-25   
ref|WP_007296131.1|  MULTISPECIES: tyramine oxidase                     115   1e-25   
ref|WP_027331473.1|  tyramine oxidase                                   115   2e-25   
ref|WP_005260964.1|  tyramine oxidase                                   115   2e-25   
ref|WP_013678400.1|  tyramine oxidase                                   115   2e-25   
ref|WP_011595316.1|  tyramine oxidase                                   115   2e-25   
ref|WP_016882495.1|  tyramine oxidase                                   115   2e-25   
ref|WP_040167401.1|  hypothetical protein                               115   2e-25   
ref|WP_005250970.1|  tyramine oxidase                                   115   2e-25   
ref|WP_005562649.1|  tyramine oxidase                                   115   2e-25   
ref|WP_034351252.1|  tyramine oxidase                                   111   2e-25   
ref|WP_015113274.1|  Copper amine oxidase domain-containing protein     115   2e-25   
ref|WP_028276231.1|  tyramine oxidase                                   115   2e-25   
gb|AII08562.1|  tyramine oxidase                                        115   2e-25   
ref|WP_007301564.1|  tyramine oxidase                                   115   2e-25   
ref|WP_021765533.1|  hypothetical protein                               108   2e-25   
ref|WP_008413752.1|  tyramine oxidase                                   115   2e-25   
ref|WP_037226125.1|  tyramine oxidase                                   115   2e-25   
ref|WP_036460719.1|  tyramine oxidase                                   115   2e-25   
gb|AFA74340.1|  histamine oxidase                                       115   2e-25   
ref|WP_043456625.1|  histamine oxidase                                  115   2e-25   
ref|WP_015320488.1|  Cu2+-containing amine oxidase                      115   2e-25   
ref|WP_012689537.1|  tyramine oxidase                                   115   2e-25   
gb|EUA67739.1|  copper amine oxidase, enzyme domain protein             113   2e-25   
ref|WP_017614103.1|  hypothetical protein                               115   2e-25   
ref|WP_020502057.1|  hypothetical protein                               114   2e-25   
ref|WP_012786837.1|  tyramine oxidase                                   114   3e-25   
ref|WP_024445852.1|  tyramine oxidase                                   115   3e-25   
ref|WP_019545195.1|  hypothetical protein                               114   3e-25   
ref|WP_007301176.1|  tyramine oxidase                                   114   3e-25   
ref|WP_043409861.1|  tyramine oxidase                                   114   3e-25   
ref|WP_029366519.1|  tyramine oxidase                                   114   3e-25   
ref|WP_009478859.1|  tyramine oxidase                                   114   3e-25   
ref|WP_040815337.1|  hypothetical protein                               114   3e-25   
ref|WP_016883509.1|  tyramine oxidase                                   114   4e-25   
ref|WP_011597752.1|  tyramine oxidase                                   114   4e-25   
ref|WP_005259938.1|  tyramine oxidase                                   114   4e-25   



>gb|AGZ20104.1| copper methylamine oxidase-like protein [Camellia sinensis]
Length=751

 Score =   277 bits (709),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNRTGQLTGYKLV GSNCLPLAGTEAKFLRRAAFLKHNLWVTPYAR+EM+PG
Sbjct  593  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARDEMYPG  652

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNRPLEETDIVLWYVFGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  653  GEFPNQNPRVGEGLATWVKQNRPLEETDIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMP  712

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPSS D D K+N V+TKP + GLVAKL
Sbjct  713  HGFFNCSPAVDVPPSSCDSDVKDNVVVTKPINNGLVAKL  751



>gb|KCW86673.1| hypothetical protein EUGRSUZ_B032971, partial [Eucalyptus grandis]
 gb|KCW86674.1| hypothetical protein EUGRSUZ_B032971, partial [Eucalyptus grandis]
Length=345

 Score =   264 bits (675),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNRTGQLTGYKL+ GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PG
Sbjct  187  WIIRNTRTVNRTGQLTGYKLLPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPG  246

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMP
Sbjct  247  GEFPNQNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMP  306

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+S D + KENG+  K    GL+AK+
Sbjct  307  HGFFNCSPAVDVPPNSGDSELKENGMAAKSIQNGLLAKM  345



>emb|CDP13211.1| unnamed protein product [Coffea canephora]
Length=282

 Score =   262 bits (670),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQLTGYKLV GSNC  LA  EAKFLRRAAFLKHNLWVTPY+ +E FPG
Sbjct  124  WIVRNTRAVNRTGQLTGYKLVPGSNCQRLARPEAKFLRRAAFLKHNLWVTPYSHDEKFPG  183

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WV++NRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE IGF LMP
Sbjct  184  GEFPNQNPRVGEGLATWVRENRPLEETDIVLWYVFGVTHVPRLEDWPVMPVEHIGFTLMP  243

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPA+DVP SS D D KENG+ITKPCH GLVAKL
Sbjct  244  HGFFNCSPAIDVPLSSCDSDVKENGMITKPCHNGLVAKL  282



>gb|KHN13432.1| Copper methylamine oxidase [Glycine soja]
Length=738

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTG LTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM PG
Sbjct  580  WIVRNTRTVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMHPG  639

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  640  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMP  699

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+ +D D KENG+  KP   GL+AKL
Sbjct  700  HGFFNCSPAVDVPPNQSDLDDKENGLPAKPIQNGLIAKL  738



>ref|NP_001237782.1| peroxisomal copper-containing amine oxidase [Glycine max]
 gb|AAD40979.1|AF089851_1 peroxisomal copper-containing amine oxidase [Glycine max]
Length=701

 Score =   266 bits (679),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTG LTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM PG
Sbjct  543  WIVRNTRTVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMHPG  602

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  603  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMP  662

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+ +D D KENG+  KP   GL+AKL
Sbjct  663  HGFFNCSPAVDVPPNQSDLDDKENGLPAKPIQNGLIAKL  701



>ref|XP_006584631.1| PREDICTED: peroxisomal copper-containing amine oxidase isoform 
X1 [Glycine max]
Length=766

 Score =   267 bits (682),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTG LTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM PG
Sbjct  608  WIVRNTRTVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMHPG  667

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  668  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMP  727

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+ +D D KENG+  KP   GL+AKL
Sbjct  728  HGFFNCSPAVDVPPNQSDLDDKENGLPAKPIQNGLIAKL  766



>emb|CBI14968.3| unnamed protein product [Vitis vinifera]
Length=1372

 Score =   272 bits (696),  Expect = 6e-80, Method: Composition-based stats.
 Identities = 117/126 (93%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EMFPG
Sbjct  628  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMFPG  687

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNRPLEETDIVLWYVFG+ HVPRLEDWPVMPVERIGFML P
Sbjct  688  GEFPNQNPRVGEGLATWVKQNRPLEETDIVLWYVFGLVHVPRLEDWPVMPVERIGFMLQP  747

Query  394  HGFFNC  377
            HGFFNC
Sbjct  748  HGFFNC  753



>ref|XP_003551224.1| PREDICTED: peroxisomal primary amine oxidase-like isoform X1 
[Glycine max]
 gb|KHN07220.1| Primary amine oxidase [Glycine soja]
Length=764

 Score =   266 bits (680),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTG LTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM PG
Sbjct  606  WIVRNTRTVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMHPG  665

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  666  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMP  725

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+ +D D KENG+  KP   GL+AKL
Sbjct  726  HGFFNCSPAVDVPPNPSDLDDKENGLPAKPIQNGLIAKL  764



>ref|XP_010646479.1| PREDICTED: copper amine oxidase 1 isoform X2 [Vitis vinifera]
Length=700

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PG
Sbjct  542  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPG  601

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WV QNR LEETDIVLWYVFGVTH+PRLEDWPVMPVE IGF LMP
Sbjct  602  GEFPNQNPRVGEGLATWVNQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVEHIGFRLMP  661

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ + D K+NGV  KP   GL+AKL
Sbjct  662  HGFFNCSPAVDVPPSTCELDLKDNGVTGKPIQNGLLAKL  700



>emb|CAN62304.1| hypothetical protein VITISV_023689 [Vitis vinifera]
Length=706

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PG
Sbjct  548  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPG  607

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WV QNR LEETDIVLWYVFGVTH+PRLEDWPVMPVE IGF LMP
Sbjct  608  GEFPNQNPRVGEGLATWVNQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVEHIGFRLMP  667

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ D D K+NGV  KP   GL+AKL
Sbjct  668  HGFFNCSPAVDVPPSTCDLDLKDNGVTGKPIQNGLLAKL  706



>ref|XP_010044582.1| PREDICTED: peroxisomal primary amine oxidase-like [Eucalyptus 
grandis]
Length=796

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNRTGQLTGYKL+ GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PG
Sbjct  638  WIIRNTRTVNRTGQLTGYKLLPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPG  697

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMP
Sbjct  698  GEFPNQNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMP  757

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+S D + KENG+  K    GL+AK+
Sbjct  758  HGFFNCSPAVDVPPNSGDSELKENGMAAKSIQNGLLAKM  796



>ref|XP_002273532.2| PREDICTED: copper amine oxidase 1 isoform X1 [Vitis vinifera]
 emb|CBI23365.3| unnamed protein product [Vitis vinifera]
Length=774

 Score =   266 bits (679),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PG
Sbjct  616  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPG  675

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WV QNR LEETDIVLWYVFGVTH+PRLEDWPVMPVE IGF LMP
Sbjct  676  GEFPNQNPRVGEGLATWVNQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVEHIGFRLMP  735

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ + D K+NGV  KP   GL+AKL
Sbjct  736  HGFFNCSPAVDVPPSTCELDLKDNGVTGKPIQNGLLAKL  774



>ref|XP_007044778.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
 gb|EOY00610.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
Length=769

 Score =   265 bits (677),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQLTG+KLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR EM+PG
Sbjct  611  WIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAREEMYPG  670

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVK+NR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP
Sbjct  671  GEFPNQNPRVGEGLATWVKKNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  730

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ D + K+N + TKP   G++AKL
Sbjct  731  HGFFNCSPAVDVPPSATDLELKDNDIATKPIQNGIIAKL  769



>ref|XP_010248627.1| PREDICTED: copper amine oxidase 1-like [Nelumbo nucifera]
Length=780

 Score =   265 bits (677),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 151/159 (95%), Gaps = 1/159 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR+VNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPY+R+EM+PG
Sbjct  623  WIVRNTRSVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYSRDEMYPG  682

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+GEGLA+WVKQ+R LEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  683  GEFPNQNPRIGEGLATWVKQDRSLEETDIVLWYVFGITHIPRLEDWPVMPVERIGFMLMP  742

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+++D D K+N ++TK  H GL+AKL
Sbjct  743  HGFFNCSPAVDVPPNASDLDLKDN-IVTKSIHNGLLAKL  780



>ref|XP_010251089.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Nelumbo nucifera]
Length=740

 Score =   264 bits (674),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 151/159 (95%), Gaps = 1/159 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR+VNRTGQLTGYKLV GSNCLPLAG+EAK LRRA+FLKHNLWVTPY+R+EM+PG
Sbjct  583  WIVRNTRSVNRTGQLTGYKLVPGSNCLPLAGSEAKVLRRASFLKHNLWVTPYSRDEMYPG  642

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQ+RPLEETDIVLWY+FG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  643  GEFPNQNPRVGEGLATWVKQDRPLEETDIVLWYIFGITHIPRLEDWPVMPVERIGFMLMP  702

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS++D D K+N ++TKP   GL+AKL
Sbjct  703  HGFFNCSPAVDVPPSTSDLDLKDN-IVTKPIQNGLLAKL  740



>ref|XP_006438284.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
 gb|ESR51524.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
Length=701

 Score =   263 bits (672),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA +EM+PG
Sbjct  543  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAHDEMYPG  602

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMP
Sbjct  603  GEFPNQNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMP  662

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  663  HGFFNCSPAVDVPPNESDLDLKDTVIAEKPVQNGLLAKL  701



>ref|XP_010251088.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nelumbo nucifera]
Length=766

 Score =   264 bits (674),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 151/159 (95%), Gaps = 1/159 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR+VNRTGQLTGYKLV GSNCLPLAG+EAK LRRA+FLKHNLWVTPY+R+EM+PG
Sbjct  609  WIVRNTRSVNRTGQLTGYKLVPGSNCLPLAGSEAKVLRRASFLKHNLWVTPYSRDEMYPG  668

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQ+RPLEETDIVLWY+FG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  669  GEFPNQNPRVGEGLATWVKQDRPLEETDIVLWYIFGITHIPRLEDWPVMPVERIGFMLMP  728

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS++D D K+N ++TKP   GL+AKL
Sbjct  729  HGFFNCSPAVDVPPSTSDLDLKDN-IVTKPIQNGLLAKL  766



>ref|XP_006483934.1| PREDICTED: copper amine oxidase 1-like [Citrus sinensis]
Length=775

 Score =   264 bits (674),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA +EM+PG
Sbjct  617  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAHDEMYPG  676

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMP
Sbjct  677  GEFPNQNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMP  736

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  737  HGFFNCSPAVDVPPNESDLDLKDTVIAEKPVQNGLLAKL  775



>ref|XP_006438285.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
 gb|ESR51525.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
Length=775

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA +EM+PG
Sbjct  617  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAHDEMYPG  676

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMP
Sbjct  677  GEFPNQNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMP  736

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  737  HGFFNCSPAVDVPPNESDLDLKDTVIAEKPVQNGLLAKL  775



>ref|XP_007044777.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
 gb|EOY00609.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
Length=797

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQLTG+KLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR EM+PG
Sbjct  639  WIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAREEMYPG  698

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVK+NR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP
Sbjct  699  GEFPNQNPRVGEGLATWVKKNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  758

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ D + K+N + TKP   G++AKL
Sbjct  759  HGFFNCSPAVDVPPSATDLELKDNDIATKPIQNGIIAKL  797



>ref|XP_004509661.1| PREDICTED: copper methylamine oxidase-like isoform X1 [Cicer 
arietinum]
Length=760

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR+VNRTG LTGYKLV G+NCLPLAG+EAKFLRRAAFLKHNLWVTPYAR EM+PG
Sbjct  602  WIVRNTRSVNRTGYLTGYKLVPGANCLPLAGSEAKFLRRAAFLKHNLWVTPYARGEMYPG  661

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVKQNRPLEE D+VLWYVFGVTH+PRLEDWPVMPVE IGFMLMP
Sbjct  662  GEFPNQNPRDGEGLATWVKQNRPLEEADVVLWYVFGVTHIPRLEDWPVMPVEHIGFMLMP  721

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS +D D KENG+  KP   GL+AKL
Sbjct  722  HGFFNCSPAVDVPPSPSDLDDKENGMPAKPSQNGLIAKL  760



>ref|XP_006438286.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
 gb|ESR51526.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
Length=785

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA +EM+PG
Sbjct  627  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAHDEMYPG  686

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMP
Sbjct  687  GEFPNQNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMP  746

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  747  HGFFNCSPAVDVPPNESDLDLKDTVIAEKPVQNGLLAKL  785



>ref|XP_008777611.1| PREDICTED: copper amine oxidase 1-like, partial [Phoenix dactylifera]
Length=204

 Score =   247 bits (630),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQ TGYKLV GSNCLPLAG EAKFLRRAAFLKHNLWVTPY R+EM+PG
Sbjct  46   WIVRNTRTVNRTGQPTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYNRDEMYPG  105

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR  EGLA+WVK+NR LEETDIVLWY+FGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  106  GEFPNQNPRPNEGLATWVKKNRSLEETDIVLWYIFGVTHIPRLEDWPVMPVERIGFMLMP  165

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCS AVDVPPS+++ D K+N    K     L+AKL
Sbjct  166  HGFFNCSTAVDVPPSTSEMDVKDNNGTPKLIQNALLAKL  204



>ref|XP_009600855.1| PREDICTED: copper amine oxidase 1-like [Nicotiana tomentosiformis]
Length=779

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 148/160 (93%), Gaps = 1/160 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNRTGQLTGYKLV G+NCLPLAG+EAKFLRRAAFLKHNLWVTPY+ +EMFPG
Sbjct  620  WIIRNTRTVNRTGQLTGYKLVPGTNCLPLAGSEAKFLRRAAFLKHNLWVTPYSGDEMFPG  679

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEET IVLWYVFG+ HVPRLEDWPVMPVE IGFML P
Sbjct  680  GEFPNQNPRVGEGLATWVKQNRSLEETQIVLWYVFGLIHVPRLEDWPVMPVEHIGFMLQP  739

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHP-GLVAKL  278
            HGFFNCSPAVDVPPS+AD D KENGV+TK CH  G++AKL
Sbjct  740  HGFFNCSPAVDVPPSTADSDIKENGVVTKSCHDGGIMAKL  779



>ref|XP_011045265.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Populus euphratica]
Length=700

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNR+GQLTG+KL+ GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PG
Sbjct  542  WIIRNTRTVNRSGQLTGFKLMPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPG  601

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEETD+VLWYVFGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  602  GEFPNQNPRVGEGLATWVKQNRSLEETDVVLWYVFGVTHIPRLEDWPVMPVERIGFMLMP  661

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFN SPAVDVPPS++D D K+N V  KP   GL+AKL
Sbjct  662  HGFFNSSPAVDVPPSASDLDLKDNVVAAKPIQNGLLAKL  700



>ref|XP_010102489.1| Putative primary amine oxidase 2 [Morus notabilis]
 gb|EXB93553.1| Putative primary amine oxidase 2 [Morus notabilis]
Length=708

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 147/163 (90%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNRTG LTGYKLV GSNCLPLAG EAKFLRRAAFLKHNLWVTPYAR+EMFPG
Sbjct  546  WIIRNTRTVNRTGHLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYARDEMFPG  605

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WV+QNRPLEETDIVLWYVFG+THVPRLEDWPVMPVERIGFML P
Sbjct  606  GEFPNQNPRVGEGLATWVQQNRPLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLTP  665

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP++ + D K++ V    + KP   G+++KL
Sbjct  666  HGFFNCSPAVDVPPNACELDAKDSDVKDAGVAKPIQNGMLSKL  708



>ref|XP_011045264.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Populus euphratica]
Length=766

 Score =   262 bits (670),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNR+GQLTG+KL+ GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PG
Sbjct  608  WIIRNTRTVNRSGQLTGFKLMPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPG  667

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEETD+VLWYVFGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  668  GEFPNQNPRVGEGLATWVKQNRSLEETDVVLWYVFGVTHIPRLEDWPVMPVERIGFMLMP  727

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFN SPAVDVPPS++D D K+N V  KP   GL+AKL
Sbjct  728  HGFFNSSPAVDVPPSASDLDLKDNVVAAKPIQNGLLAKL  766



>ref|XP_002314600.1| copper amine oxidase family protein [Populus trichocarpa]
 gb|EEF00771.1| copper amine oxidase family protein [Populus trichocarpa]
Length=700

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNR+GQLTGYKL+ GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PG
Sbjct  542  WIIRNTRTVNRSGQLTGYKLMPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPG  601

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEETD+VLWYVFGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  602  GEFPNQNPRVGEGLATWVKQNRSLEETDVVLWYVFGVTHIPRLEDWPVMPVERIGFMLMP  661

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            +GFFN SPAVDVPPS++D D K+N V  KP   GL+AKL
Sbjct  662  YGFFNSSPAVDVPPSASDLDLKDNVVAAKPIQNGLLAKL  700



>ref|XP_002277961.1| PREDICTED: copper amine oxidase 1-like [Vitis vinifera]
Length=791

 Score =   263 bits (671),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 148/163 (91%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EMFPG
Sbjct  629  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMFPG  688

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNRPLEETDIVLWYVFG+ HVPRLEDWPVMPVERIGFML P
Sbjct  689  GEFPNQNPRVGEGLATWVKQNRPLEETDIVLWYVFGLVHVPRLEDWPVMPVERIGFMLQP  748

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP++ + D K+N V    + KP   GL++K+
Sbjct  749  HGFFNCSPAVDVPPNACELDGKDNDVKDNGVAKPIQTGLLSKI  791



>gb|KDO82258.1| hypothetical protein CISIN_1g004080mg [Citrus sinensis]
Length=701

 Score =   260 bits (665),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNRTGQLTGYKLV GSNCLPLAG+EAK LRRAAFLKHNLWVTPYA +EM+PG
Sbjct  543  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKVLRRAAFLKHNLWVTPYAHDEMYPG  602

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WV+QNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMP
Sbjct  603  GEFPNQNPRVGEGLATWVEQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMP  662

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  663  HGFFNCSPAVDVPPNESDLDLKDTAIAEKPVQNGLLAKL  701



>ref|XP_009802912.1| PREDICTED: peroxisomal primary amine oxidase-like [Nicotiana 
sylvestris]
Length=779

 Score =   262 bits (669),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 147/160 (92%), Gaps = 1/160 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNRTGQLTGYKLV G+NCLPLAG+EAKFLRRAAFLKHNLWVTPY  +EMFPG
Sbjct  620  WIIRNTRTVNRTGQLTGYKLVPGTNCLPLAGSEAKFLRRAAFLKHNLWVTPYCGDEMFPG  679

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEET IVLWYVFG+ HVPRLEDWPVMPVE IGFML P
Sbjct  680  GEFPNQNPRVGEGLATWVKQNRSLEETQIVLWYVFGLIHVPRLEDWPVMPVEHIGFMLQP  739

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHP-GLVAKL  278
            HGFFNCSPAVDVPPS+AD D KENGV+TK CH  G++AKL
Sbjct  740  HGFFNCSPAVDVPPSTADSDIKENGVVTKSCHDGGIMAKL  779



>gb|KEH20158.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=700

 Score =   260 bits (665),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR+VNRTG LTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+E+ PG
Sbjct  542  WIVRNTRSVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDELHPG  601

