BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF022I09

Length=761
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006419936.1|  hypothetical protein CICLE_v100047531mg            201   5e-60   
ref|XP_011071583.1|  PREDICTED: FRIGIDA-like protein 4a                 206   6e-59   Sesamum indicum [beniseed]
gb|KDO74576.1|  hypothetical protein CISIN_1g010192mg                   202   1e-57   Citrus sinensis [apfelsine]
ref|XP_006489388.1|  PREDICTED: FRIGIDA-like protein 4a-like            202   2e-57   Citrus sinensis [apfelsine]
gb|ACV83306.2|  hypothetical protein UP-5                               194   2e-57   Dimocarpus longan [longan]
ref|XP_002517136.1|  Protein FRIGIDA, putative                          202   2e-57   Ricinus communis
emb|CDO99060.1|  unnamed protein product                                194   3e-57   Coffea canephora [robusta coffee]
gb|KDP40175.1|  hypothetical protein JCGZ_02173                         201   3e-57   Jatropha curcas
ref|XP_011026525.1|  PREDICTED: FRIGIDA-like protein 4a                 200   2e-56   Populus euphratica
gb|EYU45654.1|  hypothetical protein MIMGU_mgv1a004401mg                200   2e-56   Erythranthe guttata [common monkey flower]
gb|AEK20760.1|  FRIGIDA                                                 199   3e-56   Coffea arabica [arabica coffee]
ref|XP_002311627.2|  hydroxyproline-rich glycoprotein                   197   1e-55   Populus trichocarpa [western balsam poplar]
ref|XP_007034760.1|  FRIGIDA-like protein isoform 1                     197   2e-55   
ref|XP_002282465.1|  PREDICTED: FRIGIDA-like protein 4a                 196   5e-55   Vitis vinifera
emb|CAN69766.1|  hypothetical protein VITISV_022061                     196   5e-55   Vitis vinifera
ref|XP_006360794.1|  PREDICTED: FRIGIDA-like protein 4a-like            195   1e-54   Solanum tuberosum [potatoes]
gb|KJB28346.1|  hypothetical protein B456_005G042900                    197   2e-54   Gossypium raimondii
gb|KHG27689.1|  Protein FRIGIDA -like protein                           194   3e-54   Gossypium arboreum [tree cotton]
ref|XP_004247354.1|  PREDICTED: FRIGIDA-like protein 4a                 192   1e-53   Solanum lycopersicum
gb|KHN15769.1|  hypothetical protein glysoja_012561                     184   2e-53   Glycine soja [wild soybean]
gb|AFP97615.1|  frigida-like protein                                    191   3e-53   Medicago sativa [alfalfa]
gb|KEH43877.1|  frigida-LIKE protein                                    191   3e-53   Medicago truncatula
ref|XP_003556050.1|  PREDICTED: FRIGIDA-like protein 4a-like            189   2e-52   
ref|XP_010090919.1|  hypothetical protein L484_004461                   187   7e-52   Morus notabilis
gb|ABM05952.1|  proline-rich protein                                    179   2e-51   Gossypium hirsutum [American cotton]
gb|KJB38152.1|  hypothetical protein B456_006G239300                    183   3e-51   Gossypium raimondii
ref|XP_003536533.1|  PREDICTED: FRIGIDA-like protein 4a-like            185   5e-51   Glycine max [soybeans]
ref|XP_007143260.1|  hypothetical protein PHAVU_007G057500g             185   8e-51   Phaseolus vulgaris [French bean]
gb|KJB38151.1|  hypothetical protein B456_006G239300                    184   1e-50   Gossypium raimondii
ref|XP_007225712.1|  hypothetical protein PRUPE_ppa004224mg             184   1e-50   Prunus persica
ref|XP_008340987.1|  PREDICTED: FRIGIDA-like protein 4a                 183   3e-50   
gb|KCW60755.1|  hypothetical protein EUGRSUZ_H03480                     181   7e-50   Eucalyptus grandis [rose gum]
gb|KHG22505.1|  Protein FRIGIDA -like protein                           182   9e-50   Gossypium arboreum [tree cotton]
gb|KCW60756.1|  hypothetical protein EUGRSUZ_H03480                     181   2e-49   Eucalyptus grandis [rose gum]
ref|XP_010024304.1|  PREDICTED: LOW QUALITY PROTEIN: FRIGIDA-like...    181   2e-49   Eucalyptus grandis [rose gum]
ref|XP_006414627.1|  hypothetical protein EUTSA_v10024868mg             181   2e-49   Eutrema salsugineum [saltwater cress]
ref|XP_004139882.1|  PREDICTED: uncharacterized protein LOC101210012    179   5e-49   
gb|KGN44244.1|  hypothetical protein Csa_7G234160                       179   5e-49   Cucumis sativus [cucumbers]
ref|XP_008447152.1|  PREDICTED: FRIGIDA-like protein 4a                 179   6e-49   
ref|XP_010256039.1|  PREDICTED: FRIGIDA-like protein 4a                 178   2e-48   Nelumbo nucifera [Indian lotus]
ref|XP_009610915.1|  PREDICTED: FRIGIDA-like protein 4a                 178   2e-48   Nicotiana tomentosiformis
ref|XP_009369844.1|  PREDICTED: FRIGIDA-like protein 4a                 177   4e-48   Pyrus x bretschneideri [bai li]
ref|XP_009784382.1|  PREDICTED: FRIGIDA-like protein 4a                 176   7e-48   Nicotiana sylvestris
ref|XP_004159038.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    176   1e-47   
ref|XP_010449973.1|  PREDICTED: FRIGIDA-like protein 4b                 174   5e-47   Camelina sativa [gold-of-pleasure]
ref|XP_008390891.1|  PREDICTED: FRIGIDA-like protein 4a                 174   6e-47   Malus domestica [apple tree]
gb|KFK43732.1|  hypothetical protein AALP_AA1G165500                    173   1e-46   Arabis alpina [alpine rockcress]
ref|XP_010695287.1|  PREDICTED: FRIGIDA-like protein 4a                 173   2e-46   Beta vulgaris subsp. vulgaris [field beet]
gb|AAL31182.1|  AT4g14900/dl3490c                                       172   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567447.1|  FRIGIDA-like protein                                  172   4e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435051.1|  PREDICTED: FRIGIDA-like protein 4b                 171   8e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006283490.1|  hypothetical protein CARUB_v10004542mg             171   1e-45   Capsella rubella
ref|XP_010440374.1|  PREDICTED: FRIGIDA-like protein 4b                 170   3e-45   Camelina sativa [gold-of-pleasure]
ref|XP_002868244.1|  hydroxyproline-rich glycoprotein family protein    169   3e-45   Arabidopsis lyrata subsp. lyrata
gb|AGV54404.1|  frigida protein                                         165   1e-43   Phaseolus vulgaris [French bean]
ref|XP_010488272.1|  PREDICTED: FRIGIDA-like protein 4a                 166   1e-43   Camelina sativa [gold-of-pleasure]
gb|KFK39537.1|  hypothetical protein AALP_AA3G257000                    165   1e-43   Arabis alpina [alpine rockcress]
ref|NP_566709.1|  FRIGIDA-like protein                                  165   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010511354.1|  PREDICTED: FRIGIDA-like protein 4a                 164   3e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010551726.1|  PREDICTED: FRIGIDA-like protein 4a                 163   7e-43   Tarenaya hassleriana [spider flower]
ref|XP_010525189.1|  PREDICTED: FRIGIDA-like protein 4a                 163   9e-43   Tarenaya hassleriana [spider flower]
emb|CDY34252.1|  BnaA01g24690D                                          162   1e-42   Brassica napus [oilseed rape]
ref|XP_006299103.1|  hypothetical protein CARUB_v10015242mg             161   3e-42   Capsella rubella
ref|XP_002883367.1|  hydroxyproline-rich glycoprotein family protein    160   6e-42   
gb|AGV54236.1|  hydroxyproline-rich glycoprotein                        160   1e-41   Phaseolus vulgaris [French bean]
ref|XP_009108852.1|  PREDICTED: FRIGIDA-like protein 4a                 160   1e-41   Brassica rapa
emb|CDY46317.1|  BnaC01g31510D                                          159   1e-41   Brassica napus [oilseed rape]
ref|XP_010466529.1|  PREDICTED: FRIGIDA-like protein 4a                 157   7e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010533277.1|  PREDICTED: FRIGIDA-like protein 4a                 155   8e-40   
ref|XP_004299118.1|  PREDICTED: FRIGIDA-like protein 4a                 155   9e-40   Fragaria vesca subsp. vesca
ref|XP_010277260.1|  PREDICTED: FRIGIDA-like protein 4a                 146   7e-37   Nelumbo nucifera [Indian lotus]
gb|EPS62727.1|  hypothetical protein M569_12062                         142   1e-35   Genlisea aurea
ref|XP_008224458.1|  PREDICTED: FRIGIDA-like protein 4a                 138   4e-34   Prunus mume [ume]
ref|XP_009389010.1|  PREDICTED: FRIGIDA-like protein 4a                 128   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008796767.1|  PREDICTED: FRIGIDA-like protein 4a                 127   4e-30   Phoenix dactylifera
ref|XP_010906476.1|  PREDICTED: FRIGIDA-like protein 4a                 125   2e-29   Elaeis guineensis
ref|XP_009408489.1|  PREDICTED: FRIGIDA-like protein 4a                 123   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388157.1|  PREDICTED: FRIGIDA-like protein 4a                 117   5e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006406163.1|  hypothetical protein EUTSA_v10020440mg             121   8e-28   
ref|XP_008778905.1|  PREDICTED: FRIGIDA-like protein 4a                 114   2e-25   Phoenix dactylifera
ref|XP_010909467.1|  PREDICTED: FRIGIDA-like protein 4a                 112   7e-25   Elaeis guineensis
ref|XP_006826275.1|  hypothetical protein AMTR_s00004p00045050          110   2e-24   Amborella trichopoda
gb|AHH02379.1|  FRIGIDA-like protein                                    100   3e-23   Aegiceras corniculatum
ref|XP_009395189.1|  PREDICTED: FRIGIDA-like protein 4a                 104   5e-23   
ref|XP_010228309.1|  PREDICTED: FRIGIDA-like protein 4a                 105   4e-22   Brachypodium distachyon [annual false brome]
emb|CDY38318.1|  BnaC05g30110D                                          100   2e-20   Brassica napus [oilseed rape]
dbj|BAC83627.1|  putative hydroxyproline-rich glycoprotein            98.6    7e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EEE66652.1|  hypothetical protein OsJ_23273                        98.6    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006658319.1|  PREDICTED: FRIGIDA-like protein 4a-like          95.5    3e-19   Oryza brachyantha
ref|XP_004955594.1|  PREDICTED: protein FRIGIDA-like                  95.9    7e-19   Setaria italica
emb|CAB10269.1|  hydroxyproline-rich glycoprotein homolog             91.3    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002461525.1|  hypothetical protein SORBIDRAFT_02g004090        90.1    5e-17   
gb|ABK25209.1|  unknown                                               88.2    2e-16   Picea sitchensis
emb|CBI26255.3|  unnamed protein product                              82.4    2e-16   Vitis vinifera
gb|ABR17868.1|  unknown                                               88.2    3e-16   Picea sitchensis
gb|ABK95640.1|  unknown                                               80.1    1e-15   Populus trichocarpa [western balsam poplar]
gb|AIZ49817.1|  ABI3-interacting protein 2                            79.7    7e-15   Araucaria biramulata
gb|AIZ49827.1|  ABI3-interacting protein 2                            80.1    8e-15   Araucaria montana
gb|AIZ49820.1|  ABI3-interacting protein 2                            80.1    8e-15   Araucaria muelleri
gb|AIZ49839.1|  ABI3-interacting protein 2                            79.7    8e-15   Araucaria columnaris
gb|AIZ49833.1|  ABI3-interacting protein 2                            79.7    8e-15   Araucaria rulei
gb|AIZ49836.1|  ABI3-interacting protein 2                            79.7    8e-15   Araucaria scopulorum
gb|EEC76321.1|  hypothetical protein OsI_13877                        83.6    9e-15   Oryza sativa Indica Group [Indian rice]
gb|AIZ49823.1|  ABI3-interacting protein 2                            79.7    9e-15   Araucaria humboldtensis
ref|NP_001051543.1|  Os03g0794900                                     83.2    1e-14   
gb|AIZ49835.1|  ABI3-interacting protein 2                            79.3    1e-14   Araucaria scopulorum
gb|EEE60086.1|  hypothetical protein OsJ_12936                        83.2    1e-14   Oryza sativa Japonica Group [Japonica rice]
gb|AIZ49814.1|  ABI3-interacting protein 2                            79.7    1e-14   Araucaria bernieri
ref|XP_008652075.1|  PREDICTED: FRIGIDA-like protein 4a               82.0    3e-14   Zea mays [maize]
gb|AIZ49840.1|  ABI3-interacting protein 2                            77.8    3e-14   Araucaria muelleri
ref|NP_001145922.1|  uncharacterized protein LOC100279445             79.7    4e-14   Zea mays [maize]
dbj|BAK00009.1|  predicted protein                                    81.3    6e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA42568.1|  TPA: hypothetical protein ZEAMMB73_160821            80.9    6e-14   
gb|AGX28284.1|  hydroxyproline-rich glycoprotein-like protein         73.2    1e-13   Populus euphratica
ref|XP_006650719.1|  PREDICTED: FRIGIDA-like protein 4a-like          79.3    2e-13   
ref|XP_010228481.1|  PREDICTED: LOW QUALITY PROTEIN: 5'-3' exorib...  78.6    6e-13   
gb|EMS54431.1|  5'-3' exoribonuclease 4                               78.2    8e-13   Triticum urartu
gb|EMT08825.1|  5'-3' exoribonuclease 4                               78.2    9e-13   
ref|XP_002961449.1|  hypothetical protein SELMODRAFT_76871            77.0    1e-12   
ref|XP_006842236.1|  hypothetical protein AMTR_s00078p00186900        74.7    6e-12   Amborella trichopoda
gb|AIZ49841.1|  ABI3-interacting protein 2                            70.1    1e-11   Araucaria subulata
ref|XP_010254145.1|  PREDICTED: FRIGIDA-like protein 4a               72.0    5e-11   Nelumbo nucifera [Indian lotus]
gb|KHG13959.1|  Protein FRIGIDA -like protein                         71.2    8e-11   Gossypium arboreum [tree cotton]
gb|AAP31312.2|  ABI3-interacting protein 2                            70.9    2e-10   Callitropsis nootkatensis [Nootka cypress]
gb|KJB06948.1|  hypothetical protein B456_001G004500                  70.5    2e-10   Gossypium raimondii
ref|XP_009338911.1|  PREDICTED: FRIGIDA-like protein 2                69.7    3e-10   Pyrus x bretschneideri [bai li]
ref|XP_009338897.1|  PREDICTED: FRIGIDA-like protein 2                69.7    3e-10   Pyrus x bretschneideri [bai li]
gb|KDO50860.1|  hypothetical protein CISIN_1g009377mg                 69.3    4e-10   Citrus sinensis [apfelsine]
ref|XP_006451127.1|  hypothetical protein CICLE_v10007961mg           68.9    4e-10   Citrus clementina [clementine]
ref|XP_006371903.1|  hypothetical protein POPTR_0018s05930g           66.6    6e-10   
ref|XP_010097353.1|  hypothetical protein L484_010231                 68.9    6e-10   Morus notabilis
ref|XP_004295864.1|  PREDICTED: truncated FRIGIDA-like protein 1      68.6    7e-10   Fragaria vesca subsp. vesca
ref|XP_011043451.1|  PREDICTED: FRIGIDA-like protein 4a               68.6    8e-10   Populus euphratica
ref|XP_008337438.1|  PREDICTED: FRIGIDA-like protein 4a               68.6    8e-10   
ref|XP_006371900.1|  hypothetical protein POPTR_0018s05910g           68.2    8e-10   Populus trichocarpa [western balsam poplar]
gb|KDP33654.1|  hypothetical protein JCGZ_07225                       68.2    1e-09   Jatropha curcas
ref|XP_008242610.1|  PREDICTED: FRIGIDA-like protein 4a               68.2    1e-09   Prunus mume [ume]
ref|XP_007204566.1|  hypothetical protein PRUPE_ppa003799mg           67.8    1e-09   Prunus persica
gb|AIN75610.1|  FRIGIDA4a                                             67.4    1e-09   Dimocarpus longan [longan]
ref|XP_006371906.1|  hypothetical protein POPTR_0018s059601g          65.5    2e-09   
ref|XP_006387116.1|  hypothetical protein POPTR_1811s00200g           65.9    2e-09   
ref|XP_004287092.1|  PREDICTED: FRIGIDA-like protein 4a isoform X1    67.4    2e-09   Fragaria vesca subsp. vesca
ref|XP_011458926.1|  PREDICTED: FRIGIDA-like protein 4a isoform X2    67.4    2e-09   Fragaria vesca subsp. vesca
ref|XP_006371905.1|  hypothetical protein POPTR_0018s059601g          65.9    3e-09   
ref|XP_008344098.1|  PREDICTED: FRIGIDA-like protein 4a               65.1    3e-09   
ref|XP_007020622.1|  FRIGIDA like 1, putative                         66.6    4e-09   
ref|XP_007013214.1|  FRIGIDA-like protein                             66.2    4e-09   
ref|XP_010270166.1|  PREDICTED: truncated FRIGIDA-like protein 1      66.2    4e-09   Nelumbo nucifera [Indian lotus]
ref|XP_002514326.1|  conserved hypothetical protein                   66.2    4e-09   Ricinus communis
ref|XP_008227104.1|  PREDICTED: FRIGIDA-like protein 1                65.9    6e-09   Prunus mume [ume]
ref|XP_011016586.1|  PREDICTED: FRIGIDA-like protein 4a               63.2    8e-09   Populus euphratica
ref|XP_009347163.1|  PREDICTED: FRIGIDA-like protein 4a               65.1    9e-09   Pyrus x bretschneideri [bai li]
ref|XP_009336927.1|  PREDICTED: FRIGIDA-like protein 4a               64.7    1e-08   Pyrus x bretschneideri [bai li]
ref|XP_008386583.1|  PREDICTED: FRIGIDA-like protein 4a               64.7    1e-08   
ref|XP_002967308.1|  hypothetical protein SELMODRAFT_144478           64.3    2e-08   
ref|XP_010047742.1|  PREDICTED: FRIGIDA-like protein 4a               64.3    2e-08   Eucalyptus grandis [rose gum]
ref|XP_006858746.1|  hypothetical protein AMTR_s00066p00134410        63.9    2e-08   Amborella trichopoda
ref|XP_010088834.1|  hypothetical protein L484_020817                 63.5    3e-08   Morus notabilis
ref|XP_007211879.1|  hypothetical protein PRUPE_ppa003499mg           63.5    3e-08   
ref|XP_004503419.1|  PREDICTED: uncharacterized protein LOC101489761  63.5    3e-08   Cicer arietinum [garbanzo]
ref|XP_007160344.1|  hypothetical protein PHAVU_002G313900g           63.5    4e-08   Phaseolus vulgaris [French bean]
ref|XP_006474949.1|  PREDICTED: FRIGIDA-like protein 1-like           63.2    4e-08   Citrus sinensis [apfelsine]
gb|KDO62201.1|  hypothetical protein CISIN_1g009061mg                 63.2    4e-08   Citrus sinensis [apfelsine]