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNRPLEE DIVLWYVFGVTH+PRLEDWPVMPVE IGFMLMP
Sbjct  602  GEFPNQNPRVGEGLATWVKQNRPLEEADIVLWYVFGVTHIPRLEDWPVMPVEHIGFMLMP  661

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS  D D KENG+  K    GL+AKL
Sbjct  662  HGFFNCSPAVDVPPSPGDLDDKENGMPAKHSQNGLIAKL  700



>gb|AES96091.2| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=737

 Score =   261 bits (666),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGY+LV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPY  NEM PG
Sbjct  579  WIVRNTRTVNRTGQLTGYRLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYVHNEMHPG  638

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVG+GLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  639  GEFPNQNPRVGDGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMP  698

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ D D KENG+  KP    L+AKL
Sbjct  699  HGFFNCSPAVDVPPSAGDLDDKENGMPAKPIQNELIAKL  737



>gb|KDP31040.1| hypothetical protein JCGZ_11416 [Jatropha curcas]
Length=787

 Score =   261 bits (668),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 146/163 (90%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG EAKFLRRAAFLKHNLWVTPYAR+EMFPG
Sbjct  625  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYARDEMFPG  684

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNRPLEE DIVLWYVFG+THVPRLEDWPVMPVERIGFML P
Sbjct  685  GEFPNQNPRVGEGLATWVKQNRPLEENDIVLWYVFGITHVPRLEDWPVMPVERIGFMLSP  744

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP++ + D KE  V    + KP   GL++KL
Sbjct  745  HGFFNCSPAVDVPPNACELDAKETDVKENGVGKPIQSGLLSKL  787



>gb|KEH20159.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=761

 Score =   261 bits (667),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR+VNRTG LTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+E+ PG
Sbjct  603  WIVRNTRSVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDELHPG  662

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNRPLEE DIVLWYVFGVTH+PRLEDWPVMPVE IGFMLMP
Sbjct  663  GEFPNQNPRVGEGLATWVKQNRPLEEADIVLWYVFGVTHIPRLEDWPVMPVEHIGFMLMP  722

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS  D D KENG+  K    GL+AKL
Sbjct  723  HGFFNCSPAVDVPPSPGDLDDKENGMPAKHSQNGLIAKL  761



>gb|KEH20163.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=724

 Score =   260 bits (665),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR+VNRTG LTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+E+ PG
Sbjct  566  WIVRNTRSVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDELHPG  625

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNRPLEE DIVLWYVFGVTH+PRLEDWPVMPVE IGFMLMP
Sbjct  626  GEFPNQNPRVGEGLATWVKQNRPLEEADIVLWYVFGVTHIPRLEDWPVMPVEHIGFMLMP  685

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS  D D KENG+  K    GL+AKL
Sbjct  686  HGFFNCSPAVDVPPSPGDLDDKENGMPAKHSQNGLIAKL  724



>ref|XP_003613133.1| Copper amine oxidase [Medicago truncatula]
Length=750

 Score =   261 bits (666),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGY+LV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPY  NEM PG
Sbjct  592  WIVRNTRTVNRTGQLTGYRLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYVHNEMHPG  651

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVG+GLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  652  GEFPNQNPRVGDGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMP  711

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ D D KENG+  KP    L+AKL
Sbjct  712  HGFFNCSPAVDVPPSAGDLDDKENGMPAKPIQNELIAKL  750



>gb|KDO82257.1| hypothetical protein CISIN_1g004080mg [Citrus sinensis]
Length=775

 Score =   261 bits (667),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNRTGQLTGYKLV GSNCLPLAG+EAK LRRAAFLKHNLWVTPYA +EM+PG
Sbjct  617  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKVLRRAAFLKHNLWVTPYAHDEMYPG  676

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WV+QNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMP
Sbjct  677  GEFPNQNPRVGEGLATWVEQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMP  736

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  737  HGFFNCSPAVDVPPNESDLDLKDTAIAEKPVQNGLLAKL  775



>gb|KEH20157.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=774

 Score =   261 bits (667),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR+VNRTG LTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+E+ PG
Sbjct  616  WIVRNTRSVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDELHPG  675

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNRPLEE DIVLWYVFGVTH+PRLEDWPVMPVE IGFMLMP
Sbjct  676  GEFPNQNPRVGEGLATWVKQNRPLEEADIVLWYVFGVTHIPRLEDWPVMPVEHIGFMLMP  735

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS  D D KENG+  K    GL+AKL
Sbjct  736  HGFFNCSPAVDVPPSPGDLDDKENGMPAKHSQNGLIAKL  774



>ref|XP_002527922.1| copper amine oxidase, putative [Ricinus communis]
 gb|EEF34479.1| copper amine oxidase, putative [Ricinus communis]
Length=795

 Score =   261 bits (667),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 148/160 (93%), Gaps = 1/160 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA +EM+PG
Sbjct  636  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAPDEMYPG  695

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEET+IVLWYVFGVTH+PRLEDWPVMPVERIGF+LMP
Sbjct  696  GEFPNQNPRVGEGLATWVKQNRSLEETNIVLWYVFGVTHIPRLEDWPVMPVERIGFILMP  755

Query  394  HGFFNCspavdvppssadpdPKENGVITK-PCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ D D K+NG+  K P   GL+AKL
Sbjct  756  HGFFNCSPAVDVPPSACDMDIKDNGITAKPPIQNGLLAKL  795



>ref|XP_002318664.1| hypothetical protein POPTR_0012s08630g [Populus trichocarpa]
 gb|EEE96884.1| hypothetical protein POPTR_0012s08630g [Populus trichocarpa]
Length=751

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 146/163 (90%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFL HNLWVTPY   EMFPG
Sbjct  589  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLNHNLWVTPYTHGEMFPG  648

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRV EGLA+WVKQNRPLEETDIVLWYVFG+THVPRLEDWPVMPVER+GFMLMP
Sbjct  649  GEFPNQNPRVDEGLATWVKQNRPLEETDIVLWYVFGITHVPRLEDWPVMPVERLGFMLMP  708

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ + D K+N V    +TKP   G++AKL
Sbjct  709  HGFFNCSPAVDVPPSTCELDAKDNDVKDNGVTKPLQNGVLAKL  751



>gb|KCW83296.1| hypothetical protein EUGRSUZ_B00228 [Eucalyptus grandis]
Length=1349

 Score =   266 bits (679),  Expect = 2e-77, Method: Composition-based stats.
 Identities = 114/126 (90%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVT YA +EMFPG
Sbjct  607  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTAYAPDEMFPG  666

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGL++WVK+NRPLEETD+VLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  667  GEFPNQNPRVGEGLSTWVKRNRPLEETDVVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  726

Query  394  HGFFNC  377
            HGFFNC
Sbjct  727  HGFFNC  732



>ref|XP_008389732.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Malus domestica]
Length=781

 Score =   261 bits (666),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVT YAR+EM+PG
Sbjct  623  WIVRNTRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSYARDEMYPG  682

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+GEGLA+WV++NR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGF LMP
Sbjct  683  GEFPNQNPRIGEGLATWVQKNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFTLMP  742

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ + D K+NG+  KP   GL+AKL
Sbjct  743  HGFFNCSPAVDVPPSTCELDLKDNGMAAKPIQSGLLAKL  781



>ref|XP_008389733.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Malus domestica]
Length=775

 Score =   260 bits (665),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVT YAR+EM+PG
Sbjct  617  WIVRNTRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSYARDEMYPG  676

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+GEGLA+WV++NR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGF LMP
Sbjct  677  GEFPNQNPRIGEGLATWVQKNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFTLMP  736

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ + D K+NG+  KP   GL+AKL
Sbjct  737  HGFFNCSPAVDVPPSTCELDLKDNGMAAKPIQSGLLAKL  775



>ref|XP_004239124.1| PREDICTED: copper amine oxidase 1 [Solanum lycopersicum]
Length=776

 Score =   260 bits (665),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 145/160 (91%), Gaps = 1/160 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPY+R EMFPG
Sbjct  617  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYSREEMFPG  676

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WV+QNR LEET IVLWY+FG+ HVPRLEDWPVMPVE IGFML P
Sbjct  677  GEFPNQNPRVGEGLATWVQQNRSLEETQIVLWYIFGLIHVPRLEDWPVMPVEHIGFMLQP  736

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCH-PGLVAKL  278
            HGFFNCSPAVDVPPS +D D KENG + K CH  G+++KL
Sbjct  737  HGFFNCSPAVDVPPSMSDSDIKENGTVAKSCHNDGVMSKL  776



>ref|XP_002322194.2| hypothetical protein POPTR_0015s09450g [Populus trichocarpa]
 gb|EEF06321.2| hypothetical protein POPTR_0015s09450g [Populus trichocarpa]
Length=773

 Score =   260 bits (664),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 145/163 (89%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG EAKFLRRAAFL HNLWVTPY   EMFPG
Sbjct  611  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLNHNLWVTPYTHGEMFPG  670

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNRPLEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  671  GEFPNQNPRVGEGLATWVKQNRPLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  730

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ + D K+N      ++KP   G++AKL
Sbjct  731  HGFFNCSPAVDVPPSACELDAKDNDAKDNSVSKPLQNGVLAKL  773



>gb|KJB50258.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=779

 Score =   260 bits (665),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQLTG+KLV GSNCLPLAG+EAKFLRRA FLKHNLWVTPY+R EM PG
Sbjct  621  WIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPYSREEMHPG  680

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP
Sbjct  681  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  740

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ D + K+  + TKP   G++AKL
Sbjct  741  HGFFNCSPAVDVPPSATDLELKDTDIATKPIQNGIIAKL  779



>ref|XP_003519633.1| PREDICTED: copper amine oxidase 1-like [Glycine max]
Length=760

 Score =   260 bits (664),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPY   EM PG
Sbjct  602  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYVPGEMHPG  661

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WV++NR LEE DIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  662  GEFPNQNPRVGEGLATWVQKNRSLEEADIVLWYVFGITHIPRLEDWPVMPVERIGFMLMP  721

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS++D D KENG+  KP   G++AKL
Sbjct  722  HGFFNCSPAVDVPPSASDLDDKENGMSAKPIQNGMIAKL  760



>ref|XP_011047815.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Populus euphratica]
Length=771

 Score =   260 bits (664),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 146/163 (90%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFL HNLWVTPY   EMFPG
Sbjct  609  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLNHNLWVTPYTHGEMFPG  668

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRV EGLA+WVKQNRPLEETDIVLWYVFG+THVPRLEDWPVMPVER+GFMLMP
Sbjct  669  GEFPNQNPRVDEGLATWVKQNRPLEETDIVLWYVFGITHVPRLEDWPVMPVERLGFMLMP  728

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ + D K+N V    +TKP   G++AKL
Sbjct  729  HGFFNCSPAVDVPPSTCELDAKDNDVKDNGVTKPLQNGVLAKL  771



>ref|XP_004489782.1| PREDICTED: copper methylamine oxidase-like [Cicer arietinum]
Length=761

 Score =   259 bits (663),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGY+LV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPY  NEM PG
Sbjct  603  WIVRNTRTVNRTGQLTGYRLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYVHNEMHPG  662

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVE IGFMLMP
Sbjct  663  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVEHIGFMLMP  722

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ D D KEN +  KP   GL+AKL
Sbjct  723  HGFFNCSPAVDVPPSAGDLDDKENVMSAKPIQNGLIAKL  761



>gb|AIS23648.1| amine oxidase 5 [Malus domestica]
Length=788

 Score =   260 bits (664),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 146/163 (90%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG EAKFLRRAAFLKHNLWVTPY+R+EMFPG
Sbjct  626  WIVQNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYSRDEMFPG  685

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVK+NR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  686  GEFPNQNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  745

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFN SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  746  HGFFNASPAVDVPPSACELEAKENDVKDSGVAKPIQSGLLAKL  788



>ref|XP_002511334.1| copper amine oxidase, putative [Ricinus communis]
 gb|EEF51936.1| copper amine oxidase, putative [Ricinus communis]
Length=797

 Score =   260 bits (665),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 145/163 (89%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNR GQLTGYKLV GSNCLPLAG EAKFLRRAAFLKHNLWVTPYAR+EMFPG
Sbjct  635  WIVRNTRTVNRMGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYARDEMFPG  694

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRV EGL++WVKQNR LEETD+VLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  695  GEFPNQNPRVAEGLSTWVKQNRSLEETDVVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  754

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+  + D KEN V    + KP   GL+AKL
Sbjct  755  HGFFNCSPAVDVPPNVCELDIKENDVKENGVAKPLQNGLLAKL  797



>gb|KJB50254.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=789

 Score =   260 bits (664),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQLTG+KLV GSNCLPLAG+EAKFLRRA FLKHNLWVTPY+R EM PG
Sbjct  631  WIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPYSREEMHPG  690

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP
Sbjct  691  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  750

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ D + K+  + TKP   G++AKL
Sbjct  751  HGFFNCSPAVDVPPSATDLELKDTDIATKPIQNGIIAKL  789



>ref|XP_011047814.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Populus euphratica]
Length=774

 Score =   259 bits (663),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 146/163 (90%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFL HNLWVTPY   EMFPG
Sbjct  612  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLNHNLWVTPYTHGEMFPG  671

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRV EGLA+WVKQNRPLEETDIVLWYVFG+THVPRLEDWPVMPVER+GFMLMP
Sbjct  672  GEFPNQNPRVDEGLATWVKQNRPLEETDIVLWYVFGITHVPRLEDWPVMPVERLGFMLMP  731

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ + D K+N V    +TKP   G++AKL
Sbjct  732  HGFFNCSPAVDVPPSTCELDAKDNDVKDNGVTKPLQNGVLAKL  774



>ref|XP_007158407.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
 gb|ESW30401.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
Length=769

 Score =   259 bits (662),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPY   EM PG
Sbjct  611  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYVPEEMHPG  670

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WV+QNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGF+LMP
Sbjct  671  GEFPNQNPRVGEGLATWVQQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFLLMP  730

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS++D D K+NG+  KP   G++AKL
Sbjct  731  HGFFNCSPAVDVPPSASDLDDKDNGMSAKPIQNGVIAKL  769



>gb|KHN00390.1| Copper methylamine oxidase [Glycine soja]
Length=770

 Score =   259 bits (662),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLP+AG+EAKFLRRAAFLKHNLWVTPY   EM PG
Sbjct  612  WIVRNTRTVNRTGQLTGYKLVPGSNCLPMAGSEAKFLRRAAFLKHNLWVTPYVPGEMHPG  671

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WV++NR LEE DIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  672  GEFPNQNPRVGEGLATWVQKNRSLEEADIVLWYVFGITHIPRLEDWPVMPVERIGFMLMP  731

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS++D D KENG+  KP   G++AKL
Sbjct  732  HGFFNCSPAVDVPPSASDLDDKENGMSAKPIQNGMIAKL  770



>ref|XP_011046219.1| PREDICTED: copper amine oxidase 1-like [Populus euphratica]
Length=777

 Score =   259 bits (662),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 144/163 (88%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG EAKFLRRAAFL HNLWVTPY   EMFPG
Sbjct  615  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLNHNLWVTPYTHGEMFPG  674

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNRPLEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  675  GEFPNQNPRVGEGLATWVKQNRPLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  734

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ + + K+N      + KP   G++AKL
Sbjct  735  HGFFNCSPAVDVPPSACELEAKDNDAKDNSVAKPLQNGVLAKL  777



>gb|KHG02854.1| Copper methylamine oxidase [Gossypium arboreum]
Length=804

 Score =   259 bits (663),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQLTG+KLV GSNCLPLAG+EAKFLRRA FLKHNLWVTPY+R EM PG
Sbjct  646  WIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPYSREEMHPG  705

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP
Sbjct  706  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  765

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ D + K+  + TKP   G++AKL
Sbjct  766  HGFFNCSPAVDVPPSATDLELKDADIATKPIQNGIIAKL  804



>ref|XP_007225246.1| hypothetical protein PRUPE_ppa001698mg [Prunus persica]
 gb|EMJ26445.1| hypothetical protein PRUPE_ppa001698mg [Prunus persica]
Length=777

 Score =   259 bits (662),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVT YAR+E++PG
Sbjct  619  WIVRNTRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSYARDEVYPG  678

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+GEGLA+WVK+NR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGF LMP
Sbjct  679  GEFPNQNPRIGEGLATWVKKNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFTLMP  738

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCS AVDVPP++ D D K+NG+  KP   GL+AKL
Sbjct  739  HGFFNCSTAVDVPPNTCDLDLKDNGMTAKPIQNGLLAKL  777



>ref|XP_008380537.1| PREDICTED: copper amine oxidase 1-like [Malus domestica]
Length=788

 Score =   259 bits (662),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 146/163 (90%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG EAKFLRRAAFLKHNLWVTPY+R+EMFPG
Sbjct  626  WIVQNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYSRDEMFPG  685

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVK+NR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  686  GEFPNQNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  745

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFN SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  746  HGFFNASPAVDVPPSACELEAKENDVKDSGVAKPIQNGLLAKL  788



>ref|XP_007158406.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
 gb|ESW30400.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
Length=757

 Score =   258 bits (660),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPY   EM PG
Sbjct  599  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYVPEEMHPG  658

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WV+QNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGF+LMP
Sbjct  659  GEFPNQNPRVGEGLATWVQQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFLLMP  718

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS++D D K+NG+  KP   G++AKL
Sbjct  719  HGFFNCSPAVDVPPSASDLDDKDNGMSAKPIQNGVIAKL  757



>ref|XP_007153778.1| hypothetical protein PHAVU_003G064200g [Phaseolus vulgaris]
 gb|ESW25772.1| hypothetical protein PHAVU_003G064200g [Phaseolus vulgaris]
Length=755

 Score =   258 bits (660),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 144/160 (90%), Gaps = 1/160 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTG LTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM PG
Sbjct  596  WIVRNTRTVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMHPG  655

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVE IGFMLMP
Sbjct  656  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVEHIGFMLMP  715

Query  394  HGFFNCspavdvppssadpdPKE-NGVITKPCHPGLVAKL  278
            HGFFNCSPA+DVPP+  D D KE NG+  KP   GL+AKL
Sbjct  716  HGFFNCSPAIDVPPNPGDLDDKENNGLPAKPNQNGLIAKL  755



>ref|XP_008221920.1| PREDICTED: copper amine oxidase 1-like [Prunus mume]
Length=777

 Score =   259 bits (661),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVT YAR+E++PG
Sbjct  619  WIVRNTRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSYARDEVYPG  678

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+GEGLA+WVK+NR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGF LMP
Sbjct  679  GEFPNQNPRIGEGLATWVKKNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFTLMP  738

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCS AVDVPP++ D D K+NG+  KP   GL+AKL
Sbjct  739  HGFFNCSTAVDVPPNTCDLDLKDNGMTAKPIQNGLLAKL  777



>gb|KHG02564.1| Primary amine oxidase [Gossypium arboreum]
Length=756

 Score =   258 bits (659),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQLTG+KLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA +EM+PG
Sbjct  598  WIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAHDEMYPG  657

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEE D+VLWYVFGV H+PRLEDWPVMPV+RIGFMLMP
Sbjct  658  GEFPNQNPRVGEGLATWVKQNRSLEEADVVLWYVFGVIHIPRLEDWPVMPVDRIGFMLMP  717

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ D + K+N + TKP    ++AKL
Sbjct  718  HGFFNCSPAVDVPPSTTDLELKDNDIATKPIQNVIIAKL  756



>gb|AIS23644.1| amine oxidase 1 [Malus domestica]
Length=775

 Score =   258 bits (660),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVT YAR+EM PG
Sbjct  617  WIVRNTRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSYARDEMNPG  676

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+GEGLA+WV++NR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGF LMP
Sbjct  677  GEFPNQNPRIGEGLATWVQKNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFTLMP  736

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ + D K+NG+  KP   GL+AKL
Sbjct  737  HGFFNCSPAVDVPPSTCELDLKDNGMAAKPIQSGLLAKL  775



>gb|KJB15626.1| hypothetical protein B456_002G186900 [Gossypium raimondii]
Length=771

 Score =   258 bits (659),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQLTG+KLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA +EM+PG
Sbjct  613  WIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAHDEMYPG  672

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEE D+VLWYVFGV H+PRLEDWPVMPV+RIGFMLMP
Sbjct  673  GEFPNQNPRVGEGLATWVKQNRSLEEADVVLWYVFGVIHIPRLEDWPVMPVDRIGFMLMP  732

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ D + K+N + TKP    ++AKL
Sbjct  733  HGFFNCSPAVDVPPSTTDLELKDNDIATKPVQNVIIAKL  771



>ref|XP_009362949.1| PREDICTED: copper amine oxidase 1-like [Pyrus x bretschneideri]
Length=785

 Score =   257 bits (656),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 145/163 (89%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG EAKFLRRAAFLKHNLWVT Y+R+EMFPG
Sbjct  623  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQYSRDEMFPG  682

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVK+NR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  683  GEFPNQNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  742

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFN SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  743  HGFFNASPAVDVPPSACELEAKENDVKDSGVAKPVQNGLLAKL  785



>ref|XP_006357609.1| PREDICTED: copper amine oxidase 1-like [Solanum tuberosum]
Length=776

 Score =   257 bits (656),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPY+R E+FPG
Sbjct  617  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYSREEIFPG  676

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WV+QNR LEET IVLWY+FG+ HVPRLEDWPVMPVE IGFML P
Sbjct  677  GEFPNQNPRVGEGLATWVQQNRSLEETQIVLWYIFGLIHVPRLEDWPVMPVEHIGFMLQP  736

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCH  299
            HGFFNCSPAVDVPPS +D D KENG + K CH
Sbjct  737  HGFFNCSPAVDVPPSMSDSDIKENGTVAKSCH  768



>ref|XP_008367500.1| PREDICTED: copper amine oxidase 1-like [Malus domestica]
Length=788

 Score =   257 bits (656),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 145/163 (89%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG EAKFLRRAAFLKHNLWVT Y+R+EMFPG
Sbjct  626  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQYSRDEMFPG  685