emb|CBI28087.3|  unnamed protein product                              62.8    4e-08   Vitis vinifera
ref|XP_010656337.1|  PREDICTED: FRIGIDA-like protein 4a isoform X1    62.8    6e-08   Vitis vinifera
ref|XP_002281155.2|  PREDICTED: FRIGIDA-like protein 4a isoform X2    62.8    6e-08   Vitis vinifera
ref|XP_006600926.1|  PREDICTED: FRIGIDA-like protein 3-like           62.8    6e-08   Glycine max [soybeans]
gb|KHN44015.1|  Protein FRIGIDA                                       62.8    6e-08   Glycine soja [wild soybean]
emb|CAN61251.1|  hypothetical protein VITISV_004639                   62.8    7e-08   Vitis vinifera
ref|XP_006452513.1|  hypothetical protein CICLE_v10007929mg           62.0    1e-07   Citrus clementina [clementine]
ref|XP_010915057.1|  PREDICTED: FRIGIDA-like protein 4b isoform X1    62.0    1e-07   Elaeis guineensis
gb|AEW08332.1|  hypothetical protein 2_6510_01                        59.3    1e-07   Pinus radiata
gb|AFK43654.1|  unknown                                               60.8    3e-07   Medicago truncatula
ref|XP_003629646.1|  Protein FRIGIDA                                  60.8    3e-07   Medicago truncatula
ref|XP_006579918.1|  PREDICTED: FRIGIDA-like protein 3-like isofo...  60.5    3e-07   Glycine max [soybeans]
gb|KHN41556.1|  Protein FRIGIDA                                       60.5    4e-07   Glycine soja [wild soybean]
ref|XP_006579919.1|  PREDICTED: FRIGIDA-like protein 3-like isofo...  60.5    4e-07   Glycine max [soybeans]
ref|XP_003524673.1|  PREDICTED: FRIGIDA-like protein 3-like isofo...  60.5    4e-07   Glycine max [soybeans]
gb|KDP39236.1|  hypothetical protein JCGZ_00993                       60.1    4e-07   Jatropha curcas
ref|XP_008366422.1|  PREDICTED: FRIGIDA-like protein 2                60.1    5e-07   
ref|XP_010097278.1|  hypothetical protein L484_009510                 60.1    5e-07   Morus notabilis
ref|XP_010915058.1|  PREDICTED: FRIGIDA-like protein 4b isoform X2    60.1    5e-07   Elaeis guineensis
ref|XP_010271588.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     59.7    6e-07   Nelumbo nucifera [Indian lotus]
ref|XP_010271580.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     60.1    6e-07   Nelumbo nucifera [Indian lotus]
ref|XP_004242450.1|  PREDICTED: FRIGIDA-like protein 3                59.3    8e-07   Solanum lycopersicum
ref|XP_001752883.1|  predicted protein                                59.3    9e-07   
ref|XP_009401032.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     58.9    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009401034.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     58.9    1e-06   
gb|EYU27415.1|  hypothetical protein MIMGU_mgv1a005047mg              58.5    1e-06   Erythranthe guttata [common monkey flower]
ref|XP_010938943.1|  PREDICTED: truncated FRIGIDA-like protein 1      58.5    2e-06   Elaeis guineensis
ref|XP_004956399.1|  PREDICTED: protein FRIGIDA-like                  58.2    2e-06   Setaria italica
ref|XP_002960412.1|  hypothetical protein SELMODRAFT_34543            57.8    2e-06   
dbj|BAF47121.1|  hydroxyproline-rich glycoprotein like protein        55.1    2e-06   Nicotiana tabacum [American tobacco]
ref|XP_003588287.1|  Hydroxyproline-rich glycoprotein like protein    56.6    2e-06   
ref|XP_008780981.1|  PREDICTED: truncated FRIGIDA-like protein 1      58.2    2e-06   Phoenix dactylifera
ref|XP_006426018.1|  hypothetical protein CICLE_v10025275mg           57.8    2e-06   
ref|XP_007155867.1|  hypothetical protein PHAVU_003G238500g           57.8    3e-06   Phaseolus vulgaris [French bean]
ref|XP_006426019.1|  hypothetical protein CICLE_v10025275mg           57.8    3e-06   Citrus clementina [clementine]
gb|KDO79035.1|  hypothetical protein CISIN_1g008359mg                 57.8    3e-06   Citrus sinensis [apfelsine]
tpg|DAA60796.1|  TPA: hypothetical protein ZEAMMB73_698906            55.1    3e-06   
ref|XP_008462976.1|  PREDICTED: FRIGIDA-like protein 1                57.4    4e-06   Cucumis melo [Oriental melon]
ref|XP_011463627.1|  PREDICTED: FRIGIDA-like protein 3                57.4    4e-06   Fragaria vesca subsp. vesca
ref|XP_010251408.1|  PREDICTED: FRIGIDA-like protein 3                57.0    5e-06   Nelumbo nucifera [Indian lotus]
ref|XP_008813697.1|  PREDICTED: truncated FRIGIDA-like protein 1      57.0    5e-06   Phoenix dactylifera
gb|KHN16599.1|  Protein FRIGIDA                                       56.6    5e-06   Glycine soja [wild soybean]
ref|XP_002455057.1|  hypothetical protein SORBIDRAFT_03g003680        57.0    6e-06   
ref|XP_006660447.1|  PREDICTED: FRIGIDA-like protein 3-like           57.0    6e-06   Oryza brachyantha
ref|XP_011080559.1|  PREDICTED: LOW QUALITY PROTEIN: FRIGIDA-like...  57.0    6e-06   Sesamum indicum [beniseed]
ref|XP_010679002.1|  PREDICTED: FRIGIDA-like protein 3                56.2    8e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006466524.1|  PREDICTED: FRIGIDA-like protein 3-like isofo...  56.2    8e-06   Citrus sinensis [apfelsine]
gb|KDP45205.1|  hypothetical protein JCGZ_15070                       56.2    9e-06   Jatropha curcas
ref|XP_003608453.1|  ABI3-interacting protein                         55.1    9e-06   
ref|XP_010688181.1|  PREDICTED: FRIGIDA-like protein 4a               56.2    1e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008786398.1|  PREDICTED: FRIGIDA-like protein 4a               56.2    1e-05   Phoenix dactylifera
ref|XP_011010336.1|  PREDICTED: FRIGIDA-like protein 3                56.2    1e-05   Populus euphratica
gb|KJB81662.1|  hypothetical protein B456_013G155600                  55.8    1e-05   Gossypium raimondii
emb|CDY48750.1|  BnaA02g30110D                                        55.8    1e-05   Brassica napus [oilseed rape]
ref|XP_003532490.1|  PREDICTED: FRIGIDA-like protein 4a-like          55.8    1e-05   Glycine max [soybeans]
ref|XP_006366815.1|  PREDICTED: FRIGIDA-like protein 3-like isofo...  55.8    1e-05   Solanum tuberosum [potatoes]
ref|XP_008652494.1|  PREDICTED: FRIGIDA-like protein 3                55.8    1e-05   Zea mays [maize]
ref|XP_006829297.1|  hypothetical protein AMTR_s00001p00273060        55.5    2e-05   Amborella trichopoda
ref|XP_009598293.1|  PREDICTED: FRIGIDA-like protein 4a               55.5    2e-05   Nicotiana tomentosiformis
ref|XP_009766201.1|  PREDICTED: FRIGIDA-like protein 4a               55.5    2e-05   Nicotiana sylvestris
dbj|BAD19899.1|  putative ABI3-interacting protein 2                  55.1    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010550845.1|  PREDICTED: FRIGIDA-like protein 1                55.5    2e-05   Tarenaya hassleriana [spider flower]
gb|AIN75612.1|  FRIGIDA3a-1                                           55.5    2e-05   Dimocarpus longan [longan]
ref|XP_011008039.1|  PREDICTED: truncated FRIGIDA-like protein 1      55.5    2e-05   Populus euphratica
gb|AIN75614.1|  FRIGIDA3b-1                                           55.5    2e-05   Dimocarpus longan [longan]
gb|AIN75613.1|  FRIGIDA3a-2                                           55.5    2e-05   Dimocarpus longan [longan]
ref|XP_010907692.1|  PREDICTED: FRIGIDA-like protein 1                55.1    2e-05   Elaeis guineensis
ref|XP_009629152.1|  PREDICTED: FRIGIDA-like protein 3                55.1    2e-05   Nicotiana tomentosiformis
dbj|BAF47124.1|  hydroproline-rich glycoprotein like protein          52.8    2e-05   Nicotiana tabacum [American tobacco]
gb|ADR31574.1|  frigida-like 1                                        53.5    2e-05   Populus trichocarpa [western balsam poplar]
gb|KHG07820.1|  Protein FRIGIDA -like protein                         55.1    2e-05   Gossypium arboreum [tree cotton]
ref|XP_002457174.1|  hypothetical protein SORBIDRAFT_03g002730        55.1    2e-05   Sorghum bicolor [broomcorn]
ref|XP_009794659.1|  PREDICTED: FRIGIDA-like protein 3                55.1    2e-05   Nicotiana sylvestris
ref|XP_011008572.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     55.1    2e-05   Populus euphratica
ref|XP_006380669.1|  hypothetical protein POPTR_0007s10310g           55.1    2e-05   
ref|XP_011008571.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     55.1    2e-05   Populus euphratica
ref|NP_001062668.1|  Os09g0248300                                     54.7    3e-05   
ref|XP_009406027.1|  PREDICTED: truncated FRIGIDA-like protein 1      54.7    3e-05   
ref|XP_008458098.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     55.1    3e-05   
gb|ADR31573.1|  frigida-like 1                                        53.5    3e-05   Populus trichocarpa [western balsam poplar]
gb|ADR31569.1|  frigida-like 1                                        53.5    3e-05   Populus trichocarpa [western balsam poplar]
ref|XP_009416846.1|  PREDICTED: truncated FRIGIDA-like protein 1      54.7    3e-05   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADR31560.1|  frigida-like 1                                        53.5    3e-05   Populus trichocarpa [western balsam poplar]
ref|XP_002320559.2|  hypothetical protein POPTR_0014s17360g           54.7    3e-05   
gb|KFK25859.1|  protein frigida like 1                                54.7    3e-05   Arabis alpina [alpine rockcress]
ref|XP_004149315.1|  PREDICTED: uncharacterized protein LOC101212341  54.7    3e-05   Cucumis sativus [cucumbers]
ref|XP_003577079.1|  PREDICTED: FRIGIDA-like protein 3                54.7    4e-05   Brachypodium distachyon [annual false brome]
ref|XP_011095502.1|  PREDICTED: truncated FRIGIDA-like protein 1      54.3    4e-05   Sesamum indicum [beniseed]
gb|ADR31565.1|  frigida-like 1                                        53.1    4e-05   Populus trichocarpa [western balsam poplar]
ref|XP_008458100.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     54.3    4e-05   Cucumis melo [Oriental melon]
ref|XP_010939086.1|  PREDICTED: FRIGIDA-like protein 3                54.3    4e-05   Elaeis guineensis
ref|XP_002512283.1|  conserved hypothetical protein                   54.3    4e-05   Ricinus communis
emb|CBI23332.3|  unnamed protein product                              53.1    4e-05   Vitis vinifera
emb|CDY05684.1|  BnaC02g38530D                                        54.3    4e-05   
ref|XP_009358937.1|  PREDICTED: FRIGIDA-like protein 3                54.3    4e-05   Pyrus x bretschneideri [bai li]
gb|ABK94872.1|  unknown                                               54.3    5e-05   Populus trichocarpa [western balsam poplar]
ref|XP_002303026.1|  hypothetical protein POPTR_0002s24090g           54.3    5e-05   Populus trichocarpa [western balsam poplar]
ref|XP_006836774.1|  hypothetical protein AMTR_s00088p00168730        53.9    5e-05   
ref|XP_004509091.1|  PREDICTED: protein FRIGIDA-like                  53.9    5e-05   Cicer arietinum [garbanzo]
ref|XP_008790629.1|  PREDICTED: FRIGIDA-like protein 3                53.9    5e-05   
ref|XP_010277794.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     53.9    6e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010277793.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     53.9    6e-05   Nelumbo nucifera [Indian lotus]
ref|XP_002283922.2|  PREDICTED: FRIGIDA-like protein 3                53.9    6e-05   Vitis vinifera
ref|XP_009610151.1|  PREDICTED: FRIGIDA-like protein 3                53.9    6e-05   Nicotiana tomentosiformis
ref|XP_002302705.1|  FRIGIDA LIKE 1 family protein                    53.9    6e-05   Populus trichocarpa [western balsam poplar]
emb|CBI33736.3|  unnamed protein product                              53.5    6e-05   Vitis vinifera
gb|EMS54104.1|  hypothetical protein TRIUR3_33659                     53.5    7e-05   Triticum urartu
gb|KEH31518.1|  frigida-like protein                                  53.5    7e-05   Medicago truncatula
ref|XP_011024727.1|  PREDICTED: FRIGIDA-like protein 3                53.5    8e-05   Populus euphratica
ref|XP_009802214.1|  PREDICTED: FRIGIDA-like protein 3                53.5    8e-05   Nicotiana sylvestris
ref|XP_002527289.1|  conserved hypothetical protein                   53.1    1e-04   Ricinus communis
ref|XP_009129722.1|  PREDICTED: FRIGIDA-like protein 3                53.1    1e-04   Brassica rapa
ref|XP_008801033.1|  PREDICTED: FRIGIDA-like protein 3                53.1    1e-04   Phoenix dactylifera
ref|NP_001151902.1|  ABI3-interacting protein 2                       53.1    1e-04   Zea mays [maize]
ref|XP_010930297.1|  PREDICTED: FRIGIDA-like protein 3                53.1    1e-04   Elaeis guineensis
gb|KJB10822.1|  hypothetical protein B456_001G227000                  52.8    1e-04   Gossypium raimondii
gb|ABK42079.1|  hypothetical protein                                  52.8    1e-04   
gb|KJB10825.1|  hypothetical protein B456_001G227000                  52.8    1e-04   
ref|XP_010912749.1|  PREDICTED: FRIGIDA-like protein 3                52.8    1e-04   
ref|XP_008813784.1|  PREDICTED: FRIGIDA-like protein 3                52.8    1e-04   
ref|XP_009392592.1|  PREDICTED: FRIGIDA-like protein 3                52.8    1e-04   
ref|XP_009367793.1|  PREDICTED: FRIGIDA-like protein 3                52.8    1e-04   
ref|XP_002981887.1|  hypothetical protein SELMODRAFT_115612           52.8    2e-04   
ref|XP_002986007.1|  hypothetical protein SELMODRAFT_123480           52.8    2e-04   
gb|KEH18040.1|  ABI3-interacting protein                              52.4    2e-04   
gb|ABR17421.1|  unknown                                               52.4    2e-04   
ref|NP_001059003.1|  Os07g0173200                                     52.4    2e-04   
gb|ABK24390.1|  unknown                                               52.4    2e-04   
ref|XP_009406994.1|  PREDICTED: FRIGIDA-like protein 4a               50.1    2e-04   
ref|XP_008343464.1|  PREDICTED: LOW QUALITY PROTEIN: FRIGIDA-like...  52.4    2e-04   
gb|KDO43512.1|  hypothetical protein CISIN_1g008061mg                 52.0    2e-04   
ref|XP_010037083.1|  PREDICTED: FRIGIDA-like protein 3                52.0    2e-04   
ref|XP_004288232.1|  PREDICTED: FRIGIDA-like protein 4a               52.0    2e-04   
ref|XP_009629363.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     52.0    3e-04   
gb|KHN41626.1|  Protein FRIGIDA                                       51.6    3e-04   
dbj|BAC83628.1|  putative hydroxyproline-rich glycoprotein            51.6    3e-04   
ref|XP_009629356.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     52.0    3e-04   
emb|CBI34294.3|  unnamed protein product                              51.6    3e-04   
gb|ABK24547.1|  unknown                                               52.0    3e-04   
ref|XP_006447936.1|  hypothetical protein CICLE_v10014710mg           52.0    3e-04   
ref|XP_006599130.1|  PREDICTED: FRIGIDA-like protein 3-like           51.6    3e-04   
ref|XP_006447935.1|  hypothetical protein CICLE_v10014710mg           51.6    3e-04   
ref|XP_010087279.1|  hypothetical protein L484_009412                 51.6    3e-04   
ref|XP_008787217.1|  PREDICTED: FRIGIDA-like protein 3                51.6    3e-04   
ref|XP_003634846.1|  PREDICTED: FRIGIDA-like protein 3                51.6    3e-04   
ref|XP_006344098.1|  PREDICTED: uncharacterized LOC102577701 isof...  51.6    3e-04   
ref|XP_010482089.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     51.6    4e-04   
ref|NP_001274872.1|  uncharacterized protein LOC102577701             51.2    4e-04   
gb|ABB86244.1|  unknown                                               51.2    4e-04   
ref|XP_007024336.1|  Uncharacterized protein TCM_028912               48.9    4e-04   
ref|XP_010482087.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     51.2    4e-04   
ref|XP_010493658.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     51.2    4e-04   
ref|XP_006280261.1|  hypothetical protein CARUB_v10026179mg           51.2    4e-04   
ref|XP_010442259.1|  PREDICTED: FRIGIDA-like protein 3                51.2    4e-04   
ref|XP_010060241.1|  PREDICTED: FRIGIDA-like protein 1                51.2    4e-04   
emb|CAN75645.1|  hypothetical protein VITISV_031268                   51.2    5e-04   
ref|XP_002524951.1|  Protein FRIGIDA, putative                        51.2    5e-04   
ref|XP_004240442.1|  PREDICTED: FRIGIDA-like protein 3                50.8    6e-04   
ref|XP_010660000.1|  PREDICTED: FRIGIDA-like protein 1                51.2    6e-04   
gb|KHN30846.1|  Protein FRIGIDA                                       50.8    6e-04   
ref|XP_003525267.2|  PREDICTED: FRIGIDA-like protein 4a-like          50.8    6e-04   
ref|XP_009767900.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     50.8    6e-04   
ref|XP_007047434.1|  FRIGIDA-like protein, putative                   50.8    7e-04   
ref|XP_010659991.1|  PREDICTED: inactive FRIGIDA-like protein 2 i...  50.8    7e-04   
ref|XP_009415031.1|  PREDICTED: FRIGIDA-like protein 3                50.8    7e-04   
ref|XP_010028142.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     50.8    7e-04   
ref|XP_009767897.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     50.4    7e-04   
ref|XP_010095585.1|  hypothetical protein L484_007424                 50.4    7e-04   
ref|XP_003521014.1|  PREDICTED: FRIGIDA-like protein 3-like isofo...  50.4    7e-04   
ref|XP_010028143.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     50.4    9e-04   
ref|XP_010659992.1|  PREDICTED: FRIGIDA-like protein 2 isoform X2     50.4    9e-04   
gb|KHG07809.1|  Protein FRIGIDA -like protein                         50.4    9e-04   
emb|CAN83600.1|  hypothetical protein VITISV_033094                   50.4    0.001   
emb|CDP03992.1|  unnamed protein product                              50.4    0.001   
ref|XP_007134303.1|  hypothetical protein PHAVU_010G035900g           50.1    0.001   