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVK+NR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  686  GEFPNQNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  745

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFN SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  746  HGFFNASPAVDVPPSACELEAKENDVKDSGVAKPIQNGLLAKL  788



>ref|XP_010682433.1| PREDICTED: copper amine oxidase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=773

 Score =   256 bits (655),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 145/160 (91%), Gaps = 1/160 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG EAKFLRRAAFLKHNLWVT YA+NEM+PG
Sbjct  614  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTSYAQNEMYPG  673

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVK++R LEE DIVLWYVFG+TH+PRLEDWPVMPVE +GFMLMP
Sbjct  674  GEFPNQNPRSGEGLATWVKKDRSLEEADIVLWYVFGLTHIPRLEDWPVMPVEHLGFMLMP  733

Query  394  HGFFNCspavdvppssadpdPKE-NGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP++ + D KE NGV+ KP   GL+AKL
Sbjct  734  HGFFNCSPAVDVPPNTHESDSKETNGVVAKPVQNGLIAKL  773



>gb|AIS23647.1| amine oxidase 4 [Malus domestica]
Length=788

 Score =   256 bits (655),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 145/163 (89%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG EAKFLRRAAFLKHNLWVT Y+R+EMFPG
Sbjct  626  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQYSRDEMFPG  685

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVK+NR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  686  GEFPNQNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  745

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFN SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  746  HGFFNASPAVDVPPSACELEAKENDVKDSGVAKPIQNGLLAKL  788



>ref|XP_009345773.1| PREDICTED: copper amine oxidase 1-like [Pyrus x bretschneideri]
Length=785

 Score =   256 bits (655),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 145/163 (89%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG EAKFLRRAAFLKHNLWVT Y+R+EMFPG
Sbjct  623  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQYSRDEMFPG  682

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVK+NR LEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  683  GEFPNQNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHIPRLEDWPVMPVERIGFMLMP  742

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFN SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  743  HGFFNASPAVDVPPSACELEAKENDVKDSGVAKPVQNGLLAKL  785



>ref|XP_004301007.1| PREDICTED: copper amine oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=789

 Score =   256 bits (655),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 146/163 (90%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG EAKFLRRAAFLKHNLWVTPY+R+EM+PG
Sbjct  627  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYSRDEMYPG  686

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVK+NR LEETDIVLWYVFG+TH+PRLEDWPVMPVE +GF+LMP
Sbjct  687  GEFPNQNPRVGEGLATWVKKNRSLEETDIVLWYVFGITHIPRLEDWPVMPVEHLGFVLMP  746

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNC PAVDVPPS+ + + KE+ V    + KP   GL+AKL
Sbjct  747  HGFFNCCPAVDVPPSACESEVKEDDVKDNGVAKPIQNGLMAKL  789



>gb|AFK48029.1| unknown [Lotus japonicus]
Length=174

 Score =   239 bits (610),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 140/163 (86%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR+ NRTGQLTGYKLV GSNCLPLA +EAKFLRRAAFLKHNLWVT Y+ +E+FPG
Sbjct  12   WIVRNTRSGNRTGQLTGYKLVPGSNCLPLARSEAKFLRRAAFLKHNLWVTKYSHDEVFPG  71

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRV EGLA+WVKQNR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  72   GEFPNQNPRVSEGLATWVKQNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  131

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP++   D K+N V     +K     L AKL
Sbjct  132  HGFFNCSPAVDVPPNTCVGDSKDNDVKDNGASKTIPGALAAKL  174



>ref|XP_004309984.2| PREDICTED: copper amine oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=780

 Score =   255 bits (652),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI+++TR VNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVT YAR+EM+PG
Sbjct  622  WIVRHTRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSYARDEMYPG  681

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WV+Q+R LEE DIVLWYVFGVTH+PRLEDWPVMPVE IGF LMP
Sbjct  682  GEFPNQNPRVGEGLATWVQQDRSLEEADIVLWYVFGVTHIPRLEDWPVMPVEHIGFTLMP  741

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCS AVDVPP++ + D KEN + TKP    LVAKL
Sbjct  742  HGFFNCSTAVDVPPNTCENDLKENEMSTKPIQTALVAKL  780



>ref|XP_006476867.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Citrus sinensis]
Length=775

 Score =   254 bits (649),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 144/163 (88%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG +A   RRAAFLKHNLWVT YAR+EMFPG
Sbjct  613  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPDATVFRRAAFLKHNLWVTAYARDEMFPG  672

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+GEGL +WVKQNRPLEE+DIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  673  GEFPNQNPRIGEGLPAWVKQNRPLEESDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  732

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ + D K+N V    + KP   GL+AK+
Sbjct  733  HGFFNCSPAVDVPPSACELDAKDNDVKDNTVPKPIREGLLAKI  775



>gb|KDO69506.1| hypothetical protein CISIN_1g004084mg [Citrus sinensis]
Length=775

 Score =   254 bits (649),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 144/163 (88%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG +A   RRAAFLKHNLWVT YAR+EMFPG
Sbjct  613  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPDATVFRRAAFLKHNLWVTAYARDEMFPG  672

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+GEGL +WVKQNRPLEE+DIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  673  GEFPNQNPRIGEGLPAWVKQNRPLEESDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  732

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ + D K+N V    + KP   GL+AK+
Sbjct  733  HGFFNCSPAVDVPPSACELDAKDNDVKDNTVPKPIREGLLAKI  775



>ref|XP_006439904.1| hypothetical protein CICLE_v10018950mg [Citrus clementina]
 gb|ESR53144.1| hypothetical protein CICLE_v10018950mg [Citrus clementina]
Length=775

 Score =   254 bits (649),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 144/163 (88%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG +A   RRAAFLKHNLWVT YAR+EMFPG
Sbjct  613  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPDATVFRRAAFLKHNLWVTAYARDEMFPG  672

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+GEGL +WVKQNRPLEE+DIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  673  GEFPNQNPRIGEGLPAWVKQNRPLEESDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  732

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ + D K+N V    + KP   GL+AK+
Sbjct  733  HGFFNCSPAVDVPPSACELDAKDNDVKDNTVPKPIREGLLAKI  775



>ref|XP_007036329.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
 gb|EOY20830.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
Length=797

 Score =   254 bits (649),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 145/163 (89%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVT YA +EMFPG
Sbjct  635  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTRYAPDEMFPG  694

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVKQ+RPLEETDIVLWYVFG+THVPRLEDWPVMPVE IGFMLMP
Sbjct  695  GEFPNQNPRAGEGLATWVKQDRPLEETDIVLWYVFGITHVPRLEDWPVMPVEHIGFMLMP  754

Query  394  HGFFNCspavdvppssadpdPKEN----GVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP++ + D K+N     V+ K    GL+AKL
Sbjct  755  HGFFNCSPAVDVPPNACELDTKDNEIKENVVPKSTQNGLLAKL  797



>ref|XP_008464520.1| PREDICTED: copper amine oxidase 1 isoform X2 [Cucumis melo]
Length=704

 Score =   252 bits (644),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 147/163 (90%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKL+ GSNCLPLAG+EAKFLRRA+FLKHNLWVT Y+R+EMFPG
Sbjct  542  WIVRNTRTVNRTGQLTGYKLLPGSNCLPLAGSEAKFLRRASFLKHNLWVTQYSRDEMFPG  601

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGL++WVKQ+RPLEETDIVLWYVFG+THVPRLEDWPVMPV+RIGF L+P
Sbjct  602  GEFPNQNPRVGEGLSTWVKQDRPLEETDIVLWYVFGITHVPRLEDWPVMPVDRIGFTLLP  661

Query  394  HGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ + D K+      V+TKP    ++AKL
Sbjct  662  HGFFNCSPAVDVPPSTCELDSKDTDAKETVVTKPIQTPIIAKL  704



>ref|XP_006476868.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Citrus sinensis]
Length=704

 Score =   252 bits (644),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 144/163 (88%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG +A   RRAAFLKHNLWVT YAR+EMFPG
Sbjct  542  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPDATVFRRAAFLKHNLWVTAYARDEMFPG  601

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+GEGL +WVKQNRPLEE+DIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  602  GEFPNQNPRIGEGLPAWVKQNRPLEESDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  661

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ + D K+N V    + KP   GL+AK+
Sbjct  662  HGFFNCSPAVDVPPSACELDAKDNDVKDNTVPKPIREGLLAKI  704



>emb|CDP12746.1| unnamed protein product [Coffea canephora]
Length=773

 Score =   254 bits (648),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 142/163 (87%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNRTGQLTGYKLV GSNCLP+AG EAKFLRRAAFLKHNLWVT YAR E FPG
Sbjct  611  WIIRNTRTVNRTGQLTGYKLVPGSNCLPMAGPEAKFLRRAAFLKHNLWVTQYARGEDFPG  670

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGL SWVKQNR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGF+L P
Sbjct  671  GEFPNQNPRVGEGLDSWVKQNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFLLQP  730

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP + + D K+N V    + KP   GLVAKL
Sbjct  731  HGFFNCSPAVDVPPGACEMDGKDNDVKESSLAKPIPTGLVAKL  773



>ref|XP_008464519.1| PREDICTED: copper amine oxidase 1 isoform X1 [Cucumis melo]
Length=791

 Score =   254 bits (648),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 147/163 (90%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKL+ GSNCLPLAG+EAKFLRRA+FLKHNLWVT Y+R+EMFPG
Sbjct  629  WIVRNTRTVNRTGQLTGYKLLPGSNCLPLAGSEAKFLRRASFLKHNLWVTQYSRDEMFPG  688

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGL++WVKQ+RPLEETDIVLWYVFG+THVPRLEDWPVMPV+RIGF L+P
Sbjct  689  GEFPNQNPRVGEGLSTWVKQDRPLEETDIVLWYVFGITHVPRLEDWPVMPVDRIGFTLLP  748

Query  394  HGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ + D K+      V+TKP    ++AKL
Sbjct  749  HGFFNCSPAVDVPPSTCELDSKDTDAKETVVTKPIQTPIIAKL  791



>ref|XP_006845257.1| hypothetical protein AMTR_s00005p00262140 [Amborella trichopoda]
 gb|ERN06932.1| hypothetical protein AMTR_s00005p00262140 [Amborella trichopoda]
Length=786

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR+VNRTGQLTGYKL+ GSNCLPLAG+EAKFLRRAAFLKHNLWVT Y R+E +PG
Sbjct  629  WIVRNTRSVNRTGQLTGYKLLPGSNCLPLAGSEAKFLRRAAFLKHNLWVTAYKRDEKYPG  688

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+ EGLA+WVKQNRPLEE DIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMP
Sbjct  689  GEFPNQNPRIDEGLATWVKQNRPLEENDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMP  748

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPSS + D KE GV  KP   GLV+KL
Sbjct  749  HGFFNCSPAVDVPPSSTETDLKEIGV-PKPLQNGLVSKL  786



>ref|XP_011101289.1| PREDICTED: copper amine oxidase 1-like [Sesamum indicum]
Length=777

 Score =   252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 141/163 (87%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTR+VNR GQLTGYKLV GSNCLPLAG EAKFLRRAAFLKHNLWVTPYAR E FPG
Sbjct  615  WIIRNTRSVNRNGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYARGEDFPG  674

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLASWVKQNR LEE DIVLWYVFG+THVPRLEDWPVMPVE IGF+L P
Sbjct  675  GEFPNQNPRVGEGLASWVKQNRSLEEADIVLWYVFGITHVPRLEDWPVMPVEHIGFVLQP  734

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP++ D D KEN V    + K    GL+AKL
Sbjct  735  HGFFNCSPAVDVPPNACDMDAKENDVKDNGVAKSISSGLIAKL  777



>ref|XP_010100391.1| Copper methylamine oxidase [Morus notabilis]
 gb|EXB82525.1| Copper methylamine oxidase [Morus notabilis]
Length=841

 Score =   253 bits (647),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 141/154 (92%), Gaps = 2/154 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQLTGY+LV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA++EM+PG
Sbjct  644  WIVRNTRNVNRTGQLTGYRLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAKDEMYPG  703

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WV QNR LEE DIVLWYVFGVTH+PRLEDWPVMP +RIGFMLMP
Sbjct  704  GEFPNQNPRVGEGLATWVNQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPADRIGFMLMP  763

Query  394  HGFFNCspavdvppssadpdPKE--NGVITKPCH  299
            HGFFNCSPAVDVPPSS+D + K+  NGV  KP H
Sbjct  764  HGFFNCSPAVDVPPSSSDLELKDNGNGVTAKPIH  797



>ref|XP_010027284.1| PREDICTED: copper amine oxidase 1 [Eucalyptus grandis]
Length=769

 Score =   252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVT YA +EMFPG
Sbjct  607  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTAYAPDEMFPG  666

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGL++WVK+NRPLEETD+VLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  667  GEFPNQNPRVGEGLSTWVKRNRPLEETDVVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  726

Query  394  HGFFNCspavdvppssadpdPKENGV  317
            HGFFNCSPAVDVPPS+ D D K+N V
Sbjct  727  HGFFNCSPAVDVPPSTCDMDAKDNEV  752



>gb|AES71447.2| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=548

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 145/163 (89%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRT NRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHN+WVT Y+R+EMFPG
Sbjct  386  WIVRNTRTGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNVWVTAYSRDEMFPG  445

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+W+KQNR LEET+IVLWYVFG+THVPRLEDWPVMPVE IGFMLMP
Sbjct  446  GEFPNQNPRVGEGLATWIKQNRSLEETNIVLWYVFGITHVPRLEDWPVMPVEHIGFMLMP  505

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+S + + K++ +     +KP   G+ +KL
Sbjct  506  HGFFNCSPAVDVPPNSCEVESKDSDIKDNGASKPIQGGIASKL  548



>ref|XP_008239321.1| PREDICTED: copper amine oxidase 1-like [Prunus mume]
Length=784

 Score =   252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 144/161 (89%), Gaps = 4/161 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA++EMFPG
Sbjct  621  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAQDEMFPG  680

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRV EGLA+WV +NR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  681  GEFPNQNPRVSEGLATWVNKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  740

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVA  284
            HGFFNCSPAVDVPPS+ + + K+N V    + K    GL+A
Sbjct  741  HGFFNCSPAVDVPPSACELEAKDNDVKDNGVAKSIPNGLLA  781



>ref|XP_010532283.1| PREDICTED: copper amine oxidase 1-like [Tarenaya hassleriana]
Length=789

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 142/167 (85%), Gaps = 8/167 (5%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W+++NTRTVNRTGQLTGYKLV GSNCLPLA  EAKFLRRAAFLKHNLWVTPYA NEMFPG
Sbjct  623  WVVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTPYAPNEMFPG  682

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNRPLEE+DIVLWYVFG+THVPRLEDWPVMPVE IGF LMP
Sbjct  683  GEFPNQNPRVGEGLATWVKQNRPLEESDIVLWYVFGITHVPRLEDWPVMPVEHIGFTLMP  742

Query  394  HGFFNCspavdv-------ppssadpdPKENGVITKPCHP-GLVAKL  278
            HGFFNCSPAVDV          + D D KEN V +KP    GL+AKL
Sbjct  743  HGFFNCSPAVDVPPSLSPCELDTKDSDVKENVVASKPIQNGGLLAKL  789



>ref|XP_010907652.1| PREDICTED: copper amine oxidase 1 [Elaeis guineensis]
Length=771

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQ TGYKLV GSNCLPLAG EAKFLRRAAFLKHNLWVTPY R+EM+PG
Sbjct  613  WIVRNTRTVNRTGQPTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYNRDEMYPG  672

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR  EGLA+WVK+NRPLEETDIVLWY+FGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  673  GEFPNQNPRPNEGLATWVKKNRPLEETDIVLWYIFGVTHIPRLEDWPVMPVERIGFMLMP  732

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP  ++ + K+N    K    GL+AKL
Sbjct  733  HGFFNCSPAVDVPPGHSEVEVKDNNGTPKLIQNGLLAKL  771



>gb|EPS71193.1| hypothetical protein M569_03564, partial [Genlisea aurea]
Length=202

 Score =   236 bits (601),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNR+GQLTGYKLV GSNCLPLAG EAKFLRRAAFLKHNLWVT YAR E FPG
Sbjct  51   WIVRNTRAVNRSGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQYARGEDFPG  110

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLASWVKQNR LEE DIVLWYVFG+THVPR EDWPVMPVE IGF+L P
Sbjct  111  GEFPNQNPRAGEGLASWVKQNRSLEEADIVLWYVFGITHVPRPEDWPVMPVEHIGFVLQP  170

Query  394  HGFFNCspavdvppssadpdPKEN  323
            HGFFNCSPAVDVPP++ + + KEN
Sbjct  171  HGFFNCSPAVDVPPNACETESKEN  194



>ref|XP_006581907.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Glycine max]
Length=724

 Score =   250 bits (638),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 144/163 (88%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W+++NTRT NRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHN WVT Y+R+E+FPG
Sbjct  562  WVVRNTRTCNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNFWVTTYSRDELFPG  621

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEET++VLWY+FG+THVPRLEDWPVMPVERIGFML P
Sbjct  622  GEFPNQNPRVGEGLATWVKQNRSLEETNVVLWYIFGITHVPRLEDWPVMPVERIGFMLTP  681

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP++ + D K+N +     +KP   GL AKL
Sbjct  682  HGFFNCSPAVDVPPNACEMDSKDNDIKDNGSSKPIQSGLTAKL  724



>ref|XP_003527002.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Glycine max]
Length=774

 Score =   251 bits (640),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 144/163 (88%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W+++NTRT NRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHN WVT Y+R+E+FPG
Sbjct  612  WVVRNTRTCNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNFWVTTYSRDELFPG  671

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEET++VLWY+FG+THVPRLEDWPVMPVERIGFML P
Sbjct  672  GEFPNQNPRVGEGLATWVKQNRSLEETNVVLWYIFGITHVPRLEDWPVMPVERIGFMLTP  731

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP++ + D K+N +     +KP   GL AKL
Sbjct  732  HGFFNCSPAVDVPPNACEMDSKDNDIKDNGSSKPIQSGLTAKL  774



>ref|XP_010533488.1| PREDICTED: copper amine oxidase 1-like [Tarenaya hassleriana]
Length=787

 Score =   251 bits (640),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 139/164 (85%), Gaps = 5/164 (3%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W+++NTRTVNRTGQLTGYKLV GSNCLPLA  EAKFLRRA FLKHNLWVTPY  NEMFPG
Sbjct  624  WVVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRATFLKHNLWVTPYDPNEMFPG  683

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WVKQNR LEE+DIVLWYVFG+THVPRLEDWPVMPVE IGF LMP
Sbjct  684  GEFPNQNPRVGEGLATWVKQNRSLEESDIVLWYVFGITHVPRLEDWPVMPVEHIGFTLMP  743

Query  394  HGFFNCspavdv-----ppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDV        + D D K+N + +KP   GL+AKL
Sbjct  744  HGFFNCSPAVDVPPNPCEFETKDNDVKDNAISSKPIQSGLLAKL  787



>gb|KHG07734.1| Primary amine oxidase [Gossypium arboreum]
Length=777

 Score =   250 bits (639),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 144/163 (88%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNR+GQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVT  A NEMFPG
Sbjct  615  WIVRNTRTVNRSGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTQCAPNEMFPG  674

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVKQ+R LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  675  GEFPNQNPRAGEGLATWVKQDRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  734

Query  394  HGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP++ + D K+N     V+ K    GL++KL
Sbjct  735  HGFFNCSPAVDVPPNACELDTKDNDIKENVVPKSMQNGLMSKL  777



>ref|XP_004155025.1| PREDICTED: copper methylamine oxidase-like [Cucumis sativus]
 gb|KGN63544.1| hypothetical protein Csa_1G004100 [Cucumis sativus]
Length=791

 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 147/163 (90%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTG+KL+ GSNCLPLAG+EAKFLRRA+FLKHNLWVT Y+R+EMFPG
Sbjct  629  WIVRNTRTVNRTGQLTGFKLLPGSNCLPLAGSEAKFLRRASFLKHNLWVTQYSRDEMFPG  688

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGL++WVK++RPLEETDIVLWYVFG+THVPRLEDWPVMPV+RIGF L+P
Sbjct  689  GEFPNQNPRVGEGLSTWVKKDRPLEETDIVLWYVFGITHVPRLEDWPVMPVDRIGFTLLP  748

Query  394  HGFFNCspavdvppssadpdPKE----NGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ + D K+      V+TKP    ++AKL
Sbjct  749  HGFFNCSPAVDVPPSTCELDSKDADPKENVVTKPIQTPIIAKL  791



>gb|KEH35029.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=704

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 145/163 (89%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRT NRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHN+WVT Y+R+EMFPG
Sbjct  542  WIVRNTRTGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNVWVTAYSRDEMFPG  601

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+W+KQNR LEET+IVLWYVFG+THVPRLEDWPVMPVE IGFMLMP
Sbjct  602  GEFPNQNPRVGEGLATWIKQNRSLEETNIVLWYVFGITHVPRLEDWPVMPVEHIGFMLMP  661

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+S + + K++ +     +KP   G+ +KL
Sbjct  662  HGFFNCSPAVDVPPNSCEVESKDSDIKDNGASKPIQGGIASKL  704



>ref|XP_004501882.1| PREDICTED: copper methylamine oxidase-like [Cicer arietinum]
Length=767

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 144/163 (88%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRT NRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHN+WVT Y+R+EMFPG
Sbjct  605  WIVRNTRTGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNVWVTAYSRDEMFPG  664

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+W+KQ+R LEET+IVLWYVFG+THVPRLEDWPVMPVE IGFMLMP
Sbjct  665  GEFPNQNPRVGEGLATWIKQDRSLEETNIVLWYVFGITHVPRLEDWPVMPVEHIGFMLMP  724