>ref|XP_006419936.1| hypothetical protein CICLE_v100047531mg, partial [Citrus clementina]
 gb|ESR33176.1| hypothetical protein CICLE_v100047531mg, partial [Citrus clementina]
Length=217

 Score =   201 bits (510),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 141/166 (85%), Gaps = 4/166 (2%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKAFLKDAKKAA +ILEDPNN+GRAAHLAA+KE SA+RAV+KCIE+YKL
Sbjct  22   GLVDKFPPVPLLKAFLKDAKKAAVSILEDPNNAGRAAHLAARKEQSALRAVIKCIEDYKL  81

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            + EFPPE+LKKRL+QLEK K+E  K   AA PA KRTR SNGGPMPPAKAGR TNAYVSS
Sbjct  82   QGEFPPENLKKRLEQLEKAKTE--KKKPAAVPATKRTRASNGGPMPPAKAGRLTNAYVSS  139

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYSPEAA  264
            FP A PTFVRSPSHTQYP G+ AY ASP   +GS SP Y YSPEAA
Sbjct  140  FP-APPTFVRSPSHTQYPAGVTAY-ASPPAVYGSRSPPYAYSPEAA  183



>ref|XP_011071583.1| PREDICTED: FRIGIDA-like protein 4a [Sesamum indicum]
Length=520

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 140/163 (86%), Gaps = 5/163 (3%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL +KFPPV LLKAFLKDAKKAAT+ILEDPNNSGRAAH+AAKKE SAIRAVLKCIEEYKL
Sbjct  325  GLADKFPPVPLLKAFLKDAKKAATSILEDPNNSGRAAHMAAKKEQSAIRAVLKCIEEYKL  384

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFPPE+LKKRL+QLEK K E       A+PAAKRTR SNGGPMPPAKAGRSTNAYVSS
Sbjct  385  EAEFPPENLKKRLEQLEKAKIE---KKKPASPAAKRTRASNGGPMPPAKAGRSTNAYVSS  441

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASP-IYTHGSMSPQYVYS  276
            FP + PT+VRSPSHTQYP  +PAYPA P +Y HGS SP Y Y+
Sbjct  442  FP-SPPTYVRSPSHTQYPAPVPAYPAVPAVYGHGSRSPPYAYT  483



>gb|KDO74576.1| hypothetical protein CISIN_1g010192mg [Citrus sinensis]
Length=511

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 141/166 (85%), Gaps = 4/166 (2%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKAFLKDAKKAA +ILEDPNN+GRAAHLAA+KE SA+RAV+KCIE+YKL
Sbjct  316  GLVDKFPPVPLLKAFLKDAKKAAVSILEDPNNAGRAAHLAARKEQSALRAVIKCIEDYKL  375

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            + EFPPE+LKKRL+QLEK K+E  K   AA PA KRTR SNGGPMPPAKAGR TNAYVSS
Sbjct  376  QGEFPPENLKKRLEQLEKAKTE--KKKPAAVPATKRTRASNGGPMPPAKAGRLTNAYVSS  433

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYSPEAA  264
            FP A PTFVRSPSHTQYP G+ AY ASP   +GS SP Y YSPEAA
Sbjct  434  FP-APPTFVRSPSHTQYPAGVTAY-ASPPAVYGSRSPPYAYSPEAA  477



>ref|XP_006489388.1| PREDICTED: FRIGIDA-like protein 4a-like [Citrus sinensis]
 gb|KDO74577.1| hypothetical protein CISIN_1g010192mg [Citrus sinensis]
Length=515

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 141/166 (85%), Gaps = 4/166 (2%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKAFLKDAKKAA +ILEDPNN+GRAAHLAA+KE SA+RAV+KCIE+YKL
Sbjct  320  GLVDKFPPVPLLKAFLKDAKKAAVSILEDPNNAGRAAHLAARKEQSALRAVIKCIEDYKL  379

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            + EFPPE+LKKRL+QLEK K+E  K   AA PA KRTR SNGGPMPPAKAGR TNAYVSS
Sbjct  380  QGEFPPENLKKRLEQLEKAKTE--KKKPAAVPATKRTRASNGGPMPPAKAGRLTNAYVSS  437

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYSPEAA  264
            FP A PTFVRSPSHTQYP G+ AY ASP   +GS SP Y YSPEAA
Sbjct  438  FP-APPTFVRSPSHTQYPAGVTAY-ASPPAVYGSRSPPYAYSPEAA  481



>gb|ACV83306.2| hypothetical protein UP-5 [Dimocarpus longan]
Length=226

 Score =   194 bits (493),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 142/173 (82%), Gaps = 10/173 (6%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKAFLKDA+KAA +ILEDPNN+GRAAHLAA+KE SA+R+V+KCIEEYKL
Sbjct  22   GLVDKFPPVPLLKAFLKDARKAAASILEDPNNAGRAAHLAARKEQSALRSVIKCIEEYKL  81

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFPPE+LKKRL+QLEK K E  K   AA PA KRTR SNGGPMPPAKAGRSTNAYVSS
Sbjct  82   EAEFPPENLKKRLEQLEKAKIE--KKKPAAVPANKRTRASNGGPMPPAKAGRSTNAYVSS  139

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPA----SPIYTHGSMSPQ---YVYSPEAA  264
            FP A PTFVRSPSH+QYP G+  Y +    SP   +GS SPQ   Y YSPEAA
Sbjct  140  FP-APPTFVRSPSHSQYPAGVSPYQSPPYQSPPAVYGSRSPQAHPYAYSPEAA  191



>ref|XP_002517136.1| Protein FRIGIDA, putative [Ricinus communis]
 gb|EEF45299.1| Protein FRIGIDA, putative [Ricinus communis]
Length=520

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 143/168 (85%), Gaps = 6/168 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKAFLKDAKKAA +ILEDP+N+GRAAHLAA+KE SA+RAV+KCIEEYKL
Sbjct  323  GLVDKFPPVPLLKAFLKDAKKAAASILEDPDNTGRAAHLAARKEQSALRAVIKCIEEYKL  382

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFPPE+LKKRL+QLEKTK+E  K   AA PA KRTR SNGGPMPPAKAGR TNAYVSS
Sbjct  383  EAEFPPENLKKRLEQLEKTKTE--KKRPAAVPANKRTRASNGGPMPPAKAGRLTNAYVSS  440

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP--QYVYSPEAA  264
            FP A P FVRSPSHTQYPT LPAYP SP   +G+ SP   Y YSPEAA
Sbjct  441  FP-APPAFVRSPSHTQYPTALPAYP-SPPAVYGTRSPPSPYAYSPEAA  486



>emb|CDO99060.1| unnamed protein product [Coffea canephora]
Length=228

 Score =   194 bits (492),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 139/166 (84%), Gaps = 5/166 (3%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L+++FPPV LLKAFLKDAKK AT+IL DPNN+GRAAH+AAKKE SAIRAV+KCIEEYKLE
Sbjct  39   LVDEFPPVPLLKAFLKDAKKLATSILGDPNNTGRAAHMAAKKEQSAIRAVIKCIEEYKLE  98

Query  578  AEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSF  399
            AEFPPE+LKKRL+QLEKTK+E  K      PA KRTR SNG  +PPAKAGR TNAYVSSF
Sbjct  99   AEFPPENLKKRLEQLEKTKTE--KRKPVVVPANKRTRASNGEHVPPAKAGRLTNAYVSSF  156

Query  398  PAAAPTFVRSPSHTQYPTGLPAYPASP-IYTHGSMSPQ-YVYSPEA  267
            P AAPTFVRSPSH+ Y  G+PAYP+ P IY HGS SP  YVYSPEA
Sbjct  157  P-AAPTFVRSPSHSPYHAGVPAYPSPPAIYGHGSRSPSPYVYSPEA  201



>gb|KDP40175.1| hypothetical protein JCGZ_02173 [Jatropha curcas]
Length=520

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 143/168 (85%), Gaps = 7/168 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLK FLKD+KKAA +ILEDP+ +GRAAHLAA+KE SA+RAV+KCIEEYKL
Sbjct  323  GLVDKFPPVPLLKKFLKDSKKAAASILEDPD-TGRAAHLAARKEQSALRAVIKCIEEYKL  381

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFPPE+LKKRL+QLEK K+E  K   AA PA KRTR SNGGPMPPAKAGR TNAYVSS
Sbjct  382  EAEFPPENLKKRLEQLEKAKTE--KKRPAAVPANKRTRASNGGPMPPAKAGRLTNAYVSS  439

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQ--YVYSPEAA  264
            FP A PTFVRSPSHTQYPTG+PAYP SP   +GS SPQ  Y YSPEAA
Sbjct  440  FP-APPTFVRSPSHTQYPTGVPAYP-SPAAVYGSRSPQSPYAYSPEAA  485



>ref|XP_011026525.1| PREDICTED: FRIGIDA-like protein 4a [Populus euphratica]
Length=521

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 143/168 (85%), Gaps = 6/168 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKAFLKDAKKAA ++LEDP N+GRAAHLAA+KE SA+RAV+KC+E+YKL
Sbjct  324  GLVDKFPPVPLLKAFLKDAKKAAASVLEDPENTGRAAHLAARKEQSALRAVIKCVEDYKL  383

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EA+FPPE+LKKRL+QLEK K+E  K   AA PA KRTR SNGGPMPPAKAGR TNAYVSS
Sbjct  384  EAQFPPENLKKRLEQLEKAKTE--KKRPAAVPANKRTRASNGGPMPPAKAGRLTNAYVSS  441

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP--QYVYSPEAA  264
            FP A PTFVRSPSHTQYPTG+PAYP SP   +GS SP   Y YSPEAA
Sbjct  442  FP-APPTFVRSPSHTQYPTGVPAYP-SPPAVYGSRSPPSPYAYSPEAA  487



>gb|EYU45654.1| hypothetical protein MIMGU_mgv1a004401mg [Erythranthe guttata]
Length=529

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 141/166 (85%), Gaps = 6/166 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL ++FPPV +LKAFLKDAKKAAT+I+EDPNNSGRAAH+AAKKE SAIRAVL+CIEEYKL
Sbjct  331  GLADRFPPVPMLKAFLKDAKKAATSIMEDPNNSGRAAHMAAKKEQSAIRAVLRCIEEYKL  390

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E +FP ++LKKRL +LEK K E       A+PAAKRTR SNGGPMPPAKAGRSTNAYVSS
Sbjct  391  ENDFPSDNLKKRLSELEKVKIE---KKKPASPAAKRTRASNGGPMPPAKAGRSTNAYVSS  447

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASP-IYTHGSMSPQYVYSPEA  267
            FP + PT++RSPSHTQYP+ + AYPA P +Y HGS SP YVYSPEA
Sbjct  448  FP-SPPTYMRSPSHTQYPSAV-AYPAMPAVYAHGSRSPSYVYSPEA  491



>gb|AEK20760.1| FRIGIDA [Coffea arabica]
Length=532

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 140/166 (84%), Gaps = 5/166 (3%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L+++FPPV LLKAFLKDAKK AT+ILEDPNN+GRAAH+AAKKE SAIRAV+KCIEEYKLE
Sbjct  343  LVDEFPPVPLLKAFLKDAKKLATSILEDPNNTGRAAHMAAKKEQSAIRAVIKCIEEYKLE  402

Query  578  AEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSF  399
            AEFPPE+LKKRL+QLEKTK+E  K      PA KRTR SNG  +PPAKAGR TNAYVSSF
Sbjct  403  AEFPPENLKKRLEQLEKTKTE--KRKPVVVPANKRTRASNGEHVPPAKAGRLTNAYVSSF  460

Query  398  PAAAPTFVRSPSHTQYPTGLPAYPASP-IYTHGSMSPQ-YVYSPEA  267
            P AAPTFVRSPSH+ Y  G+PAYP+ P IY HGS SP  YVYSPEA
Sbjct  461  P-AAPTFVRSPSHSPYHAGVPAYPSPPAIYGHGSRSPSPYVYSPEA  505



>ref|XP_002311627.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE88994.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=521

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 142/168 (85%), Gaps = 6/168 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKAFLKDAKKAA ++LEDP N+GRAAHLAA+KE SA+RAV+KC+E+YKL
Sbjct  324  GLVDKFPPVPLLKAFLKDAKKAAASVLEDPENTGRAAHLAARKEQSALRAVIKCVEDYKL  383

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E+ FPPE+LKKRL+QLEK K+E  K   AA PA KRTR SNGGPMPPAKAGR TNAYVSS
Sbjct  384  ESRFPPENLKKRLEQLEKAKTE--KKRPAAVPANKRTRASNGGPMPPAKAGRLTNAYVSS  441

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP--QYVYSPEAA  264
            FP A PTFVRSPSHTQYPTG+PAYP SP   +GS SP   Y YSPEAA
Sbjct  442  FP-APPTFVRSPSHTQYPTGVPAYP-SPPAVYGSRSPPSPYAYSPEAA  487



>ref|XP_007034760.1| FRIGIDA-like protein isoform 1 [Theobroma cacao]
 gb|EOY05686.1| FRIGIDA-like protein isoform 1 [Theobroma cacao]
Length=520

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 143/169 (85%), Gaps = 7/169 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKAFL+DAKKAA++ILEDP+N+GRAA LAA+KE SA+RAV+KCIEEYKL
Sbjct  321  GLVDKFPPVPLLKAFLRDAKKAASSILEDPSNAGRAAQLAARKEQSALRAVIKCIEEYKL  380

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFPPE+LKKRL+QLEKTK+E  K  AAA PA KRTR SNGGPMPPAKAGR  NAYVSS
Sbjct  381  EAEFPPENLKKRLEQLEKTKTE--KRKAAAVPANKRTRASNGGPMPPAKAGRLMNAYVSS  438

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP---QYVYSPEAA  264
            FP A PTFVRSPSHTQYP  +PAYP SP   +GS SP    Y YSPEAA
Sbjct  439  FP-APPTFVRSPSHTQYPAAVPAYP-SPPAMYGSRSPPTNPYAYSPEAA  485



>ref|XP_002282465.1| PREDICTED: FRIGIDA-like protein 4a [Vitis vinifera]
Length=522

 Score =   196 bits (498),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 143/173 (83%), Gaps = 11/173 (6%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKAFL+D+KKAAT+ILEDPNNSGRA +LA +KE SA+RAV+KCIEEYKL
Sbjct  321  GLVDKFPPVPLLKAFLRDSKKAATSILEDPNNSGRAVNLAGRKEQSALRAVIKCIEEYKL  380

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFPPE+LKKRL+QLEK K++  K   AA PA KRTR SNGGPMPPAKAGR TNAYVSS
Sbjct  381  EAEFPPENLKKRLEQLEKAKTD--KKRPAAVPANKRTRASNGGPMPPAKAGRLTNAYVSS  438

Query  401  FPAAAPTFVRSPSHTQYPTGLPAY----PASPIYTHGSMSP---QYVYSPEAA  264
            FP AAPTF+RSPSHTQYP  +PAY    PA+P   +GS SP    Y YSPEAA
Sbjct  439  FP-AAPTFIRSPSHTQYPAAVPAYPYDRPAAPA-MYGSRSPPANPYAYSPEAA  489



>emb|CAN69766.1| hypothetical protein VITISV_022061 [Vitis vinifera]
Length=524

 Score =   196 bits (498),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 143/173 (83%), Gaps = 11/173 (6%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKAFL+D+KKAAT+ILEDPNNSGRA +LA +KE SA+RAV+KCIEEYKL
Sbjct  321  GLVDKFPPVPLLKAFLRDSKKAATSILEDPNNSGRAVNLAGRKEQSALRAVIKCIEEYKL  380

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFPPE+LKKRL+QLEK K++  K   AA PA KRTR SNGGPMPPAKAGR TNAYVSS
Sbjct  381  EAEFPPENLKKRLEQLEKAKTD--KKRPAAVPANKRTRASNGGPMPPAKAGRLTNAYVSS  438

Query  401  FPAAAPTFVRSPSHTQYPTGLPAY----PASPIYTHGSMSP---QYVYSPEAA  264
            FP AAPTF+RSPSHTQYP  +PAY    PA+P   +GS SP    Y YSPEAA
Sbjct  439  FP-AAPTFIRSPSHTQYPAAVPAYPYDRPAAPA-MYGSRSPPANPYAYSPEAA  489



>ref|XP_006360794.1| PREDICTED: FRIGIDA-like protein 4a-like [Solanum tuberosum]
Length=514

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 139/166 (84%), Gaps = 4/166 (2%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL +KFPPV LLKAFLKDAKKAA AILEDPNN GRAAH AAKKE SAIR+VLKCIEEYKL
Sbjct  324  GLAHKFPPVPLLKAFLKDAKKAAAAILEDPNNFGRAAHFAAKKEQSAIRSVLKCIEEYKL  383

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFPP++LKK+L+QLEK K+E  K   AA PA KRTR +NGGPMPPAKAGRSTNAYVSS
Sbjct  384  EAEFPPDNLKKQLEQLEKPKNE--KKRPAAVPANKRTRANNGGPMPPAKAGRSTNAYVSS  441

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYSPEAA  264
            FP  AP FVRSPSHTQYP  +PAY ASP   +GS SP Y YSPEAA
Sbjct  442  FP-VAPAFVRSPSHTQYPQAVPAY-ASPPAMYGSRSPPYPYSPEAA  485



>gb|KJB28346.1| hypothetical protein B456_005G042900 [Gossypium raimondii]
Length=830

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 143/169 (85%), Gaps = 6/169 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL+N+FPPV LLKAFLKDAKKAA++ILEDPNN+GRAA LAA+KE SA+RAV+KCIEEYKL
Sbjct  318  GLVNRFPPVPLLKAFLKDAKKAASSILEDPNNAGRAAQLAARKEQSALRAVMKCIEEYKL  377

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFPPE+LKKRL+QLEKTK+E  K   AA PA KRTR SNGGPMPPAKAGRSTNAYVSS
Sbjct  378  EAEFPPENLKKRLEQLEKTKTE--KRKPAAVPANKRTRASNGGPMPPAKAGRSTNAYVSS  435