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPSS + + K+N +      KP   GL +KL
Sbjct  725  HGFFNCSPAVDVPPSSCEAESKDNDIKDNGAPKPIPSGLASKL  767



>ref|XP_003601196.1| Primary amine oxidase [Medicago truncatula]
Length=674

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 145/163 (89%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRT NRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHN+WVT Y+R+EMFPG
Sbjct  512  WIVRNTRTGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNVWVTAYSRDEMFPG  571

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+W+KQNR LEET+IVLWYVFG+THVPRLEDWPVMPVE IGFMLMP
Sbjct  572  GEFPNQNPRVGEGLATWIKQNRSLEETNIVLWYVFGITHVPRLEDWPVMPVEHIGFMLMP  631

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+S + + K++ +     +KP   G+ +KL
Sbjct  632  HGFFNCSPAVDVPPNSCEVESKDSDIKDNGASKPIQGGIASKL  674



>ref|XP_003601195.1| Primary amine oxidase [Medicago truncatula]
 gb|AES71446.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=769

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 145/163 (89%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRT NRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHN+WVT Y+R+EMFPG
Sbjct  607  WIVRNTRTGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNVWVTAYSRDEMFPG  666

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+W+KQNR LEET+IVLWYVFG+THVPRLEDWPVMPVE IGFMLMP
Sbjct  667  GEFPNQNPRVGEGLATWIKQNRSLEETNIVLWYVFGITHVPRLEDWPVMPVEHIGFMLMP  726

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+S + + K++ +     +KP   G+ +KL
Sbjct  727  HGFFNCSPAVDVPPNSCEVESKDSDIKDNGASKPIQGGIASKL  769



>ref|XP_004138093.1| PREDICTED: copper methylamine oxidase-like [Cucumis sativus]
Length=794

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 148/166 (89%), Gaps = 7/166 (4%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTG+KL+ GSNCLPLAG+EAKFLRRA+FLKHNLWVT Y+R+EMFPG
Sbjct  629  WIVRNTRTVNRTGQLTGFKLLPGSNCLPLAGSEAKFLRRASFLKHNLWVTQYSRDEMFPG  688

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGL++WVK++RPLEETDIVLWYVFG+THVPRLEDWPVMPV+RIGF L+P
Sbjct  689  GEFPNQNPRVGEGLSTWVKKDRPLEETDIVLWYVFGITHVPRLEDWPVMPVDRIGFTLLP  748

Query  394  HGFFNCspavdvppssadpdPKEN-------GVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ + D K++        V+TKP    ++AKL
Sbjct  749  HGFFNCSPAVDVPPSTCELDSKDSKDADPKENVVTKPIQTPIIAKL  794



>gb|KJB19706.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
 gb|KJB19707.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
Length=791

 Score =   249 bits (635),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 144/163 (88%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNR+GQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVT  A NEMFPG
Sbjct  629  WIVRNTRTVNRSGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTQCAPNEMFPG  688

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVK++R LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  689  GEFPNQNPRAGEGLATWVKRDRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  748

Query  394  HGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP++ + D K+N     V+ K    GL++KL
Sbjct  749  HGFFNCSPAVDVPPNACELDTKDNDIKENVVAKSIQNGLMSKL  791



>ref|XP_007138024.1| hypothetical protein PHAVU_009G174800g [Phaseolus vulgaris]
 gb|ESW10018.1| hypothetical protein PHAVU_009G174800g [Phaseolus vulgaris]
Length=770

 Score =   246 bits (628),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 141/163 (87%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRT NRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHN WVT Y+RNEMFPG
Sbjct  608  WIVRNTRTCNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNFWVTTYSRNEMFPG  667

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR  EGLA+WVKQNR LEET+IVLWYVFG+THVPRLEDWPVMPVE IGFML P
Sbjct  668  GEFPNQNPRDREGLATWVKQNRSLEETNIVLWYVFGITHVPRLEDWPVMPVEHIGFMLTP  727

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP++ + D K+N +     +KP   GL AKL
Sbjct  728  HGFFNCSPAVDVPPNACEMDSKDNEIKDNGSSKPIQNGLTAKL  770



>ref|XP_004289862.2| PREDICTED: copper amine oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=740

 Score =   245 bits (626),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 141/159 (89%), Gaps = 4/159 (3%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVT Y+ +EMFPG
Sbjct  586  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTQYSPDEMFPG  645

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLA+WV++NR LEETDIVLWYVFG+THVPRLEDWPVMPVE IGF L+P
Sbjct  646  GEFPNQNPRVGEGLATWVQKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVEHIGFKLVP  705

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPS+ +   KE+ V       GL+AKL
Sbjct  706  HGFFNCSPAVDVPPSACESKAKEDDVKDN----GLMAKL  740



>gb|ACN27241.1| unknown [Zea mays]
Length=246

 Score =   232 bits (591),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQ TGY+LV GSNCLPLA  EAKFLRRA FLKHNLWVT Y R EMFPG
Sbjct  89   WIVRNTRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKRGEMFPG  148

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+ EGL +WVK +RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE IGFMLMP
Sbjct  149  GEFPNQNPRIHEGLPTWVKNDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVEHIGFMLMP  208

Query  394  HGFFNC  377
            HGFFNC
Sbjct  209  HGFFNC  214



>ref|XP_011071936.1| PREDICTED: copper amine oxidase 1-like [Sesamum indicum]
Length=786

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 139/164 (85%), Gaps = 5/164 (3%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNR+GQLTGYKLV GSNCLPLAG EAKFLRRAAFLKHNLWVT YAR E FPG
Sbjct  623  WIIRNTRTVNRSGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQYARGEDFPG  682

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGL SWVKQNRPLEE DIVLWYVFG+THVPRLEDWPVMPVE IGF+L P
Sbjct  683  GEFPNQNPRAGEGLVSWVKQNRPLEENDIVLWYVFGITHVPRLEDWPVMPVEHIGFVLQP  742

Query  394  HGFFNCspavdvppssadpdPKENGV----ITKP-CHPGLVAKL  278
            HGFFNCSPAVDVPP+  + D KE+ V    + KP     L+AKL
Sbjct  743  HGFFNCSPAVDVPPNVCEIDAKESDVKDSSVAKPTSSAALIAKL  786



>ref|XP_006411505.1| hypothetical protein EUTSA_v100163161mg, partial [Eutrema salsugineum]
 gb|ESQ52958.1| hypothetical protein EUTSA_v100163161mg, partial [Eutrema salsugineum]
Length=329

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPG
Sbjct  166  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPG  225

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMP
Sbjct  226  GEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMP  285

Query  394  HGFFNC  377
            HGFFNC
Sbjct  286  HGFFNC  291



>ref|XP_010678856.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=745

 Score =   243 bits (620),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG++AKFLRRAAFLKHNLWVT YA +EMFPG
Sbjct  585  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSDAKFLRRAAFLKHNLWVTEYACDEMFPG  644

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVK+NRPL E+D+VLWYVFG+THVPRLEDWPVMPVE IGFMLMP
Sbjct  645  GEFPNQNPRAGEGLATWVKKNRPLYESDVVLWYVFGLTHVPRLEDWPVMPVEHIGFMLMP  704

Query  394  HGFFNC  377
            HGFFNC
Sbjct  705  HGFFNC  710



>gb|EYU22171.1| hypothetical protein MIMGU_mgv1a001639mg [Erythranthe guttata]
Length=781

 Score =   243 bits (621),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNR+G+LTGYKLV GSNCLPLAG EAKFLRRAAFLKHNLWVT YA  E FPG
Sbjct  616  WIIRNTRTVNRSGELTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPG  675

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGL SWVKQNRPLEETD+VLWYVFG+THVPRLEDWPVMPVE IGF+L P
Sbjct  676  GEFPNQNPRVGEGLVSWVKQNRPLEETDVVLWYVFGITHVPRLEDWPVMPVEHIGFVLQP  735

Query  394  HGFFNCspavdvppssadpdPKENGV  317
            HGFFNCSPAVDVPPS+ + + KEN V
Sbjct  736  HGFFNCSPAVDVPPSACELEAKENDV  761



>gb|KHN18421.1| Copper methylamine oxidase [Glycine soja]
Length=711

 Score =   242 bits (618),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR  NRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFL+HNLWVTPY+ ++MFPG
Sbjct  547  WIVRNTRIGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLRHNLWVTPYSHDQMFPG  606

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRV +GLA+WVKQNR LEETDIVLWYVFG+T VPRLEDWPVMPVERIGFMLMP
Sbjct  607  GEFPNQNPRVSQGLATWVKQNRSLEETDIVLWYVFGITQVPRLEDWPVMPVERIGFMLMP  666

Query  394  HGFFNC  377
            HGFFNC
Sbjct  667  HGFFNC  672



>gb|KJB19705.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
Length=795

 Score =   243 bits (620),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 144/167 (86%), Gaps = 8/167 (5%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNR+GQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVT  A NEMFPG
Sbjct  629  WIVRNTRTVNRSGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTQCAPNEMFPG  688

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVL----WYVFGVTHVPRLEDWPVMPVERIGF  407
            GEFPNQNPR GEGLA+WVK++R LEETDIVL    WYVFG+THVPRLEDWPVMPVERIGF
Sbjct  689  GEFPNQNPRAGEGLATWVKRDRSLEETDIVLWLLNWYVFGITHVPRLEDWPVMPVERIGF  748

Query  406  MLMPHGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  278
            MLMPHGFFNCSPAVDVPP++ + D K+N     V+ K    GL++KL
Sbjct  749  MLMPHGFFNCSPAVDVPPNACELDTKDNDIKENVVAKSIQNGLMSKL  795



>ref|XP_003550715.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Glycine max]
Length=751

 Score =   242 bits (618),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR  NRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFL+HNLWVTPY+ ++MFPG
Sbjct  587  WIVRNTRIGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLRHNLWVTPYSHDQMFPG  646

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRV +GLA+WVKQNR LEETDIVLWYVFG+T VPRLEDWPVMPVERIGFMLMP
Sbjct  647  GEFPNQNPRVSQGLATWVKQNRSLEETDIVLWYVFGITQVPRLEDWPVMPVERIGFMLMP  706

Query  394  HGFFNC  377
            HGFFNC
Sbjct  707  HGFFNC  712



>dbj|BAD95322.1| putative copper amine oxidase [Arabidopsis thaliana]
Length=502

 Score =   235 bits (600),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 138/163 (85%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPG
Sbjct  340  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPG  399

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGF LMP
Sbjct  400  GEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFTLMP  459

Query  394  HGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+  + + KE+     V  K    GL++KL
Sbjct  460  HGFFNCSPAVDVPPNPCELETKESEVKEVVAPKALQTGLLSKL  502



>ref|NP_001169559.1| uncharacterized protein LOC100383438 [Zea mays]
 gb|ACN34121.1| unknown [Zea mays]
Length=352

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQ TGY+LV GSNCLPLA  EAKFLRRA FLKHNLWVT Y R EMFPG
Sbjct  195  WIVRNTRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKRGEMFPG  254

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+ EGL +WVK +RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE IGFMLMP
Sbjct  255  GEFPNQNPRIHEGLPTWVKNDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVEHIGFMLMP  314

Query  394  HGFFNC  377
            HGFFNC
Sbjct  315  HGFFNC  320



>ref|XP_010322539.1| PREDICTED: copper amine oxidase 1-like [Solanum lycopersicum]
Length=774

 Score =   240 bits (613),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 135/165 (82%), Gaps = 7/165 (4%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRT NRTGQLTGYKLV G NCLPLAG EAKFLRRAAFLKHNLWVT YA  E FPG
Sbjct  611  WIVRNTRTSNRTGQLTGYKLVPGQNCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPG  670

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLASWVK++R LEE+DIVLWYVFG+THVPRLEDWPVMPVE IGFML P
Sbjct  671  GEFPNQNPRVGEGLASWVKEDRSLEESDIVLWYVFGITHVPRLEDWPVMPVEHIGFMLQP  730

Query  394  HGFFNCspavdv------ppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDV         S D D  ENG  +KP   GL AKL
Sbjct  731  HGFFNCSPAVDVPPPRGCDSESKDSDASENGE-SKPTTTGLTAKL  774



>ref|XP_006351050.1| PREDICTED: copper amine oxidase 1-like [Solanum tuberosum]
Length=786

 Score =   240 bits (613),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 134/165 (81%), Gaps = 6/165 (4%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV G NCLPLAG EAKFLRRAAFLKHNLWVT YA  E FPG
Sbjct  622  WIVRNTRTVNRTGQLTGYKLVPGPNCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPG  681

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLASWVKQ+RPLEE+D VLWY+FG+THVPRLEDWPVMPVE IGFML P
Sbjct  682  GEFPNQNPRAGEGLASWVKQDRPLEESDTVLWYIFGITHVPRLEDWPVMPVEHIGFMLQP  741

Query  394  HGFFNCspavdv------ppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDV         S D +  +N  + K    GL+AKL
Sbjct  742  HGFFNCSPAVDVPPPSGCDSESRDSEVTDNSSVAKHTTTGLMAKL  786



>ref|XP_009606421.1| PREDICTED: copper amine oxidase 1-like [Nicotiana tomentosiformis]
Length=786

 Score =   240 bits (613),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV G NCLPLAG EAKFLRRAAFLKHNLWVT YA  E FPG
Sbjct  623  WIVRNTRTVNRTGQLTGYKLVPGPNCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEEFPG  682

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLASWVKQ+RPLEE+DIVLWY+FG+THVPRLEDWPVMPVE IGF+L P
Sbjct  683  GEFPNQNPRVGEGLASWVKQDRPLEESDIVLWYIFGITHVPRLEDWPVMPVEHIGFVLQP  742

Query  394  HGFFNC  377
            HGFFNC
Sbjct  743  HGFFNC  748



>ref|XP_002881856.1| hypothetical protein ARALYDRAFT_903619 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58115.1| hypothetical protein ARALYDRAFT_903619 [Arabidopsis lyrata subsp. 
lyrata]
Length=775

 Score =   240 bits (612),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 139/163 (85%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPG
Sbjct  613  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPG  672

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGF LMP
Sbjct  673  GEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFTLMP  732

Query  394  HGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+  + + K++     V  KP   GL++KL
Sbjct  733  HGFFNCSPAVDVPPNPCELETKDSEVKEVVAPKPLQTGLLSKL  775



>ref|XP_009618867.1| PREDICTED: copper amine oxidase 1-like isoform X3 [Nicotiana 
tomentosiformis]
Length=702

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 134/165 (81%), Gaps = 7/165 (4%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRT NRTGQLTGYKLV G +CLPLAG EAKFLRRAAFLKHNLWVT YA  E FPG
Sbjct  539  WIVRNTRTSNRTGQLTGYKLVPGPSCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPG  598

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLASWVKQ+R LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGFML P
Sbjct  599  GEFPNQNPRVGEGLASWVKQDRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFMLQP  658

Query  394  HGFFNCspavdv------ppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDV           D D  ENGV  KP    L+AKL
Sbjct  659  HGFFNCSPAVDVPPPRGCDLEIKDSDGSENGV-AKPTPSSLMAKL  702



>gb|ABR16250.1| unknown [Picea sitchensis]
Length=788

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV G+NCLPLAG+EAKFLRRAAFL+HNLWVT Y ++E +PG
Sbjct  632  WIVRNTRTVNRTGQLTGYKLVPGANCLPLAGSEAKFLRRAAFLQHNLWVTQYHKDEQYPG  691

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGL +WVKQNR LEE D+VLWYVFG+THVPRLEDWPVMPVERIGFML P
Sbjct  692  GEFPNQNPRVGEGLHTWVKQNRNLEEADVVLWYVFGITHVPRLEDWPVMPVERIGFMLSP  751

Query  394  HGFFNC  377
            HGFFNC
Sbjct  752  HGFFNC  757



>ref|XP_009403621.1| PREDICTED: copper amine oxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=775

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQ TGYKL+ G NCLPLAG EAKFLRRAAFLKHNLWVTPY+R+EM+PG
Sbjct  619  WIVRNTRTVNRTGQPTGYKLMPGLNCLPLAGPEAKFLRRAAFLKHNLWVTPYSRDEMYPG  678

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+ EGL +WVK+NR LEE DIVLWYVFG+TH+PRLEDWPVMPV+RIGFMLMP
Sbjct  679  GEFPNQNPRINEGLVTWVKKNRSLEEADIVLWYVFGITHIPRLEDWPVMPVDRIGFMLMP  738

Query  394  HGFFNC  377
            HGFFNC
Sbjct  739  HGFFNC  744



>ref|XP_010678857.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=698

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -3

Query  748  IKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGE  569
            ++NTRTVNRTGQLTGYKLV GSNCLPLAG++AKFLRRAAFLKHNLWVT YA +EMFPGGE
Sbjct  540  VRNTRTVNRTGQLTGYKLVPGSNCLPLAGSDAKFLRRAAFLKHNLWVTEYACDEMFPGGE  599

Query  568  FPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHG  389
            FPNQNPR GEGLA+WVK+NRPL E+D+VLWYVFG+THVPRLEDWPVMPVE IGFMLMPHG
Sbjct  600  FPNQNPRAGEGLATWVKKNRPLYESDVVLWYVFGLTHVPRLEDWPVMPVEHIGFMLMPHG  659

Query  388  FFNC  377
            FFNC
Sbjct  660  FFNC  663



>ref|XP_009778427.1| PREDICTED: copper amine oxidase 1-like [Nicotiana sylvestris]
 gb|ABI93948.1| methylputrescine oxidase [Nicotiana tabacum]
 dbj|BAF49519.1| N-methylputrescine oxidase [Nicotiana tabacum]
Length=790

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV G NCLPLAG EAKFLRRAAFLKHNLWVT YA  E FPG
Sbjct  627  WIVRNTRTVNRTGQLTGYKLVPGPNCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPG  686

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLASWVKQ+RPLEE+DIVLWY+FG+THVPRLEDWPVMPVE IGF+L P
Sbjct  687  GEFPNQNPRVGEGLASWVKQDRPLEESDIVLWYIFGITHVPRLEDWPVMPVEHIGFVLQP  746

Query  394  HGFFNC  377
            HG+FNC
Sbjct  747  HGYFNC  752



>gb|AAD23730.1| putative copper amine oxidase [Arabidopsis thaliana]
 gb|AAM15387.1| putative copper amine oxidase [Arabidopsis thaliana]
Length=759

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 138/163 (85%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPG
Sbjct  597  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPG  656

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGF LMP
Sbjct  657  GEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFTLMP  716

Query  394  HGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+  + + KE+     V  K    GL++KL
Sbjct  717  HGFFNCSPAVDVPPNPCELETKESEVKEVVAPKALQTGLLSKL  759



>emb|CAN76391.1| hypothetical protein VITISV_023592 [Vitis vinifera]
Length=790

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 119/125 (95%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EMFPG
Sbjct  601  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMFPG  660

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFML-M  398
            GEFPNQNPRVGEGLA+WVKQNRPLEETDIVLWYVFG+ HVPRLEDWPVMPVERIGFML +
Sbjct  661  GEFPNQNPRVGEGLATWVKQNRPLEETDIVLWYVFGLVHVPRLEDWPVMPVERIGFMLQI  720

Query  397  PHGFF  383
             H  F
Sbjct  721  LHNLF  725



>ref|NP_181777.2| copper amine oxidase family protein [Arabidopsis thaliana]
 gb|AAM53275.1| putative copper amine oxidase [Arabidopsis thaliana]
 gb|AAN15348.1| putative copper amine oxidase [Arabidopsis thaliana]
 gb|AEC10126.1| copper amine oxidase family protein [Arabidopsis thaliana]
Length=776

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 138/163 (85%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPG
Sbjct  614  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPG  673

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGF LMP
Sbjct  674  GEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFTLMP  733

Query  394  HGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+  + + KE+     V  K    GL++KL
Sbjct  734  HGFFNCSPAVDVPPNPCELETKESEVKEVVAPKALQTGLLSKL  776



>ref|XP_006347431.1| PREDICTED: copper amine oxidase 1-like [Solanum tuberosum]
Length=769

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 135/165 (82%), Gaps = 7/165 (4%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRT NRTGQLTGYKLV G NCLPLAG EAKFLRRAAFLKHNLWVT +A  E FPG
Sbjct  606  WIVRNTRTSNRTGQLTGYKLVPGQNCLPLAGPEAKFLRRAAFLKHNLWVTQFAPGEDFPG  665

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLASWVK++R LEE+DIVLWYVFG+THVPRLEDWPVMPVE IGFML P
Sbjct  666  GEFPNQNPRVGEGLASWVKEDRSLEESDIVLWYVFGITHVPRLEDWPVMPVEHIGFMLQP  725

Query  394  HGFFNCspavdv------ppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPA+DV         S D D  ENG  +KP   GL AKL
Sbjct  726  HGFFNCSPAIDVPPPRGCDLESKDSDASENGE-SKPTTTGLTAKL  769



>ref|XP_010517774.1| PREDICTED: copper amine oxidase 1-like [Camelina sativa]
Length=781

 Score =   238 bits (606),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 138/163 (85%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPG
Sbjct  619  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPG  678

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMP
Sbjct  679  GEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMP  738

Query  394  HGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  278
            HGFFNCSPA+DVPP+  + D K++     V  KP   GL++KL
Sbjct  739  HGFFNCSPAIDVPPNPCELDTKDSEVKEVVAPKPLQTGLLSKL  781



>ref|XP_004244763.1| PREDICTED: copper amine oxidase 1-like [Solanum lycopersicum]
Length=788

 Score =   238 bits (606),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV G NCLPLAG EAKF+RRAAFLKHNLWVT YA  E FPG
Sbjct  624  WIVRNTRTVNRTGQLTGYKLVPGPNCLPLAGPEAKFMRRAAFLKHNLWVTQYAPGEDFPG  683

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLASWVKQ+RPLEE+D VLWY+FG+THVPRLEDWPVMPVE IGFML P
Sbjct  684  GEFPNQNPRAGEGLASWVKQDRPLEESDTVLWYIFGITHVPRLEDWPVMPVEHIGFMLQP  743

Query  394  HGFFNC  377
            HGFFNC
Sbjct  744  HGFFNC  749



>dbj|BAF49520.1| N-methylputrescine oxidase [Nicotiana tabacum]
Length=766

 Score =   237 bits (604),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 134/165 (81%), Gaps = 7/165 (4%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRT NRTGQLTGYKLV G +CLPLAG EAKFLRRAAFLKHNLWVT YA  E FPG
Sbjct  603  WIVRNTRTSNRTGQLTGYKLVPGPSCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPG  662

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLASWVKQ+R LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGFML P
Sbjct  663  GEFPNQNPRVGEGLASWVKQDRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFMLQP  722

Query  394  HGFFNCspavdv------ppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDV           D D  ENGV  KP    L+AKL
Sbjct  723  HGFFNCSPAVDVPPPRGCDLEIKDSDGSENGV-AKPTPSSLMAKL  766



>ref|XP_009618862.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618864.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618865.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=766

 Score =   237 bits (604),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 134/165 (81%), Gaps = 7/165 (4%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRT NRTGQLTGYKLV G +CLPLAG EAKFLRRAAFLKHNLWVT YA  E FPG
Sbjct  603  WIVRNTRTSNRTGQLTGYKLVPGPSCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPG  662

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLASWVKQ+R LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGFML P
Sbjct  663  GEFPNQNPRVGEGLASWVKQDRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFMLQP  722

Query  394  HGFFNCspavdv------ppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDV           D D  ENGV  KP    L+AKL
Sbjct  723  HGFFNCSPAVDVPPPRGCDLEIKDSDGSENGV-AKPTPSSLMAKL  766



>ref|XP_002448036.1| hypothetical protein SORBIDRAFT_06g020020 [Sorghum bicolor]
 gb|EES12364.1| hypothetical protein SORBIDRAFT_06g020020 [Sorghum bicolor]
Length=782

 Score =   237 bits (605),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQ TGY+LV GSNCLPLA  EAKFLRRA FLKHNLWVT Y R+EMFPG
Sbjct  625  WIVRNTRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKRDEMFPG  684

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+ EGL +WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE IGFMLMP
Sbjct  685  GEFPNQNPRIHEGLPTWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVEHIGFMLMP  744

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPPSS+D D KE     K    GLV+KL
Sbjct  745  HGFFNCSPAVDVPPSSSDADVKE-AESPKAIQNGLVSKL  782



>ref|XP_010506075.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Camelina sativa]
 ref|XP_010506076.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Camelina sativa]
Length=779

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 138/163 (85%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLA  EAKFLRRAAFLKHNLWVT Y+ +E FPG
Sbjct  617  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYSPDEKFPG  676

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMP
Sbjct  677  GEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMP  736

Query  394  HGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  278
            HGFFNCSPA+DVPP+  + D K++     V  KP   GL++KL
Sbjct  737  HGFFNCSPAIDVPPNPCELDTKDSEVKEVVAPKPLQTGLLSKL  779



>ref|NP_001053078.1| Os04g0476100 [Oryza sativa Japonica Group]
 dbj|BAF14992.1| Os04g0476100, partial [Oryza sativa Japonica Group]
Length=518

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQ TGY+LV GSNCLPLA  EAKFLRRA FLKHNLWVT Y  +E+FPG
Sbjct  361  WIVRNTRAVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKSDEVFPG  420

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  421  GEFPNQNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMP  480

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP S+D D KE     K    GL++KL
Sbjct  481  HGFFNCSPAVDVPPGSSDADIKE-AESPKAIQNGLISKL  518



>ref|XP_009133538.1| PREDICTED: copper amine oxidase 1-like [Brassica rapa]
Length=757

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 136/164 (83%), Gaps = 5/164 (3%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPG
Sbjct  594  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPG  653

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMP
Sbjct  654  GEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMP  713

Query  394  HGFFNCspavdvppssadpdPKENG-----VITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+ A     ++      V  KP   GL++KL
Sbjct  714  HGFFNCSPAVDVPPNPACELDTKDSEVKEVVAPKPLQSGLLSKL  757



>ref|XP_009773282.1| PREDICTED: copper amine oxidase 1-like [Nicotiana sylvestris]
 ref|XP_009773283.1| PREDICTED: copper amine oxidase 1-like [Nicotiana sylvestris]
Length=774

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 134/165 (81%), Gaps = 7/165 (4%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRT NRTGQLTGYKLV G NCLPLAG +AKFLRRAAFLKHNLWVT YA  E FPG
Sbjct  611  WIVRNTRTSNRTGQLTGYKLVPGPNCLPLAGPKAKFLRRAAFLKHNLWVTKYAPGEDFPG  670

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGLASWVKQ+R LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGFML P
Sbjct  671  GEFPNQNPRVGEGLASWVKQDRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFMLQP  730

Query  394  HGFFNCspavdv------ppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDV           D D  ENGV  KP    L+AKL
Sbjct  731  HGFFNCSPAVDVPPPRGCDMEIKDSDGSENGV-AKPTPSNLMAKL  774



>gb|KFK37100.1| hypothetical protein AALP_AA4G213000 [Arabis alpina]
Length=767

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 136/164 (83%), Gaps = 5/164 (3%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPG
Sbjct  604  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPG  663

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMP
Sbjct  664  GEFPNQNPRSGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMP  723

Query  394  HGFFNCspavdvppssadpdPKENG-----VITKPCHPGLVAKL  278
            HGFFNCSPA+DVPP+ A     ++      V  KP   GL++KL
Sbjct  724  HGFFNCSPAIDVPPNPACELETKDSEVKEVVTPKPIQAGLLSKL  767



>ref|XP_006293724.1| hypothetical protein CARUB_v10022684mg [Capsella rubella]
 gb|EOA26622.1| hypothetical protein CARUB_v10022684mg [Capsella rubella]
Length=771

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 137/163 (84%), Gaps = 4/163 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLA  EAKFLRRAAFLKHNLWVT YA  E FPG
Sbjct  609  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPEEKFPG  668

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGL++WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMP
Sbjct  669  GEFPNQNPRAGEGLSTWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMP  728

Query  394  HGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP+  + D K++     V  KP   GL++KL
Sbjct  729  HGFFNCSPAVDVPPNPCELDTKDSEVKEVVAPKPIQTGLLSKL  771



>ref|XP_009379966.1| PREDICTED: copper amine oxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=771

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 130/159 (82%), Gaps = 2/159 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQ  GYKL+ GSNCLPLAG EAKFLRRAAFLKHNLWVT Y  +EM+PG
Sbjct  615  WIVRNTRTVNRTGQPAGYKLMPGSNCLPLAGPEAKFLRRAAFLKHNLWVTSYKHDEMYPG  674

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+ EGLA+WV++NR LEETDIVLWYVFG+TH+PRLEDWPVMPVE IGF+LMP
Sbjct  675  GEFPNQNPRINEGLATWVRKNRSLEETDIVLWYVFGITHIPRLEDWPVMPVEHIGFLLMP  734

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNC       P S +   KE G   K  H GLVAKL
Sbjct  735  HGFFNC-SPAVDVPPSPNEADKECGA-PKLMHNGLVAKL  771



>dbj|BAJ87935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=527

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQ TG++LV GSNCLP A  EAKFLRRA FLKHNLWVTPY  +E FPG
Sbjct  368  WIVRNTRAVNRTGQPTGFRLVPGSNCLPFALPEAKFLRRAGFLKHNLWVTPYKSDEKFPG  427

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+ EGLA+WVKQ+RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  428  GEFPNQNPRLHEGLATWVKQDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMP  487

Query  394  HGFFNC  377
            HGFFNC
Sbjct  488  HGFFNC  493



>ref|XP_010508564.1| PREDICTED: copper amine oxidase 1-like [Camelina sativa]
Length=781

 Score =   236 bits (601),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPG
Sbjct  619  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPG  678

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMP
Sbjct  679  GEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMP  738

Query  394  HGFFNC  377
            HGFFNC
Sbjct  739  HGFFNC  744



>ref|XP_003581353.1| PREDICTED: copper amine oxidase 1-like [Brachypodium distachyon]
Length=771

 Score =   235 bits (600),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQ TGY+LV GSNCLPLA  EAKFLRRA FLKHNLWVTPY  +E FPG
Sbjct  613  WIVRNTRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTPYNSDEKFPG  672

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  673  GEFPNQNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMP  732

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
             GFFNCSPAVDVPP S+D D KE        + GLV+KL
Sbjct  733  DGFFNCSPAVDVPPGSSDVDAKEAESPKAIQNGGLVSKL  771



>emb|CAE05498.2| OSJNBa0022H21.18 [Oryza sativa Japonica Group]
Length=699

 Score =   234 bits (596),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQ TGY+LV GSNCLPLA  EAKFLRRA FLKHNLWVT Y  +E+FPG
Sbjct  542  WIVRNTRAVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKSDEVFPG  601

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  602  GEFPNQNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMP  661

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP S+D D KE     K    GL++KL
Sbjct  662  HGFFNCSPAVDVPPGSSDADIKE-AESPKAIQNGLISKL  699



>ref|XP_001774529.1| predicted protein [Physcomitrella patens]
 gb|EDQ60597.1| predicted protein [Physcomitrella patens]
Length=705

 Score =   234 bits (596),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRT NRTGQLTGYKLV GSNCLPLAG +AKFLRRAAFLKHNLWVT Y  +E FPG
Sbjct  545  WIVRNTRTFNRTGQLTGYKLVPGSNCLPLAGPDAKFLRRAAFLKHNLWVTQYNPDECFPG  604

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGL +WVKQ+R LEETDIVLWYVFGVTH+PRLEDWPVMPVE IGF LMP
Sbjct  605  GEFPNQNPRVGEGLPTWVKQDRKLEETDIVLWYVFGVTHIPRLEDWPVMPVEHIGFSLMP  664

Query  394  HGFFNC  377
            HGFFNC
Sbjct  665  HGFFNC  670



>emb|CAH67316.1| OSIGBa0106G07.12 [Oryza sativa Indica Group]
Length=699

 Score =   233 bits (594),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQ TGY+LV GSNCLPLA  EAKFLRRA FLKHNLWVT Y  +E+FPG
Sbjct  542  WIVRNTRAVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKSDEVFPG  601

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  602  GEFPNQNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMP  661

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP S+D D KE     K    GL++KL
Sbjct  662  HGFFNCSPAVDVPPGSSDADIKE-AESPKVIQNGLISKL  699



>emb|CDY35376.1| BnaA03g19840D [Brassica napus]
Length=1065

 Score =   236 bits (602),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPG
Sbjct  594  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPG  653

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMP
Sbjct  654  GEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMP  713

Query  394  HGFFNC  377
            HGFFNC
Sbjct  714  HGFFNC  719



>ref|XP_006652410.1| PREDICTED: copper amine oxidase 1-like [Oryza brachyantha]
Length=699

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQ TGY+LV GSNCLPLA  +AKFLRRA FLKHNLWVT Y  +E+FPG
Sbjct  542  WIVRNTRAVNRTGQPTGYRLVPGSNCLPLALPDAKFLRRAGFLKHNLWVTQYRSDEVFPG  601

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  602  GEFPNQNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMP  661

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP S+D D KE     K    GL++KL
Sbjct  662  HGFFNCSPAVDVPPGSSDADIKE-AESPKAIQNGLISKL  699



>gb|EAZ31082.1| hypothetical protein OsJ_15179 [Oryza sativa Japonica Group]
Length=838

 Score =   234 bits (597),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQ TGY+LV GSNCLPLA  EAKFLRRA FLKHNLWVT Y  +E+FPG
Sbjct  681  WIVRNTRAVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKSDEVFPG  740

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  741  GEFPNQNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMP  800

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP S+D D KE     K    GL++KL
Sbjct  801  HGFFNCSPAVDVPPGSSDADIKE-AESPKAIQNGLISKL  838



>gb|EAY94528.1| hypothetical protein OsI_16305 [Oryza sativa Indica Group]
Length=787

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQ TGY+LV GSNCLPLA  EAKFLRRA FLKHNLWVT Y  +E+FPG
Sbjct  630  WIVRNTRAVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKSDEVFPG  689

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  690  GEFPNQNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMP  749

Query  394  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  278
            HGFFNCSPAVDVPP S+D D KE     K    GL++KL
Sbjct  750  HGFFNCSPAVDVPPGSSDADIKE-AESPKVIQNGLISKL  787



>ref|XP_008668433.1| PREDICTED: uncharacterized protein LOC100383438 isoform X1 [Zea 
mays]
 tpg|DAA37327.1| TPA: hypothetical protein ZEAMMB73_085776 [Zea mays]
 tpg|DAA37328.1| TPA: hypothetical protein ZEAMMB73_085776 [Zea mays]
Length=780

 Score =   233 bits (594),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQ TGY+LV GSNCLPLA  EAKFLRRA FLKHNLWVT Y R EMFPG
Sbjct  623  WIVRNTRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKRGEMFPG  682

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+ EGL +WVK +RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE IGFMLMP
Sbjct  683  GEFPNQNPRIHEGLPTWVKNDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVEHIGFMLMP  742

Query  394  HGFFNC  377
            HGFFNC
Sbjct  743  HGFFNC  748



>ref|XP_009404245.1| PREDICTED: copper amine oxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=767

 Score =   233 bits (593),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQ  GYKL+ G NCLPLAG EAKF RRAAFLKHNLWVT Y  +EM+PG
Sbjct  611  WIVRNTRTVNRTGQPAGYKLMPGPNCLPLAGPEAKFFRRAAFLKHNLWVTSYKHDEMYPG  670

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+ EGLA+WVK+NR LEET+IVLWYVFGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  671  GEFPNQNPRINEGLATWVKKNRSLEETNIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMP  730

Query  394  HGFFNC  377
            HGFFNC
Sbjct  731  HGFFNC  736



>emb|CDY47975.1| BnaA04g24530D [Brassica napus]
Length=775

 Score =   232 bits (592),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLA  EAKFLRRAAFLKHNLWVT Y   E FPG
Sbjct  614  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYDPEEKFPG  673

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMP
Sbjct  674  GEFPNQNPRSGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMP  733

Query  394  HGFFNC  377
            HGFFNC
Sbjct  734  HGFFNC  739



>ref|XP_004975956.1| PREDICTED: copper amine oxidase 1-like [Setaria italica]
Length=781

 Score =   232 bits (592),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQ TGY+LV GSNCLPLA  EAKFLRRA FLKHNLWVT Y  +EMFPG
Sbjct  623  WIVRNTRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKSDEMFPG  682

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+ EGL +WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE IGFMLMP
Sbjct  683  GEFPNQNPRIHEGLPTWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVEHIGFMLMP  742

Query  394  HGFFNC  377
            HGFFNC
Sbjct  743  HGFFNC  748



>ref|XP_009142070.1| PREDICTED: LOW QUALITY PROTEIN: copper amine oxidase 1 [Brassica 
rapa]
Length=778

 Score =   232 bits (592),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLA  EAKFLRRAAFLKHNLWVT Y   E FPG
Sbjct  617  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYDPEEKFPG  676

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMP
Sbjct  677  GEFPNQNPRSGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMP  736

Query  394  HGFFNC  377
            HGFFNC
Sbjct  737  HGFFNC  742



>gb|EMS63127.1| Primary amine oxidase [Triticum urartu]
Length=735

 Score =   231 bits (590),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQ TG++LV GSNCLP A  EAKFLRRA FLKHNLWVTPY  +E FPG
Sbjct  576  WIVRNTRAVNRTGQPTGFRLVPGSNCLPFALPEAKFLRRAGFLKHNLWVTPYKSDEKFPG  635

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  636  GEFPNQNPRLHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMP  695

Query  394  HGFFNC  377
            HGFFNC
Sbjct  696  HGFFNC  701



>ref|XP_001753509.1| predicted protein [Physcomitrella patens]
 gb|EDQ81732.1| predicted protein [Physcomitrella patens]
Length=668

 Score =   230 bits (587),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRT NRTG LTGYKLV GSNCLPLAG +AKFLRRAAFLKHNLWVT Y  +E+FPG
Sbjct  505  WIVRNTRTFNRTGHLTGYKLVPGSNCLPLAGPDAKFLRRAAFLKHNLWVTQYYPDEIFPG  564

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGL +WVKQ+R LEETDIVLWYVFGVTH+PRLEDWPVMPVE IGF L+P
Sbjct  565  GEFPNQNPRVGEGLPTWVKQDRKLEETDIVLWYVFGVTHIPRLEDWPVMPVEHIGFSLVP  624

Query  394  HGFFNC  377
            HGFFNC
Sbjct  625  HGFFNC  630



>emb|CDY14839.1| BnaC04g48360D [Brassica napus]
Length=775

 Score =   232 bits (591),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLA  EAKFLRRAAFLKHNLWVT Y   E FPG
Sbjct  614  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYDPEEKFPG  673

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMP
Sbjct  674  GEFPNQNPRSGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMP  733

Query  394  HGFFNC  377
            HGFFNC
Sbjct  734  HGFFNC  739



>emb|CDY22564.1| BnaC03g23740D [Brassica napus]
Length=1075

 Score =   233 bits (594),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 116/128 (91%), Gaps = 2/128 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPG
Sbjct  594  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPG  653

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLW--YVFGVTHVPRLEDWPVMPVERIGFML  401
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLW  YVFG+THVPRLEDWPVMPVE IGF L
Sbjct  654  GEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVYVFGITHVPRLEDWPVMPVEHIGFTL  713

Query  400  MPHGFFNC  377
            MPHGFFNC
Sbjct  714  MPHGFFNC  721



>gb|KEH27747.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=714

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGY+LV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPY  NEM PG
Sbjct  579  WIVRNTRTVNRTGQLTGYRLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYVHNEMHPG  638

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  398
            GEFPNQNPRVG+GLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGFMLM
Sbjct  639  GEFPNQNPRVGDGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFMLM  697



>ref|XP_001757203.1| predicted protein [Physcomitrella patens]
 gb|EDQ78062.1| predicted protein [Physcomitrella patens]
Length=715

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRT NRTGQLTGYKL+ G NCLPLAG +AKFLRRAAFL HNLWVT Y R+E FPG
Sbjct  550  WIVRNTRTFNRTGQLTGYKLMPGRNCLPLAGPDAKFLRRAAFLNHNLWVTEYKRDECFPG  609

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPRVGEGL +WVKQ+R LEETD+VLWYVFGVTHVPRLEDWPVMPVE +GF L+P
Sbjct  610  GEFPNQNPRVGEGLPTWVKQDRKLEETDVVLWYVFGVTHVPRLEDWPVMPVEHVGFKLLP  669

Query  394  HGFFNC  377
            HGFFNC
Sbjct  670  HGFFNC  675



>gb|KJB50256.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=751

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQLTG+KLV GSNCLPLAG+EAKFLRRA FLKHNLWVTPY+R EM PG
Sbjct  631  WIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPYSREEMHPG  690

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  398
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM
Sbjct  691  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  749



>gb|KJB50255.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=757

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQLTG+KLV GSNCLPLAG+EAKFLRRA FLKHNLWVTPY+R EM PG
Sbjct  631  WIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPYSREEMHPG  690

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  398
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM
Sbjct  691  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  749



>gb|KJB50257.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=775

 Score =   229 bits (585),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQLTG+KLV GSNCLPLAG+EAKFLRRA FLKHNLWVTPY+R EM PG
Sbjct  631  WIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPYSREEMHPG  690

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  398
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM
Sbjct  691  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  749



>ref|XP_007155469.1| hypothetical protein PHAVU_003G204000g [Phaseolus vulgaris]
 gb|ESW27463.1| hypothetical protein PHAVU_003G204000g [Phaseolus vulgaris]
Length=1289

 Score =   232 bits (592),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR  NR+G+LTGYKLV GSNCLPLAG+EA FLRRA FL+HNLW+TPY+ ++MFPG
Sbjct  571  WIVRNTRRGNRSGELTGYKLVPGSNCLPLAGSEAMFLRRAGFLRHNLWITPYSHHQMFPG  630

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+ +GL +WVKQNR LEET IVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  631  GEFPNQNPRLNQGLPTWVKQNRSLEETAIVLWYVFGMTHIPRLEDWPVMPVERIGFMLMP  690

Query  394  HGFFNC  377
            HGFFNC
Sbjct  691  HGFFNC  696



>ref|XP_001759255.1| predicted protein [Physcomitrella patens]
 gb|EDQ75939.1| predicted protein [Physcomitrella patens]
Length=715

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRT NRTGQLTGYKL+ G NCLPLAG +AKFLRRAAFL HNLWVT Y  +E FPG
Sbjct  550  WIVRNTRTFNRTGQLTGYKLMPGRNCLPLAGPDAKFLRRAAFLNHNLWVTEYKHDECFPG  609

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+GEGL +WVKQ+R LEETDIVLWYVFGVTHVPRLEDWPVMPVE +GF L+P
Sbjct  610  GEFPNQNPRIGEGLPTWVKQDRKLEETDIVLWYVFGVTHVPRLEDWPVMPVEHVGFNLLP  669

Query  394  HGFFNC  377
            HGFFNC
Sbjct  670  HGFFNC  675



>gb|EMT09520.1| Copper methylamine oxidase [Aegilops tauschii]
Length=808

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQ TGYKL+ GSNCLP    EAKFLRRA FLKHNLWVT Y  +E+FPG
Sbjct  652  WIVRNTRTVNRTGQPTGYKLIPGSNCLPFCLPEAKFLRRAGFLKHNLWVTSYKSDEIFPG  711

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+ EGLA+WVK++R LEET+IVLWYVFG+TH+PRLEDWPVMPVER GFMLMP
Sbjct  712  GEFPNQNPRIHEGLATWVKKDRSLEETNIVLWYVFGITHIPRLEDWPVMPVERSGFMLMP  771