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP---QYVYSPEAA  264
            F AA P+ VRSPSH QYP  +PAYP+ P   +G+ +P    Y+YSPEAA
Sbjct  436  F-AAPPSIVRSPSHPQYPAAVPAYPSPPPAMYGTQTPPTCPYMYSPEAA  483



>gb|KHG27689.1| Protein FRIGIDA -like protein [Gossypium arboreum]
Length=516

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 142/169 (84%), Gaps = 6/169 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL+++FPPV LLKAFLKDAKKAA++ILEDPNN+GRAA LAA+KE SA+RAV+KCIEEYKL
Sbjct  318  GLVDRFPPVPLLKAFLKDAKKAASSILEDPNNAGRAAQLAARKEQSALRAVMKCIEEYKL  377

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAE PPE+LKKRL+QLEKTK+E  K   +A PA KRTR SNGGPMPPAKAGRSTNAYVSS
Sbjct  378  EAELPPENLKKRLEQLEKTKTE--KRKPSAVPANKRTRASNGGPMPPAKAGRSTNAYVSS  435

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP---QYVYSPEAA  264
            F AA P+ VRSPSH QYP  +PAYP+ P   +G+ +P    Y+YSPEAA
Sbjct  436  F-AAPPSIVRSPSHPQYPAAVPAYPSPPPAIYGTQTPPTCPYMYSPEAA  483



>ref|XP_004247354.1| PREDICTED: FRIGIDA-like protein 4a [Solanum lycopersicum]
Length=514

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 138/166 (83%), Gaps = 4/166 (2%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL +KFPPV LLKAFLKDAKKAA AILEDPNN GRAAH A+KKE SAIR+VLKCIEEYKL
Sbjct  324  GLADKFPPVPLLKAFLKDAKKAAAAILEDPNNFGRAAHFASKKEQSAIRSVLKCIEEYKL  383

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFPPE+LKK+L+QLEK K+E  K   AA PA KRTR +NGGPMPPAKAGRSTNAYVSS
Sbjct  384  EAEFPPENLKKQLEQLEKPKNE--KKRPAAVPANKRTRANNGGPMPPAKAGRSTNAYVSS  441

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYSPEAA  264
            FP  AP FVRSP HTQYP  +PAY ASP   +G+ SP Y YSPEAA
Sbjct  442  FP-VAPAFVRSPPHTQYPQAVPAY-ASPPTIYGNRSPPYPYSPEAA  485



>gb|KHN15769.1| hypothetical protein glysoja_012561 [Glycine soja]
Length=243

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 135/173 (78%), Gaps = 9/173 (5%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL+ KFPPV LLK+FLKDAKK A +ILEDPNN+GRAA+LAA+KE SA+RAV+KCIEEYKL
Sbjct  38   GLVEKFPPVPLLKSFLKDAKKVAASILEDPNNAGRAAYLAARKEQSALRAVIKCIEEYKL  97

Query  581  EAEFPPEHLKKRLDQLEK---TKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAY  411
            E EFPPE+LKKRLDQLEK    K+EK+KP A  A    R   SNGGPMPPAKAGR TNAY
Sbjct  98   EDEFPPENLKKRLDQLEKVKTVKTEKRKPVAVPANKRTRASNSNGGPMPPAKAGRLTNAY  157

Query  410  VSSFPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMS----PQYVYSPEAA  264
            VSSFP AAPTFVRSPSH QYP  LP YP SP + +GS S    P   YSPE A
Sbjct  158  VSSFP-AAPTFVRSPSHGQYPAALPPYP-SPPHMYGSRSPPANPYAAYSPEPA  208



>gb|AFP97615.1| frigida-like protein [Medicago sativa]
Length=519

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 130/166 (78%), Gaps = 2/166 (1%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL+ KFPPV LLK++LKDAKK A +ILEDPNN+GRA +LAA+KE SA++AV+KCIEEY L
Sbjct  322  GLVEKFPPVPLLKSYLKDAKKVAASILEDPNNAGRAGYLAARKEQSALKAVIKCIEEYNL  381

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFP E LKKRL+QLEK K EK+K     A    R   SNGGPMPPAKAGR TNAYVSS
Sbjct  382  EAEFPAESLKKRLEQLEKVKPEKRKQIVVPANKRTRASNSNGGPMPPAKAGRLTNAYVSS  441

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYSPEAA  264
            FP AAPTFVRSPSH QYP  LP YP SP + +GS SP Y YSPE A
Sbjct  442  FP-AAPTFVRSPSHGQYPAALPPYP-SPPHMYGSRSPSYAYSPEPA  485



>gb|KEH43877.1| frigida-LIKE protein [Medicago truncatula]
Length=519

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 131/166 (79%), Gaps = 2/166 (1%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLK++LKDAKK A +ILEDPNN+GRA +LAA+KE SA++AV+KCIEEY L
Sbjct  322  GLVDKFPPVPLLKSYLKDAKKVAASILEDPNNAGRAGYLAARKEQSALKAVIKCIEEYNL  381

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFP E LKKRL+QLEK K EK+K     A    R   SNGGPMPPAKAGR TNAYVSS
Sbjct  382  EAEFPAESLKKRLEQLEKVKPEKRKQIVVPANKRTRASNSNGGPMPPAKAGRLTNAYVSS  441

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYSPEAA  264
            FPAA+ TFVRSPSH QYP  LP YP SP + +GS SP Y YSPE A
Sbjct  442  FPAAS-TFVRSPSHGQYPAALPLYP-SPPHMYGSRSPSYAYSPEPA  485



>ref|XP_003556050.1| PREDICTED: FRIGIDA-like protein 4a-like [Glycine max]
Length=524

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 134/170 (79%), Gaps = 6/170 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL+ KFPPV LLK+FLKDAKK A +ILEDPNN+GRAA+LAA+KE SA+RAV+KCIEEYKL
Sbjct  322  GLVEKFPPVPLLKSFLKDAKKVAASILEDPNNAGRAAYLAARKEQSALRAVIKCIEEYKL  381

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPPE+LKKRLDQLEK K+EK+KP A  A    R    NGGPMPPAKAGR TNAYVSS
Sbjct  382  EDEFPPENLKKRLDQLEKVKTEKRKPVAVPANKRTRASNGNGGPMPPAKAGRLTNAYVSS  441

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMS----PQYVYSPEAA  264
            FP AAPTFVRSPSH QYP  LP YP SP + +GS S    P   YSPE A
Sbjct  442  FP-AAPTFVRSPSHGQYPAALPPYP-SPPHMYGSRSPPANPYAAYSPEPA  489



>ref|XP_010090919.1| hypothetical protein L484_004461 [Morus notabilis]
 gb|EXB41291.1| hypothetical protein L484_004461 [Morus notabilis]
Length=519

 Score =   187 bits (475),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 136/169 (80%), Gaps = 7/169 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKAFLKDAKKAA +ILEDPNN GR+ HLA +KE SA+RAV+KCIEEYKL
Sbjct  322  GLVDKFPPVPLLKAFLKDAKKAAASILEDPNNIGRSVHLAGRKEQSALRAVIKCIEEYKL  381

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFPPE+LKKRL+QLEK K+E  K    A PA KRTR +NGGPMPPAKAGR TNAYVSS
Sbjct  382  EAEFPPENLKKRLEQLEKGKTE--KRKPVAVPANKRTRANNGGPMPPAKAGRLTNAYVSS  439

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP---QYVYSPEAA  264
            FP AAPTFVRSPSH QYP  +P Y  SP   +GS SP    Y YSPEAA
Sbjct  440  FP-AAPTFVRSPSHAQYPAPVPPY-HSPPTMYGSRSPPTNPYAYSPEAA  486



>gb|ABM05952.1| proline-rich protein [Gossypium hirsutum]
Length=237

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 136/168 (81%), Gaps = 7/168 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLK+FL+DAKKAA++IL+DPNN+GRAA LAA+KE SA+RAV+KCIEEYKL
Sbjct  38   GLVDKFPPVPLLKSFLRDAKKAASSILDDPNNTGRAAQLAARKEQSALRAVIKCIEEYKL  97

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFPPE+LKKRL+QLEKTK+E  K      PA KRTRV+NGGPMPPAKAGR TNAYVSS
Sbjct  98   EAEFPPENLKKRLEQLEKTKTE--KRKPVVVPANKRTRVNNGGPMPPAKAGRLTNAYVSS  155

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP---QYVYSPEA  267
            FP A P FVRSPSHTQYP  +     SP   +GS SP    Y YSPEA
Sbjct  156  FP-APPPFVRSPSHTQYPAPV-PGYPSPPPMYGSRSPPTNPYAYSPEA  201



>gb|KJB38152.1| hypothetical protein B456_006G239300 [Gossypium raimondii]
Length=389

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 137/169 (81%), Gaps = 7/169 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLK+FL+DAKKAA++IL+DPNNSGRAA LAA+KE SA+RAV+KCIEEYKL
Sbjct  190  GLVDKFPPVPLLKSFLRDAKKAASSILDDPNNSGRAAQLAARKEQSALRAVIKCIEEYKL  249

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFPPE+LKKRL+QLEKTK+E  K      PA KRTRV+NGGPMPPAKAGR TNAYVSS
Sbjct  250  EAEFPPENLKKRLEQLEKTKTE--KRKPVVVPANKRTRVNNGGPMPPAKAGRLTNAYVSS  307

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP---QYVYSPEAA  264
            FP A P FVRSPSHTQYP  +     SP   +GS SP    Y YSPEAA
Sbjct  308  FP-APPPFVRSPSHTQYPAPV-PGYPSPPPMYGSRSPPTNPYAYSPEAA  354



>ref|XP_003536533.1| PREDICTED: FRIGIDA-like protein 4a-like [Glycine max]
Length=530