Query  394  HGFFNC  377
            HGFFNC
Sbjct  772  HGFFNC  777



>emb|CAE02362.2| OSJNBb0016B03.15 [Oryza sativa Japonica Group]
Length=792

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQ TGYKL+ GSNCLPLA  EAKFLRRA FLKHNLWVT Y  +EM+PG
Sbjct  646  WIVRNTRTVNRTGQPTGYKLIPGSNCLPLALPEAKFLRRAGFLKHNLWVTSYKNDEMYPG  705

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+ EGLA+WVKQ+R LEET+IVLWYVFGVTHVPRLEDWPVMPVE IGFML P
Sbjct  706  GEFPNQNPRINEGLATWVKQDRSLEETNIVLWYVFGVTHVPRLEDWPVMPVEHIGFMLKP  765

Query  394  HGFFNC  377
             GFF+C
Sbjct  766  DGFFDC  771



>ref|XP_006600617.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Glycine max]
Length=722

 Score =   223 bits (569),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR  NRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFL+HNLWVTPY+ ++MFPG
Sbjct  587  WIVRNTRIGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLRHNLWVTPYSHDQMFPG  646

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  398
            GEFPNQNPRV +GLA+WVKQNR LEETDIVLWYVFG+T VPRLEDWPVMPVERIGFMLM
Sbjct  647  GEFPNQNPRVSQGLATWVKQNRSLEETDIVLWYVFGITQVPRLEDWPVMPVERIGFMLM  705



>gb|EMS61925.1| Copper methylamine oxidase [Triticum urartu]
Length=760

 Score =   223 bits (569),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQ TGYKL+ GSNCLP    EAKFLRRA FLKHNLWVT Y  +E+FPG
Sbjct  604  WIVRNTRTVNRTGQPTGYKLIPGSNCLPFCLPEAKFLRRAGFLKHNLWVTSYKSDEIFPG  663

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQNPR+ EGLA+WVK++R LEET+IVLWYVFG+TH+PRLEDWPVMPVER GF++MP
Sbjct  664  GEFPNQNPRIHEGLATWVKKDRSLEETNIVLWYVFGITHIPRLEDWPVMPVERSGFIIMP  723

Query  394  HGFFNC  377
            HGFFNC
Sbjct  724  HGFFNC  729



>ref|NP_001173054.1| Os02g0593150 [Oryza sativa Japonica Group]
 dbj|BAH91783.1| Os02g0593150 [Oryza sativa Japonica Group]
Length=311

 Score =   209 bits (531),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQ TGYKLV GS+CLPLA  EAKFLRRA FLKHNLWVT +  +EMFPG
Sbjct  26   WIVRNTRTVNRTGQPTGYKLVPGSSCLPLALPEAKFLRRAGFLKHNLWVTSFKNDEMFPG  85

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  398
            GEFPNQNPR+ EGLA+WVK++R LEET++VLWYVFG+TH+PRLEDWPVMPVERI FMLM
Sbjct  86   GEFPNQNPRINEGLATWVKKDRSLEETNLVLWYVFGITHIPRLEDWPVMPVERISFMLM  144



>ref|XP_009618866.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=723

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRT NRTGQLTGYKLV G +CLPLAG EAKFLRRAAFLKHNLWVT YA  E FPG
Sbjct  603  WIVRNTRTSNRTGQLTGYKLVPGPSCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPG  662

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  398
            GEFPNQNPRVGEGLASWVKQ+R LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGFML 
Sbjct  663  GEFPNQNPRVGEGLASWVKQDRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFMLQ  721



>gb|EEC76708.1| hypothetical protein OsI_14715 [Oryza sativa Indica Group]
Length=729

 Score =   212 bits (539),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQ TGYKL+ GSNCLPLA  EAKFLRRA FLKHNLWVT Y  +EM+PG
Sbjct  556  WIVRNTRTVNRTGQPTGYKLIPGSNCLPLALPEAKFLRRAGFLKHNLWVTSYKNDEMYPG  615

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFML  401
            GEFPNQNPR+ EGLA+WVKQ+R LEET+IVLWYVFGVTHVPRLEDWPVMPVE IGFML
Sbjct  616  GEFPNQNPRINEGLATWVKQDRSLEETNIVLWYVFGVTHVPRLEDWPVMPVEHIGFML  673



>gb|EAZ29581.1| hypothetical protein OsJ_13655 [Oryza sativa Japonica Group]
Length=819

 Score =   212 bits (539),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQ TGYKL+ GSNCLPLA  EAKFLRRA FLKHNLWVT Y  +EM+PG
Sbjct  646  WIVRNTRTVNRTGQPTGYKLIPGSNCLPLALPEAKFLRRAGFLKHNLWVTSYKNDEMYPG  705

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFML  401
            GEFPNQNPR+ EGLA+WVKQ+R LEET+IVLWYVFGVTHVPRLEDWPVMPVE IGFML
Sbjct  706  GEFPNQNPRINEGLATWVKQDRSLEETNIVLWYVFGVTHVPRLEDWPVMPVEHIGFML  763



>ref|XP_002985875.1| hypothetical protein SELMODRAFT_123165 [Selaginella moellendorffii]
 gb|EFJ13052.1| hypothetical protein SELMODRAFT_123165 [Selaginella moellendorffii]
Length=710

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NT+ VNR G  TGYKLV G+NCL   G +A  LRRA FLKHNLWVT Y+++E++P 
Sbjct  572  WIVRNTKVVNRAGGNTGYKLVPGANCLGFIGKDAMILRRAEFLKHNLWVTSYSKDELYPA  631

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFP QNPR+GEGL +WVK++R LE  DIVLWYVFGVTH+PRLEDWPVMPVERIGF L P
Sbjct  632  GEFPKQNPRIGEGLPTWVKKDRDLENADIVLWYVFGVTHIPRLEDWPVMPVERIGFTLTP  691

Query  394  HGFFNC  377
            HGFF+C
Sbjct  692  HGFFDC  697



>ref|XP_002984811.1| hypothetical protein SELMODRAFT_121227 [Selaginella moellendorffii]
 gb|EFJ14061.1| hypothetical protein SELMODRAFT_121227 [Selaginella moellendorffii]
Length=710

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NT+ VNR G  TGYKLV G+NCL   G +A  LRRA FLKHNLWVT Y+++E++P 
Sbjct  572  WIVRNTKVVNRAGGNTGYKLVPGANCLGFIGKDAMILRRAEFLKHNLWVTSYSKDELYPA  631

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFP QNPR+GEGL +WVK++R LE  DIVLWYVFGVTH+PRLEDWPVMPVERIGF L P
Sbjct  632  GEFPKQNPRIGEGLPTWVKKDRDLENADIVLWYVFGVTHIPRLEDWPVMPVERIGFTLTP  691

Query  394  HGFFNC  377
            HGFF+C
Sbjct  692  HGFFDC  697



>gb|EEE57286.1| hypothetical protein OsJ_07344 [Oryza sativa Japonica Group]
Length=681

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  748  IKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGE  569
            ++NTRTVNRTGQ TGYKLV GS+CLPLA  EAKFLRRA FLKHNLWVT +  +EMFPGGE
Sbjct  398  VRNTRTVNRTGQPTGYKLVPGSSCLPLALPEAKFLRRAGFLKHNLWVTSFKNDEMFPGGE  457

Query  568  FPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  398
            FPNQNPR+ EGLA+WVK++R LEET++VLWYVFG+TH+PRLEDWPVMPVERI FMLM
Sbjct  458  FPNQNPRINEGLATWVKKDRSLEETNLVLWYVFGITHIPRLEDWPVMPVERISFMLM  514



>ref|XP_002979456.1| hypothetical protein SELMODRAFT_153358 [Selaginella moellendorffii]
 gb|EFJ19345.1| hypothetical protein SELMODRAFT_153358 [Selaginella moellendorffii]
Length=668

 Score =   200 bits (509),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR+ NR GQLTGYKLV GSNCLPL G  A  LRRA FL HNLWVT Y+ +E +PG
Sbjct  506  WIVRNTRSFNRMGQLTGYKLVPGSNCLPLVGENAMMLRRAKFLHHNLWVTSYSPDERYPG  565

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G+FPNQNPRVGEGL +W K+++ LE+ DIVLWY FGV HVPRLEDWPVMPVE +GF L P
Sbjct  566  GDFPNQNPRVGEGLPTWTKRDKNLEQADIVLWYTFGVIHVPRLEDWPVMPVEHLGFSLAP  625

Query  394  HGFFNC  377
             GFFNC
Sbjct  626  VGFFNC  631



>ref|XP_002462763.1| hypothetical protein SORBIDRAFT_02g031550 [Sorghum bicolor]
 gb|EER99284.1| hypothetical protein SORBIDRAFT_02g031550 [Sorghum bicolor]
Length=651

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRT +LTGYKL+ GSNC P+A  EAKFLRRA FLKHNLWVTPY  +EMFPG
Sbjct  514  WIVRNTRTVNRTRKLTGYKLMPGSNCKPMALPEAKFLRRAGFLKHNLWVTPYKSDEMFPG  573

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G+FPNQNP + EGL +WVK++R LEETDIVLWYVFG+TH+PRLEDWPVMPV+R+   ++P
Sbjct  574  GDFPNQNPHIDEGLPTWVKKDRSLEETDIVLWYVFGLTHIPRLEDWPVMPVDRMDSSIVP  633



>ref|XP_002977869.1| hypothetical protein SELMODRAFT_443642 [Selaginella moellendorffii]
 gb|EFJ21207.1| hypothetical protein SELMODRAFT_443642 [Selaginella moellendorffii]
Length=797

 Score =   190 bits (483),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 103/145 (71%), Gaps = 19/145 (13%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR+ NR GQLTGYKLV GSNCLPL G  A  LRRA FL HNLWVT Y+ +E +PG
Sbjct  616  WIVRNTRSFNRMGQLTGYKLVPGSNCLPLVGENAMMLRRAKFLHHNLWVTSYSPDERYPG  675

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLW-------------------YVFGVTHVP  452
            G+FPNQNPRVGEGL +W K+++ LE+ DIVLW                   Y FGV HVP
Sbjct  676  GDFPNQNPRVGEGLPTWTKRDKNLEQADIVLWSVAHFGLIRSFMVFSWISRYTFGVIHVP  735

Query  451  RLEDWPVMPVERIGFMLMPHGFFNC  377
            RLEDWPVMPVE +GF L P GFFNC
Sbjct  736  RLEDWPVMPVEHLGFSLAPVGFFNC  760



>ref|XP_007211293.1| hypothetical protein PRUPE_ppa002116mg [Prunus persica]
 gb|EMJ12492.1| hypothetical protein PRUPE_ppa002116mg [Prunus persica]
Length=714

 Score =   181 bits (460),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA++EMFPG
Sbjct  621  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAQDEMFPG  680

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYV  473
            GEFPNQNPRVGEGLA+WVK+NR LEETDIVLW V
Sbjct  681  GEFPNQNPRVGEGLATWVKKNRSLEETDIVLWSV  714



>gb|KDO82259.1| hypothetical protein CISIN_1g004080mg [Citrus sinensis]
Length=716

 Score =   178 bits (452),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII+NTRTVNRTGQLTGYKLV GSNCLPLAG+EAK LRRAAFLKHNLWVTPYA +EM+PG
Sbjct  617  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKVLRRAAFLKHNLWVTPYAHDEMYPG  676

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYV  473
            GEFPNQNPRVGEGLA+WV+QNR LEETDIVLW V
Sbjct  677  GEFPNQNPRVGEGLATWVEQNRSLEETDIVLWLV  710



>ref|XP_007044779.1| Copper amine oxidase family protein isoform 3 [Theobroma cacao]
 gb|EOY00611.1| Copper amine oxidase family protein isoform 3 [Theobroma cacao]
Length=754

 Score =   176 bits (445),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTR VNRTGQLTG+KLV GSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR EM+PG
Sbjct  628  WIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAREEMYPG  687

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRL  446
            GEFPNQNPRVGEGLA+WVK+NR LEE DIVL +   +T   RL
Sbjct  688  GEFPNQNPRVGEGLATWVKKNRSLEEADIVLCHTVSLTAHQRL  730



>gb|KDO69507.1| hypothetical protein CISIN_1g004084mg [Citrus sinensis]
Length=735

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG +A   RRAAFLKHNLWVT YAR+EMFPG
Sbjct  613  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPDATVFRRAAFLKHNLWVTAYARDEMFPG  672

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYV  473
            GEFPNQNPR+GEGL +WVKQNRPLEE+DIVLW+V
Sbjct  673  GEFPNQNPRIGEGLPAWVKQNRPLEESDIVLWFV  706



>ref|XP_007036330.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
 gb|EOY20831.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
Length=755

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNRTGQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVT YA +EMFPG
Sbjct  635  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTRYAPDEMFPG  694

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRL  446
            GEFPNQNPR GEGLA+WVKQ+RPLEETDIV ++ +    + RL
Sbjct  695  GEFPNQNPRAGEGLATWVKQDRPLEETDIVCFWNYPCPSIGRL  737


 Score = 57.0 bits (136),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  482  LVCFWSDSCSSAGRLAGNACGAHWFHAHAAWIL  384
            +VCFW+  C S GRLA  A GAHWFHA+AAWIL
Sbjct  723  IVCFWNYPCPSIGRLACYASGAHWFHANAAWIL  755



>gb|KJB19704.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
Length=743

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI++NTRTVNR+GQLTGYKLV GSNCLPLAG+EAKFLRRAAFLKHNLWVT  A NEMFPG
Sbjct  629  WIVRNTRTVNRSGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTQCAPNEMFPG  688

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLW  479
            GEFPNQNPR GEGLA+WVK++R LEETDIVLW
Sbjct  689  GEFPNQNPRAGEGLATWVKRDRSLEETDIVLW  720



>ref|WP_027094208.1| tyramine oxidase [Cohnella thermotolerans]
Length=647

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 87/125 (70%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    N  GQ  GYK+V G NC P A   +  ++RA F++H+LWVTPY  NEM+  
Sbjct  497  WKIVNDNVKNDYGQSVGYKIVTGENCFPFASPNSSLIKRAGFIRHHLWVTPYNENEMYAA  556

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G +PNQ+   G+GL++WV+Q+RP++ TDIV+WY  G THVPR EDWPVMP   IGFML P
Sbjct  557  GNYPNQHIG-GDGLSAWVEQDRPVKNTDIVVWYTMGHTHVPRPEDWPVMPAAYIGFMLKP  615

Query  394  HGFFN  380
             GFFN
Sbjct  616  VGFFN  620



>ref|WP_025696771.1| tyramine oxidase, partial [Paenibacillus durus]
Length=475

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 85/125 (68%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    N  GQ  GYK+V G NC P A   +  L+RA F+KH+LWVTPY  +E++  
Sbjct  325  WKIVNDNVKNELGQSVGYKIVTGENCFPFASKNSSLLKRAGFIKHHLWVTPYNEDEIYAS  384

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++PNQ+   GEGL+SW +Q+RP+  +DIV+WY  G THVPR EDWPVMP   IGFML P
Sbjct  385  GKYPNQHIG-GEGLSSWAEQDRPVANSDIVVWYTMGHTHVPRPEDWPVMPTAYIGFMLKP  443

Query  394  HGFFN  380
              FFN
Sbjct  444  VSFFN  448



>ref|WP_036584415.1| tyramine oxidase [Paenibacillus darwinianus]
 gb|EXX90377.1| tyramine oxidase [Paenibacillus darwinianus]
 gb|EXX91103.1| tyramine oxidase [Paenibacillus darwinianus]
 gb|EXX91955.1| tyramine oxidase [Paenibacillus darwinianus]
Length=647

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W   N    N  GQ  GYK++ G NC P A   +  ++RA F+KH+LWVTPY  NEM+  
Sbjct  497  WKFVNDNVKNDLGQSVGYKIMTGENCFPFASDSSSLIKRAGFIKHHLWVTPYNENEMYAS  556

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++PNQN   G+GL++WV+Q+RP+   DIV+WY  G THVPR EDWPVMP   IGF L P
Sbjct  557  GKYPNQNIG-GDGLSAWVEQDRPVVNKDIVVWYTMGHTHVPRPEDWPVMPAAYIGFTLKP  615

Query  394  HGFFN  380
             GFFN
Sbjct  616  VGFFN  620



>gb|EEC73513.1| hypothetical protein OsI_07883 [Oryza sativa Indica Group]
Length=529

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = -3

Query  748  IKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGE  569
            ++NTRTVNRTGQ TGYKLV GS+CLPLA  EAKFLRRA FLKHNLWVT +  +EMFPGGE
Sbjct  440  VRNTRTVNRTGQPTGYKLVPGSSCLPLALPEAKFLRRAGFLKHNLWVTSFKNDEMFPGGE  499

Query  568  FPNQNPRVGEGLASWVKQNRPLEETDIVLW  479
            FPNQNPR+ EGLA+WVK++R LEET++VLW
Sbjct  500  FPNQNPRINEGLATWVKKDRSLEETNLVLW  529



>ref|WP_008317043.1| Cu2+-containing amine oxidase [Leptolyngbya sp. PCC 6406]
Length=632

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W + N +  NR GQ  G+KL+ G N LP A  EA  ++RA FL  +LWVTPY   E FP 
Sbjct  493  WKVVNPQVTNRLGQPVGFKLIPGENILPFAHPEAPIMKRAGFLNQHLWVTPYQAAENFPA  552

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G +PNQ+P  GEGL  W   +RPLE TD+VLWYVFG  H+PR EDWPVMPV   GF L P
Sbjct  553  GPYPNQHPG-GEGLPQWTVADRPLENTDVVLWYVFGHHHIPRPEDWPVMPVAYSGFTLKP  611

Query  394  HGFFN  380
             GFF+
Sbjct  612  LGFFD  616



>ref|WP_015845121.1| tyramine oxidase [Paenibacillus sp. JDR-2]
 gb|ACT02179.1| Primary-amine oxidase [Paenibacillus sp. JDR-2]
Length=647

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W   N    N  GQ  G+K+V G NC P A   +  ++RA F+KH+LWVTPY  +EM+  
Sbjct  497  WKFVNDNVKNELGQSVGFKIVTGENCFPFALDNSSLIKRAGFIKHHLWVTPYDEDEMYAS  556

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++PNQ+   G+GL++W +++R ++ TD+V+WY  G THVPR EDWPVMP   IGFML P
Sbjct  557  GKYPNQH-LGGDGLSAWAEKDRDIKNTDVVVWYTMGHTHVPRPEDWPVMPAAYIGFMLKP  615

Query  394  HGFFN  380
              FFN
Sbjct  616  VSFFN  620



>ref|WP_017299862.1| tyramine oxidase [Nodosilinea nodulosa]
Length=642

 Score =   141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    N  G  T YKL+ G N LP+A + A   +RA ++  +LWVTPYA  E FP 
Sbjct  501  WKIVNPTETNAMGYPTAYKLMPGENTLPMARSGASVTKRATYMTQHLWVTPYAEEEKFPA  560

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G +PNQ+P  GEGL  W +++RP+  TD+V+WY F  +HVPR EDWPVMPV  IGFML P
Sbjct  561  GNYPNQHPG-GEGLPKWTERDRPIVNTDLVVWYTFAHSHVPRAEDWPVMPVAYIGFMLKP  619

Query  394  HGFFN  380
              FFN
Sbjct  620  LNFFN  624



>ref|WP_007920030.1| tyramine oxidase [Ktedonobacter racemifer]
 gb|EFH82153.1| Primary-amine oxidase [Ktedonobacter racemifer DSM 44963]
Length=649

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W + N    NR G+   YKL+ G N LP    E+  ++RA F+K NLWVTPY   E++P 
Sbjct  506  WKVANPNVQNRLGEPVAYKLMPGDNALPFLHPESSIMKRAGFIKKNLWVTPYHEKELYPA  565

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++PNQ+   GEGL +W + NR LE TD+VLWYV    HV R EDWPVMP   IGFML P
Sbjct  566  GDYPNQHAG-GEGLPAWTQANRSLENTDVVLWYVMNAHHVTRPEDWPVMPTTYIGFMLKP  624

Query  394  HGFFN  380
             GFF+
Sbjct  625  VGFFD  629



>gb|ETX01504.1| hypothetical protein ETSY2_37115, partial [Candidatus Entotheonella 
sp. TSY2]
Length=278

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N  + N+TG    YKL+ G N LP A  ++   +R A++  +LWVTPY+ NE +P 
Sbjct  139  WQITNPSSTNKTGAPVAYKLLPGENTLPFAQPDSSIAKRGAYMWKHLWVTPYSPNERYPA  198

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++PNQ+ + G+GL +W + +R +E TD+V+WYV    H+ RLEDWPVMPV  IGF L P
Sbjct  199  GDYPNQH-QGGDGLPAWTQADRSVENTDLVVWYVMNGNHIARLEDWPVMPVTNIGFKLKP  257

Query  394  HGFFN  380
             GFF+
Sbjct  258  SGFFD  262



>ref|WP_035986372.1| tyramine oxidase [Leptolyngbya sp. KIOST-1]
Length=643

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    N  G  T YKL+ G N LPLA   A  + RA ++  +LWVTPYA +E FP 
Sbjct  502  WKIVNPNETNAAGYPTAYKLMPGENTLPLARPHASVINRATYMTKHLWVTPYAPDEKFPA  561

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++PNQ+P  GEGL  W + +RP++ TD+V+WY F  TH+PR EDWPVMP   IGFML P
Sbjct  562  GDYPNQSPG-GEGLPKWTEGDRPVDNTDLVVWYTFAHTHIPRAEDWPVMPTAYIGFMLKP  620

Query  394  HGFFN  380
              +F+
Sbjct  621  LNYFD  625



>ref|WP_008314860.1| Cu2+-containing amine oxidase [Leptolyngbya sp. PCC 6406]
Length=643

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    N  G  T YKL+ G N LPLA   A  ++RA ++  +LWVTPY+ +E FP 
Sbjct  501  WKIVNPTKTNAMGYPTAYKLMPGENTLPLARPNASVIKRATYMTQHLWVTPYSPDEKFPA  560

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G +PNQ+P  GEGL  W + +RP+E TD+V+W+ F  +H PR EDWPVMPV  IGFML P
Sbjct  561  GNYPNQSPG-GEGLPQWTQADRPVENTDLVVWHTFAHSHSPRAEDWPVMPVSTIGFMLKP  619

Query  394  HGFFN  380
              FF+
Sbjct  620  LNFFD  624



>ref|WP_039728302.1| MULTISPECIES: tyramine oxidase [Oscillatoriophycideae]
 gb|KIF15990.1| tyramine oxidase [Aphanocapsa montana BDHKU210001]
 gb|KIF40915.1| tyramine oxidase [Lyngbya confervoides BDU141951]
Length=638

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W + N    NR GQ  G+KL+ G N LP A  +A  ++RA F+  +LWVTPY  +E FP 
Sbjct  498  WKVVNPNIHNRLGQPVGFKLIPGENVLPFAHPDAPIVKRAGFITRHLWVTPYHPDENFPA  557

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G +PNQ+P  GEGL  W +++R L+ TD+V+WYVFG  H+PR EDWPVMPV   GF L P
Sbjct  558  GPYPNQHPG-GEGLLKWTQRDRALDNTDVVVWYVFGHHHIPRPEDWPVMPVAYSGFTLKP  616

Query  394  HGFFN  380
             GFF+
Sbjct  617  LGFFD  621



>ref|WP_041436864.1| tyramine oxidase [Synechococcus sp. JA-2-3B'a(2-13)]
Length=647

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 78/126 (62%), Gaps = 1/126 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    NR GQ   YKL+ G N   LA  ++   RRA +L H+LW TPY   E FP 
Sbjct  498  WKIVNPNRHNRLGQPVAYKLMPGDNVQLLAHPDSWLYRRAGYLAHHLWATPYHPGEKFPA  557

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++PNQ+P  GEGL  W + NR LE T +VLWY FG  H PR EDWPVMP   IGFML P
Sbjct  558  GDYPNQHPG-GEGLVQWTQANRSLENTRLVLWYSFGCNHFPRTEDWPVMPASYIGFMLKP  616

Query  394  HGFFNC  377
             GFF C
Sbjct  617  LGFFEC  622



>gb|ABD03718.1| putative copper methylamine oxidase [Synechococcus sp. JA-2-3B'a(2-13)]
Length=641

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 78/126 (62%), Gaps = 1/126 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    NR GQ   YKL+ G N   LA  ++   RRA +L H+LW TPY   E FP 
Sbjct  492  WKIVNPNRHNRLGQPVAYKLMPGDNVQLLAHPDSWLYRRAGYLAHHLWATPYHPGEKFPA  551

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++PNQ+P  GEGL  W + NR LE T +VLWY FG  H PR EDWPVMP   IGFML P
Sbjct  552  GDYPNQHPG-GEGLVQWTQANRSLENTRLVLWYSFGCNHFPRTEDWPVMPASYIGFMLKP  610

Query  394  HGFFNC  377
             GFF C
Sbjct  611  LGFFEC  616



>ref|WP_011430198.1| tyramine oxidase [Synechococcus sp. JA-3-3Ab]
 gb|ABC99520.1| copper amine oxidase [Synechococcus sp. JA-3-3Ab]
Length=672

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 78/126 (62%), Gaps = 1/126 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    NR GQ   YKL+ G N   LA  ++   RRA +L H+LW TPY   E FP 
Sbjct  523  WKIVNPNRHNRLGQPVAYKLMPGENVQLLAHPDSWLYRRAGYLAHHLWATPYHPGEKFPA  582

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G +PNQ+P  GEGL  W + NR LE T +VLWY FG  H PR EDWPVMPV  IGFML P
Sbjct  583  GNYPNQHPG-GEGLVQWTQANRSLENTRLVLWYSFGCNHFPRTEDWPVMPVSYIGFMLKP  641

Query  394  HGFFNC  377
             GFF C
Sbjct  642  LGFFEC  647



>ref|WP_015124381.1| Cu2+-containing amine oxidase [Synechococcus sp. PCC 6312]
 gb|AFY60837.1| Cu2+-containing amine oxidase [Synechococcus sp. PCC 6312]
Length=650

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 79/125 (63%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W+I N    N  GQ   YKL+    CLP A  +A  ++RA FL  + W TPY  +E FP 
Sbjct  503  WLITNPNLKNYLGQPVAYKLIPSETCLPFANDQAWVMKRAGFLNTHFWATPYHPDENFPA  562

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G+ PNQ+P  GEGL  W + NRP+E TD+V+WY FG  H+PR EDWP+MP   IGF L P
Sbjct  563  GDHPNQHPG-GEGLQKWTQANRPIENTDVVVWYNFGHHHIPRPEDWPIMPTAYIGFHLKP  621

Query  394  HGFFN  380
             GFF+
Sbjct  622  FGFFD  626



>ref|WP_036002001.1| tyramine oxidase [Leptolyngbya sp. JSC-1]
Length=652

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 85/126 (67%), Gaps = 1/126 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W + N    NR GQ  G+KLV G N LP A  +A  L+RA F+  +LWVTPY+ +E +P 
Sbjct  503  WKVVNPNQHNRLGQPVGFKLVPGENVLPFAHPDAPILKRAGFMTKHLWVTPYSPSERYPT  562

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G +PNQ+P  GEGL  W + NR +E TD+V+WY+FG  H+PR ED+P+MPV   GF+L P
Sbjct  563  GNYPNQHPG-GEGLPQWTQANRSIENTDLVVWYMFGHHHIPRPEDFPIMPVAYAGFLLKP  621

Query  394  HGFFNC  377
             GFF+ 
Sbjct  622  VGFFDA  627



>ref|WP_012627324.1| tyramine oxidase [Cyanothece sp. PCC 7425]
 gb|ACL44238.1| Amine oxidase (copper-containing) [Cyanothece sp. PCC 7425]
Length=641

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W+I N    N  GQ   YKL+ G N LP A  ++  ++RA F+  +LWVTPY   E +P 
Sbjct  498  WVIANPTVNNSLGQPVAYKLIPGENALPFAHPDSAIIKRATFMTKHLWVTPYHPKENYPA  557

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++PNQ+P  G+GL  W   NR ++ TD+V+WY FG  H+PR EDWPVMPV  IGF L P
Sbjct  558  GDYPNQHPG-GDGLPRWTAANRSIDNTDLVVWYNFGHHHIPRPEDWPVMPVAYIGFYLKP  616

Query  394  HGFFN  380
             GFF+
Sbjct  617  SGFFD  621



>ref|WP_015186652.1| Copper amine oxidase domain-containing protein [Gloeocapsa sp. 
PCC 7428]
 gb|AFZ28775.1| Copper amine oxidase domain-containing protein [Gloeocapsa sp. 
PCC 7428]
Length=646

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 81/126 (64%), Gaps = 1/126 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    N  GQ   YKL+ G N LP A  E+  ++RA F+  +LWVTPY  +E++  
Sbjct  505  WKIVNPAVRNSLGQPVSYKLMPGENILPFAHPESSVIKRAGFMTKHLWVTPYDPDELYAA  564

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++PNQ+P    GL +W K NR +E TD+V+WY FG  HV R EDWPVMPV  IGFML P
Sbjct  565  GDYPNQHPG-DAGLPAWTKANREIENTDVVVWYTFGHNHVTRPEDWPVMPVSHIGFMLKP  623

Query  394  HGFFNC  377
             GFF+ 
Sbjct  624  VGFFDA  629



>ref|WP_006456034.1| tyramine oxidase [Synechococcus sp. PCC 7335]
 gb|EDX86269.1| Copper amine oxidase, enzyme domain protein [Synechococcus sp. 
PCC 7335]
Length=646

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    N  G  T YKL+ G N LP+A   A   +RAA++  +LWVTP+  +E +P 
Sbjct  506  WKIVNPSKTNAMGYPTAYKLMPGENTLPMARPSASVSKRAAYMSQHLWVTPFHEDEKYPA  565

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++PNQNP  G GL  W + +R +E+TD+V+WY F  +H PR EDWPVMPV  IGFML P
Sbjct  566  GDYPNQNPG-GAGLPHWTQSDRVVEDTDLVVWYTFAHSHSPRAEDWPVMPVATIGFMLKP  624

Query  394  HGFFN  380
              FF+
Sbjct  625  LNFFD  629



>ref|WP_036531589.1| tyramine oxidase [Neosynechococcus sphagnicola]
 gb|KGF73303.1| tyramine oxidase [Neosynechococcus sphagnicola sy1]
Length=641

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 82/124 (66%), Gaps = 1/124 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N   +NR G+   YKL  G N LP A  +A  L+RA F+  +LWVTPY   E +P 
Sbjct  502  WKIVNPTVLNRLGKPVSYKLQPGENILPFADPQAWILKRAGFMTRHLWVTPYHPQENYPA  561

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++PNQ+P  G GL +W + +R L+ TD+V+WY FG  H+PR EDWPVMPV  IGFML P
Sbjct  562  GDYPNQHPG-GAGLPAWTEADRSLDNTDLVVWYNFGHHHIPRPEDWPVMPVAYIGFMLKP  620

Query  394  HGFF  383
             GFF
Sbjct  621  VGFF  624



>emb|CEG30995.1| Primary amine oxidase precursor [Bacillus simplex]
Length=650

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 78/125 (62%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    NR G+  GYKL  G NC P A  ++  L+RA FLKH+ WVTP+  +E F  
Sbjct  501  WKIVNPSKKNRLGEPVGYKLFAGENCFPFAHDDSPLLKRAGFLKHHFWVTPFDPDEQFAS  560

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G +PNQ+   GEGL  WVK +R +E  D+V+WY  G  H+ R EDWPVMP   I F+L P
Sbjct  561  GRYPNQHAG-GEGLEDWVKADRSIENEDVVVWYNMGHHHITRPEDWPVMPTAYISFILKP  619

Query  394  HGFFN  380
             GFFN
Sbjct  620  TGFFN  624



>ref|WP_012935344.1| tyramine oxidase [Conexibacter woesei]
 gb|ADB52293.1| Primary-amine oxidase [Conexibacter woesei DSM 14684]
Length=643

 Score =   135 bits (341),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W++ N    N  G+   YKLV G N +P A   +  LRRA F++H+LWVT +A  E +P 
Sbjct  499  WLVTNPAVRNAVGEAVAYKLVPGDNTVPFAAPGSALLRRAGFVEHHLWVTRHAAAERYPA  558

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GE+P Q+   GEGL +WV+ +RPL + D+VLWY     HVPR EDWPVMPV RIGF L P
Sbjct  559  GEYPYQH-SGGEGLPAWVQADRPLVDRDVVLWYTMNHHHVPRPEDWPVMPVARIGFELKP  617

Query  394  HGFFN  380
             GFF+
Sbjct  618  WGFFD  622



>ref|WP_041858942.1| hypothetical protein, partial [Candidatus Solibacter usitatus]
Length=616

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 80/124 (65%), Gaps = 1/124 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI+ N    N  G  TGY L+ G N +P A  ++   RRAAFL  ++WVTPY  +EM+ G
Sbjct  483  WIVTNPHERNALGHATGYALLPGENAVPFAQPDSWVRRRAAFLDSHIWVTPYRASEMYAG  542

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++PNQ+ R G+GL  W   NR +   D+VLWY  G+TH PR EDWPVMPV   GF L+P
Sbjct  543  GDYPNQS-RGGDGLRQWTAANRDIHNHDVVLWYTLGITHNPRPEDWPVMPVHAAGFRLVP  601

Query  394  HGFF  383
             GFF
Sbjct  602  WGFF  605



>ref|WP_006520181.1| Cu2+-containing amine oxidase [Leptolyngbya sp. PCC 7375]
 gb|EKU99059.1| Cu2+-containing amine oxidase [Leptolyngbya sp. PCC 7375]
Length=647

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 83/126 (66%), Gaps = 3/126 (2%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    N  G  T YKL+ G N LPLA  +A  +RRA ++  +LWVTPY+ +E +P 
Sbjct  502  WKIVNPAKTNAMGYPTAYKLMPGENTLPLARPDASVIRRATYMTKHLWVTPYSPDEKYPA  561

Query  574  GEFPNQNPRVGE-GLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  398
            G +PNQ+P  G+ GL  W + +R +E+TD+V+WY F  +H PR EDWPVMPV  IGFML 
Sbjct  562  GNYPNQHP--GDVGLPEWTQADRSVEDTDVVVWYTFAHSHSPRAEDWPVMPVATIGFMLK  619

Query  397  PHGFFN  380
            P  FF+
Sbjct  620  PLNFFD  625



>gb|ABJ81915.1| Amine oxidase (copper-containing) [Candidatus Solibacter usitatus 
Ellin6076]
Length=634

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 80/124 (65%), Gaps = 1/124 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI+ N    N  G  TGY L+ G N +P A  ++   RRAAFL  ++WVTPY  +EM+ G
Sbjct  501  WIVTNPHERNALGHATGYALLPGENAVPFAQPDSWVRRRAAFLDSHIWVTPYRASEMYAG  560

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++PNQ+ R G+GL  W   NR +   D+VLWY  G+TH PR EDWPVMPV   GF L+P
Sbjct  561  GDYPNQS-RGGDGLRQWTAANRDIHNHDVVLWYTLGITHNPRPEDWPVMPVHAAGFRLVP  619

Query  394  HGFF  383
             GFF
Sbjct  620  WGFF  623



>ref|WP_040597665.1| tyramine oxidase [Patulibacter medicamentivorans]
Length=641

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W + N    N  GQ  GY+LV G N +P +   +   RRAAF+ H+LWVT +   E +P 
Sbjct  491  WTVVNPDVRNAVGQPVGYRLVTGENTVPFSAPGSSARRRAAFMDHHLWVTRHDPAERYPA  550

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GE+P Q+P  G+GL  WV+ +RPLE  D+V+WY     HVPR EDWPVMPV R+GFML P
Sbjct  551  GEYPYQHPG-GDGLPRWVQADRPLEREDLVVWYTMNHHHVPRPEDWPVMPVARLGFMLKP  609

Query  394  HGFFN  380
             GFF+
Sbjct  610  WGFFD  614



>gb|EHN12772.1| Monoamine oxidase [Patulibacter medicamentivorans]
Length=632

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W + N    N  GQ  GY+LV G N +P +   +   RRAAF+ H+LWVT +   E +P 
Sbjct  482  WTVVNPDVRNAVGQPVGYRLVTGENTVPFSAPGSSARRRAAFMDHHLWVTRHDPAERYPA  541

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GE+P Q+P  G+GL  WV+ +RPLE  D+V+WY     HVPR EDWPVMPV R+GFML P
Sbjct  542  GEYPYQHPG-GDGLPRWVQADRPLEREDLVVWYTMNHHHVPRPEDWPVMPVARLGFMLKP  600

Query  394  HGFFN  380
             GFF+
Sbjct  601  WGFFD  605



>ref|WP_012873420.1| tyramine oxidase [Sphaerobacter thermophilus]
 gb|ACZ40385.1| Primary-amine oxidase [Sphaerobacter thermophilus DSM 20745]
Length=646

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 84/126 (67%), Gaps = 1/126 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N  ++N+ G+   Y+L+   N LP+A   A  ++RA F+  ++WVTPY   E +  
Sbjct  499  WKIVNHNSLNKVGEPVAYRLMPHGNVLPMAHPTASVMQRAGFMTKHVWVTPYRPEEKYAA  558

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++PNQ+P  G GL +W  QNRP+ +TD+V+WY  G  HV RLEDWPVMPV+ +GF+L P
Sbjct  559  GDYPNQHPG-GAGLPAWTAQNRPIVDTDVVVWYTLGSHHVVRLEDWPVMPVQYVGFLLQP  617

Query  394  HGFFNC  377
             GFF+ 
Sbjct  618  FGFFDA  623



>ref|WP_036480875.1| tyramine oxidase [Myxosarcina sp. GI1]
Length=634

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 82/126 (65%), Gaps = 1/126 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N  ++N  GQ  GYKL+ G N LP A  E+  ++RA F+  +LWVTPY  +E++  
Sbjct  493  WKIVNPSSLNSLGQPVGYKLMPGDNILPFAHPESSVIKRAGFMNKHLWVTPYQPDELYGA  552

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++PNQ+P   EGL  W + +R ++ TD+V+WY FG  HV R EDWPVMPV  I F L P
Sbjct  553  GDYPNQHPG-NEGLTKWTQSDRSVDNTDVVVWYTFGQHHVTRPEDWPVMPVAYIDFKLKP  611

Query  394  HGFFNC  377
             GFF+ 
Sbjct  612  IGFFDA  617



>ref|WP_026159538.1| hypothetical protein [actinobacterium SCGC AAA023-J06]
Length=637

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 77/124 (62%), Gaps = 1/124 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    N  G   GYKL+ G    PLA  ++   +RA F+  +LWVTP   +E +P 
Sbjct  495  WKIINPNKKNHVGHSIGYKLIPGHTTYPLAHRDSVLGKRAGFMYSHLWVTPNVESERYPA  554

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++P Q+   G GL  W K NR LE TDIVLW+VFG  H+PR EDWPVMPVER GF L P
Sbjct  555  GDYPFQH-EGGAGLPEWTKNNRSLENTDIVLWHVFGTNHIPRTEDWPVMPVERTGFHLKP  613

Query  394  HGFF  383
             GFF
Sbjct  614  TGFF  617



>ref|WP_029635581.1| hypothetical protein [actinobacterium SCGC AAA041-L13]
Length=629

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 78/124 (63%), Gaps = 1/124 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W + N    N  G   GYKL+ G    PLA  E+   +RA F+  +LWVTP+  +E +P 
Sbjct  487  WKVINPNKKNHVGHSIGYKLIPGHTTYPLAHKESVLGKRAGFMYSHLWVTPHVESERYPA  546

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++P Q+   G GL  W K +R +E TD+VLW+VFG  H+PR EDWPVMPVER GF L P
Sbjct  547  GDYPFQH-EGGAGLPEWTKNDRSIENTDVVLWHVFGTNHIPRTEDWPVMPVERTGFHLKP  605

Query  394  HGFF  383
             GFF
Sbjct  606  TGFF  609



>gb|AIA11119.1| Copper amine oxidase, enzyme domain protein, partial [uncultured 
bacterium]
Length=158

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    N  G+  GYK + G N  P A   A + +RA F+ +++WVTP+  +E +  
Sbjct  8    WKIINPVVKNHVGEPVGYKFLPGDNSFPYASPNAWWRKRAGFVNYHVWVTPFDESEKYAA  67

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++PNQ+   G+GL  W + +RP+ +TD+VLWY FG TH+PR ED+PVMP   IGF+L P
Sbjct  68   GDYPNQS-GGGDGLIRWTEADRPVADTDVVLWYTFGHTHIPRPEDYPVMPAAYIGFLLKP  126

Query  394  HGFFN  380
             GFF+
Sbjct  127  VGFFD  131



>ref|WP_035742293.1| tyramine oxidase, partial [Arthrobacter sp. MA-N2]
Length=280

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 78/125 (62%), Gaps = 0/125 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N  + N   +   Y+L+        AG E+   +RA F ++NLWVT Y R E F  
Sbjct  131  WKIVNHXSRNIVDEPVAYRLIPTDGIQLAAGDESYVSKRAQFARNNLWVTAYDRTERFAA  190

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQ+    +GL  W +++R + + D+V+WY FG+ HV RLEDWPVMP + IGFML P
Sbjct  191  GEFPNQSTGADDGLHIWTEKDRNIVDEDLVVWYTFGMHHVVRLEDWPVMPRQNIGFMLEP  250

Query  394  HGFFN  380
            HGFFN
Sbjct  251  HGFFN  255



>ref|WP_024819190.1| tyramine oxidase [Arthrobacter sp. 31Y]
Length=648

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 78/125 (62%), Gaps = 0/125 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    N   +   Y+L+  +     AG E+   +RA F ++NLWVT Y R E F  
Sbjct  497  WKIANHDKTNLVNEPVAYRLIPTNGIQLAAGDESYVSKRAQFARNNLWVTAYNRTERFAA  556

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GE+PNQ     +GL  W +QNR + +TD+V+WY FG+ HV RLEDWPVMP + IGFML P
Sbjct  557  GEYPNQATGADDGLHIWTEQNRNIVDTDLVIWYTFGMHHVVRLEDWPVMPRQNIGFMLEP  616

Query  394  HGFFN  380
            HGFFN
Sbjct  617  HGFFN  621



>ref|WP_043457655.1| tyramine oxidase [Arthrobacter sp. 31Y]
Length=644

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 78/125 (62%), Gaps = 0/125 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    N   +   Y+L+  +     AG E+   +RA F ++NLWVT Y R E F  
Sbjct  493  WKIANHDKTNLVNEPVAYRLIPTNGIQLAAGDESYVSKRAQFARNNLWVTAYNRTERFAA  552

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GE+PNQ     +GL  W +QNR + +TD+V+WY FG+ HV RLEDWPVMP + IGFML P
Sbjct  553  GEYPNQATGADDGLHIWTEQNRNIVDTDLVIWYTFGMHHVVRLEDWPVMPRQNIGFMLEP  612

Query  394  HGFFN  380
            HGFFN
Sbjct  613  HGFFN  617



>ref|WP_034315126.1| tyramine oxidase [Bacillus simplex]
Length=650

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 76/125 (61%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    N  G+  GYKL  G NC P A  ++  L+RA FLKH+ WVTP+   E F  
Sbjct  501  WKIVNPSKKNILGEPVGYKLFAGENCFPFAHDDSPLLKRAGFLKHHFWVTPFDPEEQFAS  560

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G +PNQ+   GEGL  WVK +R +E  D+V+WY  G  H+ R EDWPVMP   I F+L P
Sbjct  561  GRYPNQHAG-GEGLEDWVKADRSIENEDVVVWYNMGHHHITRPEDWPVMPTAYISFILKP  619

Query  394  HGFFN  380
             GFFN
Sbjct  620  TGFFN  624



>ref|WP_028930454.1| tyramine oxidase [Pseudonocardia asaccharolytica]
Length=644

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 78/125 (62%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    N  G+  GY L    N +PL   EA  +RRA F+ H+LWVTP+A  E    
Sbjct  505  WKIVNPHERNAVGEPPGYALKPRDNVVPLVQPEASVMRRAGFMAHHLWVTPHAERERHAA  564

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GE+PNQ+ + GEGL  W   +RP+ +TD+V+WY FG  HV RLEDWPVMP +  GF L P
Sbjct  565  GEYPNQH-QGGEGLLRWTAADRPVADTDLVVWYTFGSHHVARLEDWPVMPAQYAGFSLQP  623

Query  394  HGFFN  380
             GFF+
Sbjct  624  TGFFD  628



>ref|WP_035741463.1| tyramine oxidase, partial [Arthrobacter sp. MA-N2]
Length=345

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 78/125 (62%), Gaps = 0/125 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N  + N   +   Y+L+        AG E+   +RA F ++NLWVT Y R E F  
Sbjct  196  WKIVNHESRNIVDEPVAYRLIPTDGIQLAAGDESYVSKRAQFARNNLWVTAYDRTERFAA  255

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQ+    +GL  W +++R + + D+V+WY FG+ HV RLEDWPVMP + IGFML P
Sbjct  256  GEFPNQSTGADDGLHIWTEKDRNIVDEDLVVWYTFGMHHVVRLEDWPVMPRQNIGFMLEP  315

Query  394  HGFFN  380
            HGFFN
Sbjct  316  HGFFN  320



>ref|WP_009633550.1| Cu2+-containing amine oxidase [Synechocystis sp. PCC 7509]
Length=645

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 79/126 (63%), Gaps = 1/126 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W + N    N  GQ   YK++ G N LP    E+  ++RA +L  +LWVTPY + E +P 
Sbjct  505  WKVVNPDVHNSLGQPVAYKIMPGENILPFLHPESFVIKRAGYLNKHLWVTPYNKAENYPA  564

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G +PNQ+   G+GL  W K +R +E TD+V+WY FG  H+PR EDWPVMP   IGFML P
Sbjct  565  GAYPNQHAG-GDGLPEWTKADRHIENTDVVVWYTFGHNHIPRPEDWPVMPTSYIGFMLKP  623

Query  394  HGFFNC  377
             GFF+ 
Sbjct  624  VGFFDA  629



>ref|WP_042206338.1| tyramine oxidase [Paenibacillus durus]
 gb|AIQ12487.1| tyramine oxidase [Paenibacillus durus]
Length=648

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 77/125 (62%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    N  G   GYKL  G N  P A   +  ++RA FLKH+LW TPY   E +  
Sbjct  495  WKIVNPAKKNPVGDPVGYKLFPGENAFPFASDNSSLIKRAGFLKHHLWCTPYNPKEKYAS  554

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++PNQ+   G GL+SWV+Q+R L+ TD+V+WY  G  HV R EDWPVMP   IGF L P
Sbjct  555  GDYPNQHAG-GAGLSSWVQQDRSLDNTDVVVWYTMGHHHVTRPEDWPVMPTAYIGFSLKP  613

Query  394  HGFFN  380
             GFF+
Sbjct  614  VGFFD  618



>ref|WP_029018078.1| hypothetical protein [actinobacterium SCGC AAA028-N15]
Length=632

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 77/124 (62%), Gaps = 1/124 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W + N    N      GYKL+ G    PLA  E+   ++AAF+  +LWVT    +E +P 
Sbjct  494  WKVVNQEVKNHMDHPVGYKLIPGHTTFPLALPESTIGKKAAFMYKHLWVTKNNESEKYPA  553

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++P Q+P  G GL  W K NR +E+ D+VLWYVFG  H+PR EDWPVMPVER GF L P
Sbjct  554  GDYPFQHPG-GAGLPEWTKANRNIEDEDVVLWYVFGTNHIPRTEDWPVMPVERTGFHLKP  612

Query  394  HGFF  383
             GFF
Sbjct  613  SGFF  616



>ref|WP_019310622.1| tyramine oxidase [Kocuria rhizophila]
 gb|KIC69986.1| histamine oxidase [Kocuria rhizophila]
Length=644

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 80/125 (64%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W++ +T   NR G   GYKL        LA  ++   RRAAF    LWVTPY  +E +P 
Sbjct  493  WVVSSTEHTNRLGHPVGYKLHPEGLPTMLASEDSSIHRRAAFATKALWVTPYEESERYPT  552

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G+FPNQ+   G GL  W  Q+R ++ TDIV+W+ FG+TH PR+EDWP+MPV+ +GF L P
Sbjct  553  GDFPNQHAGNG-GLPEWTAQDRSVDGTDIVVWHTFGLTHFPRVEDWPIMPVDTVGFKLRP  611

Query  394  HGFFN  380
             GFF+
Sbjct  612  EGFFD  616



>ref|WP_037709969.1| tyramine oxidase [Streptomyces mirabilis]
Length=666

 Score =   130 bits (327),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I+N + ++  G+  GY L+ G N +P+   EA F  RA F   +LWVT Y   E +  
Sbjct  519  WRIENPQKLSGLGEPVGYTLMPGGNTVPMYPPEALFAPRAGFTASHLWVTAYDPAERYAA  578

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++PNQ+P  GEGL ++   +RPLE+TD+V+WY FG  HV R EDWPVMPV  IGFML P
Sbjct  579  GDYPNQHPG-GEGLPAYAAADRPLEDTDVVVWYTFGAHHVVRPEDWPVMPVSTIGFMLKP  637

Query  394  HGFFN  380
             GFF+
Sbjct  638  SGFFD  642



>ref|WP_043709977.1| tyramine oxidase, partial [Leifsonia aquatica]
Length=635

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 79/124 (64%), Gaps = 1/124 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I NT   NR GQ TGY L    N   +A   A+   RAAF    +WVT YA +E +P 
Sbjct  504  WHIVNTEKTNRLGQPTGYVLHAEQNPTLMADPSARVTARAAFTTKQVWVTQYASDERYPA  563

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEF NQNP  G+GL +++  +R L+  DIVLW+ FG TH PR+EDWPVMPV+R  F L P
Sbjct  564  GEFVNQNPG-GDGLPAYMAADRSLDGEDIVLWHTFGPTHFPRVEDWPVMPVDRARFTLKP  622

Query  394  HGFF  383
            +GFF
Sbjct  623  YGFF  626



>ref|WP_020471082.1| hypothetical protein [Zavarzinella formosa]
Length=631

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 80/124 (65%), Gaps = 1/124 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    N  G+  GYK + G N  PLA   A + +RA F+ +++WV+PY   E F  
Sbjct  489  WKIVNPNVKNHVGEPAGYKFLPGDNSFPLASPNAWWRKRARFVDYHVWVSPYDETENFAA  548

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++PNQ+   G+GL  +  Q+RP+E TD+V WY FG TH+PR ED+PVMP   IGF+L P
Sbjct  549  GDYPNQSSG-GDGLLKYTDQDRPIENTDVVFWYTFGHTHIPRPEDYPVMPTAYIGFLLKP  607

Query  394  HGFF  383
            +GFF
Sbjct  608  NGFF  611



>ref|WP_036725089.1| tyramine oxidase [Paenibacillus forsythiae]
Length=648

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 75/125 (60%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    N  G    YKL  G N  P A   +  ++RA FLKH+LW TPY   E +  
Sbjct  495  WKIVNPNKKNHVGDPVSYKLFPGENAFPFASDNSSLIKRAGFLKHHLWCTPYNPEEKYAS  554

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G +PNQ+   G GL+SWV+Q+R L+ TD+V+WY  G  HV R EDWPVMP   IGF L P
Sbjct  555  GSYPNQHAG-GAGLSSWVQQDRSLDNTDVVVWYTMGHHHVTRPEDWPVMPTAYIGFSLKP  613

Query  394  HGFFN  380
             GFF+
Sbjct  614  VGFFD  618



>ref|WP_018685630.1| hypothetical protein [Actinokineospora enzanensis]
Length=649

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WI+++  +VNR G+   Y+L+       +A  EA    RAAF   +LWVT +   +++P 
Sbjct  500  WIVRSGDSVNRLGKPRAYQLMPHVGPTLMAQPEATVSARAAFATKHLWVTKHDDEQLYPA  559

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G FPNQ+P  G GL  W K +R +E+ DIVLW+VFG THVPR EDWPVMPV+  GFML P
Sbjct  560  GNFPNQHPG-GSGLPEWTKADRKIEDEDIVLWHVFGPTHVPRPEDWPVMPVDYSGFMLRP  618

Query  394  HGFFN  380
            HGF +
Sbjct  619  HGFCD  623



>ref|WP_028063099.1| tyramine oxidase [Solirubrobacter soli]
Length=643

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 79/124 (64%), Gaps = 1/124 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I+N   V+  G    YKLV G N  P+   +++F  RA F + ++WVT Y   E F  
Sbjct  501  WRIENPNEVSALGDPVAYKLVPGENVAPMYAPDSRFANRAGFTREHVWVTAYDPAERFAA  560

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++PNQ+P  G+G+A +V+ +RP E TD+VLWY FG  HV R EDWPVMPV  IGF L P
Sbjct  561  GDYPNQHPG-GDGVARYVEADRPTENTDVVLWYTFGAHHVVRPEDWPVMPVTHIGFKLKP  619

Query  394  HGFF  383
             GFF
Sbjct  620  AGFF  623



>ref|WP_039923589.1| tyramine oxidase, partial [Leifsonia aquatica]
Length=642

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 78/124 (63%), Gaps = 1/124 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I NT   NR GQ TGY L    N   +A   A    RAAF    +WVT YA +E +P 
Sbjct  504  WHIVNTEKTNRLGQPTGYVLHAEQNPTLMADPSATVTARAAFTTKQVWVTQYASDERYPA  563

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEF NQNP  G+GL +++  +RPL+  DIVLW+ FG TH PR+EDWPVMPV+   F L P
Sbjct  564  GEFVNQNPG-GDGLPAYMAADRPLDGEDIVLWHTFGPTHFPRVEDWPVMPVDYAKFTLKP  622

Query  394  HGFF  383
            +GFF
Sbjct  623  YGFF  626



>ref|WP_003805961.1| copper-containing amine oxidase, partial [Arthrobacter globiformis]
 dbj|GAB16038.1| copper-containing amine oxidase, partial [Arthrobacter globiformis 
NBRC 12137]
Length=367

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 77/125 (62%), Gaps = 0/125 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    N   +   Y+L+  +     AG E+   +RA F ++NLWVT Y R E F  
Sbjct  228  WKIANHEKKNIVDEPVAYRLIPTNGIQLAAGDESYVSKRAQFARNNLWVTAYDRTERFAA  287

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GE+PNQ     +GL  W +++R + + D+V+WY FG+ HV RLEDWPVMP + IGFML P
Sbjct  288  GEYPNQATGADDGLHIWTQKDRNIVDQDLVVWYTFGMHHVVRLEDWPVMPRQNIGFMLEP  347

Query  394  HGFFN  380
            HGFFN
Sbjct  348  HGFFN  352



>gb|ERK69570.1| histamine oxidase [Leifsonia aquatica ATCC 14665]
Length=667

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 78/124 (63%), Gaps = 1/124 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I NT   NR GQ TGY L    N   +A   A    RAAF    +WVT YA +E +P 
Sbjct  510  WHIVNTEKTNRLGQPTGYVLHAEQNPTLMADPSATVTARAAFTTKQVWVTQYASDERYPA  569

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEF NQNP  G+GL +++  +RPL+  DIVLW+ FG TH PR+EDWPVMPV+   F L P
Sbjct  570  GEFVNQNPG-GDGLPAYMAADRPLDGEDIVLWHTFGPTHFPRVEDWPVMPVDYAKFTLKP  628

Query  394  HGFF  383
            +GFF
Sbjct  629  YGFF  632



>ref|XP_005964261.1| PREDICTED: copper amine oxidase 1-like [Pantholops hodgsonii]
Length=697

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 80/124 (65%), Gaps = 1/124 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W+I+N  + NR G   GY++      LP    ++   +RA +L ++LWVT +   EMF  
Sbjct  511  WVIQNPNSKNRMGTNVGYRIEPTEVVLPFFNDDSSIAKRAGYLNNHLWVTKFDEGEMFAA  570

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G +PNQNP   +GL  W++Q+R +E  DIV+WYVFG  HVPRLEDWPVMP  ++GF L P
Sbjct  571  GRYPNQNPG-PDGLPRWIEQDRNIENEDIVVWYVFGHHHVPRLEDWPVMPNAKLGFKLKP  629

Query  394  HGFF  383
             GFF
Sbjct  630  SGFF  633



>ref|WP_028276189.1| histamine oxidase [Arthrobacter sp. I3]
Length=645

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W+I N  + NR G+  GYKL   +    LA  ++   RRAAF   +LWVT YA +E +P 
Sbjct  493  WVISNPESRNRLGEPVGYKLHSQNQPTLLADPDSSIARRAAFATKDLWVTRYAEDERYPT  552

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G+F NQ+   G GL ++V Q+R ++  DIV+W+ FG+TH PR+EDWP+MPV+ +GF L P
Sbjct  553  GDFVNQHSG-GAGLPAYVSQDRDIDGQDIVIWHTFGLTHFPRVEDWPMMPVDTVGFKLRP  611

Query  394  HGFFN  380
             GFF+
Sbjct  612  DGFFD  616



>ref|WP_033288818.1| tyramine oxidase [Amycolatopsis jejuensis]
Length=623

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W +++T   NR G  T Y+LV   +   +A  E+   +RA F  ++LWVTPYA +E FP 
Sbjct  483  WEVRSTEHTNRLGAPTAYQLVPRPSATLMAQPESSVHKRATFATNHLWVTPYAPDERFPA  542

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G+ P  +P  G GL++W   +R + +TD+VLW+VFG TH+PR EDWPVMPV+  GF L P
Sbjct  543  GDRPGAHPG-GAGLSAWTAGDRSISDTDVVLWHVFGPTHIPRPEDWPVMPVDYSGFTLRP  601

Query  394  HGFFN  380
            +GFF+
Sbjct  602  YGFFD  606



>ref|WP_037078438.1| tyramine oxidase [Pseudonocardia spinosispora]
Length=628

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 80/125 (64%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N    N+ G    YKLV G+    +   E+  L+RA  L+H LWVTP+ R+E +P 
Sbjct  490  WKITNPGKRNKVGAPVAYKLVPGAAVPAMLDPESPVLKRAQVLRHTLWVTPFDRDERWPC  549

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEF NQ+    EGL  W + +R +E TD+VLWYVFG+ HVPR+EDWP+MP + + F L P
Sbjct  550  GEFVNQS-GTDEGLPVWTEADRSIENTDVVLWYVFGIHHVPRVEDWPIMPADTVSFWLKP  608

Query  394  HGFFN  380
             GFF+
Sbjct  609  TGFFD  613



>ref|WP_024477500.1| histamine oxidase [Arthrobacter sp. CAL618]
Length=638

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W+I N  ++NR G+  GYKL   +    LA  E+   RRA F   +LWVT +A +E +P 
Sbjct  495  WVISNPESLNRLGEPVGYKLHSEAQPTLLADPESSIARRATFATKDLWVTRFAEDERYPT  554

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G+F NQ+   G GL ++V Q+R L+  D+V+W+ FG+TH PRLEDWP+MPV+ +GF L P
Sbjct  555  GDFVNQHVG-GAGLPAYVAQDRDLDGQDLVVWHTFGLTHFPRLEDWPIMPVDTVGFKLRP  613

Query  394  HGFFN  380
             GFF+
Sbjct  614  EGFFD  618



>ref|WP_028271227.1| histamine oxidase [Arthrobacter sp. UNC362MFTsu5.1]
Length=645

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII N  + NR G+  GYKL        LA  E+   RRAAF   +LWVT +A +E +P 
Sbjct  499  WIISNPESRNRLGEPVGYKLHAQGQPTLLADPESSIARRAAFATKDLWVTRFAEDERYPT  558

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G+F NQ+   G GL ++V Q+R ++  DIV+W+ FG+TH PR+EDWP+MPV+ +GF L P
Sbjct  559  GDFVNQHSG-GAGLPAYVAQDREIDGQDIVVWHTFGLTHFPRIEDWPIMPVDTVGFKLRP  617

Query  394  HGFFN  380
             GFF+
Sbjct  618  EGFFD  622



>ref|WP_009075996.1| tyramine oxidase [Streptomyces sp. AA4]
 gb|EFL06694.1| tyramine oxidase [Streptomyces sp. AA4]
Length=636

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 82/124 (66%), Gaps = 1/124 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W + N    + TG+  GY+L+ G+N LPLA + ++  RRA F   +LWVT Y  ++ +  
Sbjct  499  WTVVNPSVRHHTGRPVGYQLMPGTNILPLAQSGSQTSRRAGFAYRHLWVTAYDPDQRYAS  558

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G++PNQ P   +GLA +V+ +RPL +TD+V+WY FG  HVPR EDWPVMPV + GF L P
Sbjct  559  GDYPNQRPG-DDGLAEYVRADRPLVDTDVVVWYTFGANHVPRPEDWPVMPVSKAGFHLRP  617

Query  394  HGFF  383
              FF
Sbjct  618  VAFF  621



>ref|WP_035743334.1| tyramine oxidase [Arthrobacter sp. MA-N2]
Length=646

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 78/125 (62%), Gaps = 0/125 (0%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W I N  + N   +   Y+L+        AG E+   +RA F ++NLWVT Y R E F  
Sbjct  497  WKIVNHESRNIVDEPVAYRLIPTDGIQLAAGDESYVSKRAQFARNNLWVTAYDRTERFAA  556

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            GEFPNQ+    +GL  W +++R + + D+V+WY FG+ HV RLEDWPVMP + IGFML P
Sbjct  557  GEFPNQSTGADDGLHIWTEKDRNIVDEDLVVWYTFGMHHVVRLEDWPVMPRQNIGFMLEP  616

Query  394  HGFFN  380
            HGFFN
Sbjct  617  HGFFN  621



>ref|WP_018774097.1| tyramine oxidase [Arthrobacter sp. 131MFCol6.1]
Length=652

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            WII N  + NR G+  GYKL        LA  E+   RRAAF   +LWVT +A  E +P 
Sbjct  500  WIISNPESRNRLGEPVGYKLHAQGQPTLLADPESSIARRAAFATKDLWVTRFAEEERYPT  559

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G+F NQ+   G GL ++V Q+R ++  DIV+W+ FG+TH PR+EDWP+MPV+ +GF L P
Sbjct  560  GDFVNQHAG-GAGLPAYVAQDRDIDGQDIVVWHTFGLTHFPRIEDWPIMPVDTVGFKLRP  618

Query  394  HGFFN  380
             GFF+
Sbjct  619  EGFFD  623



>ref|WP_043836428.1| tyramine oxidase [Amycolatopsis orientalis]
Length=623

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W +++T   NR G  T Y+LV   +   +A  E+   +RA F  ++LWVTPYA +E FP 
Sbjct  483  WEVRSTEHTNRLGAPTAYQLVPRPSATLMAQPESTVYQRATFATNHLWVTPYAPDERFPA  542

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G+ PN +P  G GL +W   +R + +TD+VLW+VFG TH+PR EDWPVMPV+  GFM+ P
Sbjct  543  GDRPNAHPG-GAGLPAWTAADRSVSDTDVVLWHVFGPTHIPRPEDWPVMPVDYSGFMVRP  601

Query  394  HGFFN  380
            +GF +
Sbjct  602  YGFCD  606



>ref|WP_037817779.1| tyramine oxidase [Streptomyces sp. NRRL F-3213]
Length=623

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W +++T   NR G  T Y+LV   +   +A  E+   +RA F  ++LWVTPYA +E FP 
Sbjct  483  WEVRSTEHTNRLGAPTAYQLVPRPSATLMAQPESTVYQRATFATNHLWVTPYAPDERFPA  542

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G+ PN +P  G GL +W   +R + +TD+VLW+VFG TH+PR EDWPVMPV+  GFM+ P
Sbjct  543  GDRPNAHPG-GAGLPAWTAADRSVSDTDVVLWHVFGPTHIPRPEDWPVMPVDYSGFMVRP  601

Query  394  HGFFN  380
            +GF +
Sbjct  602  YGFCD  606



>gb|EFL10175.1| tyramine oxidase [Streptomyces sp. AA4]
Length=656

 Score =   128 bits (321),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -3

Query  754  WIIKNTRTVNRTGQLTGYKLVXGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  575
            W +++T   NR G  T Y+LV   +   +A  E+   +RA F  ++LWVTPYA +E FP 
Sbjct  516  WEVRSTEHTNRLGAPTAYQLVPRPSATLMAQPESTVYQRATFATNHLWVTPYAPDERFPA  575

Query  574  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  395
            G+ PN +P  G GL +W   +R + +TD+VLW+VFG TH+PR EDWPVMPV+  GFM+ P
Sbjct  576  GDRPNAHPG-GAGLPAWTAADRSVSDTDVVLWHVFGPTHIPRPEDWPVMPVDYSGFMVRP  634

Query  394  HGFFN  380
            +GF +
Sbjct  635  YGFCD  639



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260