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 135/173 (78%), Gaps = 9/173 (5%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL+ KFPPV LLK+FLKDAKK A +ILEDPNN+GRAA+LAA+KE SA+RAV+KCIEEYKL
Sbjct  325  GLVEKFPPVPLLKSFLKDAKKVAASILEDPNNAGRAAYLAARKEQSALRAVIKCIEEYKL  384

Query  581  EAEFPPEHLKKRLDQLEK---TKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAY  411
            E EFPPE+LKKRLDQLEK    K+EK+KP A  A    R   SNGGPMPPAKAGR TNAY
Sbjct  385  EDEFPPENLKKRLDQLEKVKTVKTEKRKPVAVPANKRTRASNSNGGPMPPAKAGRLTNAY  444

Query  410  VSSFPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMS----PQYVYSPEAA  264
            VSSFP AAPTFVRSPSH QYP  LP YP SP + +GS S    P   YSPE A
Sbjct  445  VSSFP-AAPTFVRSPSHGQYPAALPPYP-SPPHMYGSRSPPTNPYAAYSPEPA  495



>ref|XP_007143260.1| hypothetical protein PHAVU_007G057500g [Phaseolus vulgaris]
 gb|ESW15254.1| hypothetical protein PHAVU_007G057500g [Phaseolus vulgaris]
Length=525

 Score =   185 bits (469),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 137/173 (79%), Gaps = 9/173 (5%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLK+FLKDAKK A +ILEDPNN+GRAA+LAA+KE SA+RAV+KCIEEYKL
Sbjct  321  GLVDKFPPVPLLKSFLKDAKKVAASILEDPNNAGRAAYLAARKEQSALRAVIKCIEEYKL  380

Query  581  EAEFPPEHLKKRLDQLEK---TKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAY  411
            EA+FPPE+LKKRL+QLEK    K+EK+KP A  A    R   SNGGPMPPAKAGR TNAY
Sbjct  381  EADFPPENLKKRLEQLEKVKTVKTEKRKPVAVPANKRTRASNSNGGPMPPAKAGRLTNAY  440

Query  410  VSSFPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMS----PQYVYSPEAA  264
            VSSFP AAPTFVRSPSH QYP  LP YP SP + +GS S    P   YSPE A
Sbjct  441  VSSFP-AAPTFVRSPSHGQYPAALPPYP-SPPHMYGSRSPPANPYAAYSPEPA  491



>gb|KJB38151.1| hypothetical protein B456_006G239300 [Gossypium raimondii]
Length=520

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 136/169 (80%), Gaps = 7/169 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLK+FL+DAKKAA++IL+DPNNSGRAA LAA+KE SA+RAV+KCIEEYKL
Sbjct  321  GLVDKFPPVPLLKSFLRDAKKAASSILDDPNNSGRAAQLAARKEQSALRAVIKCIEEYKL  380

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFPPE+LKKRL+QLEKTK+E  K      PA KRTRV+NGGPMPPAKAGR TNAYVSS
Sbjct  381  EAEFPPENLKKRLEQLEKTKTE--KRKPVVVPANKRTRVNNGGPMPPAKAGRLTNAYVSS  438

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP---QYVYSPEAA  264
            FPA  P FVRSPSHTQYP        SP   +GS SP    Y YSPEAA
Sbjct  439  FPAPPP-FVRSPSHTQYP-APVPGYPSPPPMYGSRSPPTNPYAYSPEAA  485



>ref|XP_007225712.1| hypothetical protein PRUPE_ppa004224mg [Prunus persica]
 gb|EMJ26911.1| hypothetical protein PRUPE_ppa004224mg [Prunus persica]
Length=522

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 135/169 (80%), Gaps = 6/169 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKAFLKDAKKAA +I+EDPNN+GRAA+LA +KE SA+RAV+KCIE+YKL
Sbjct  323  GLVHKFPPVPLLKAFLKDAKKAAASIMEDPNNAGRAANLAGRKEQSALRAVVKCIEDYKL  382

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFPPE+LKKRL+QLEK K E  K   AA PA KRTR +NGGPMPPAKAGR TNAYVSS
Sbjct  383  EAEFPPENLKKRLEQLEKVKPE--KKRPAAVPANKRTRANNGGPMPPAKAGRLTNAYVSS  440

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP---QYVYSPEAA  264
            FP   PTFVRSPSH QYP G   Y  SP   +GS SP    Y YSPEAA
Sbjct  441  FPTPPPTFVRSPSHAQYPAGYSPY-HSPPTMYGSRSPPTNPYAYSPEAA  488



>ref|XP_008340987.1| PREDICTED: FRIGIDA-like protein 4a [Malus domestica]
Length=521

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 131/168 (78%), Gaps = 5/168 (3%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKAFLKDAKKAA +ILEDPNN+GRAA+LA +KELSA+RAV+KCIE+Y L
Sbjct  323  GLVHKFPPVPLLKAFLKDAKKAAASILEDPNNAGRAANLAGRKELSALRAVVKCIEDYNL  382

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPPE+LKKRL+QLEK K E  K      PA KRTR +NGGPMPPAKAGR TNAYVSS
Sbjct  383  ETEFPPENLKKRLEQLEKVKPE--KKRPVVVPANKRTRANNGGPMPPAKAGRLTNAYVSS  440

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP--QYVYSPEAA  264
            FP   PTFV SPSH QYP G   Y  SP   +GS SP   Y YSPEAA
Sbjct  441  FPTTPPTFVMSPSHGQYPAGFSPY-HSPPTMYGSRSPPTPYAYSPEAA  487



>gb|KCW60755.1| hypothetical protein EUGRSUZ_H03480 [Eucalyptus grandis]
Length=477

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 136/169 (80%), Gaps = 6/169 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++ FPPV LLKAFLKDA+KAA  +LEDPNN GRAA+LA++KE SA+RAVLKCIEEYKL
Sbjct  277  GLVDMFPPVPLLKAFLKDARKAAATMLEDPNNGGRAANLASRKEQSALRAVLKCIEEYKL  336

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EA+FPPE+LKKRL+QLEK K + KK   AA PA KRTR +NGGPMPPAKAGR  NAYVSS
Sbjct  337  EAQFPPENLKKRLEQLEKVKID-KKRQPAAVPANKRTRANNGGPMPPAKAGRLANAYVSS  395

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP---QYVYSPEAA  264
            FP AAP +VRSPSH QYP G+P Y  SP   +G +SP    Y YSPEAA
Sbjct  396  FP-AAPAYVRSPSHGQYPAGVPTY-HSPQPMYGGLSPPTNPYAYSPEAA  442



>gb|KHG22505.1| Protein FRIGIDA -like protein [Gossypium arboreum]
Length=520

 Score =   182 bits (461),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 135/169 (80%), Gaps = 7/169 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLK+FL+DAKKAA++IL+DPNN+GRAA LAA+KE SA+RAV+KCIEEYKL
Sbjct  321  GLVDKFPPVPLLKSFLRDAKKAASSILDDPNNTGRAAQLAARKEQSALRAVIKCIEEYKL  380

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFPPE+LKKRL+QLEKTK+E  K      PA KRTRV+NGGPMPPAKAGR TNAYVSS
Sbjct  381  EAEFPPENLKKRLEQLEKTKTE--KRKPVVVPANKRTRVNNGGPMPPAKAGRLTNAYVSS  438

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP---QYVYSPEAA  264
            FPA  P FVRSPSHTQYP        SP   +GS SP    Y YSPEA 
Sbjct  439  FPAPPP-FVRSPSHTQYP-APVPGYPSPPPMYGSRSPPTNPYAYSPEAV  485



>gb|KCW60756.1| hypothetical protein EUGRSUZ_H03480 [Eucalyptus grandis]
Length=511

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 136/169 (80%), Gaps = 6/169 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++ FPPV LLKAFLKDA+KAA  +LEDPNN GRAA+LA++KE SA+RAVLKCIEEYKL
Sbjct  311  GLVDMFPPVPLLKAFLKDARKAAATMLEDPNNGGRAANLASRKEQSALRAVLKCIEEYKL  370

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EA+FPPE+LKKRL+QLEK K + KK   AA PA KRTR +NGGPMPPAKAGR  NAYVSS
Sbjct  371  EAQFPPENLKKRLEQLEKVKID-KKRQPAAVPANKRTRANNGGPMPPAKAGRLANAYVSS  429

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP---QYVYSPEAA  264
            FP AAP +VRSPSH QYP G+P Y  SP   +G +SP    Y YSPEAA
Sbjct  430  FP-AAPAYVRSPSHGQYPAGVPTY-HSPQPMYGGLSPPTNPYAYSPEAA  476



>ref|XP_010024304.1| PREDICTED: LOW QUALITY PROTEIN: FRIGIDA-like protein 4a [Eucalyptus 
grandis]
Length=530

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 136/169 (80%), Gaps = 6/169 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++ FPPV LLKAFLKDA+KAA  +LEDPNN GRAA+LA++KE SA+RAVLKCIEEYKL
Sbjct  330  GLVDMFPPVPLLKAFLKDARKAAATMLEDPNNGGRAANLASRKEQSALRAVLKCIEEYKL  389

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EA+FPPE+LKKRL+QLEK K + KK   AA PA KRTR +NGGPMPPAKAGR  NAYVSS
Sbjct  390  EAQFPPENLKKRLEQLEKVKID-KKRQPAAVPANKRTRANNGGPMPPAKAGRLANAYVSS  448

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP---QYVYSPEAA  264
            FP AAP +VRSPSH QYP G+P Y  SP   +G +SP    Y YSPEAA
Sbjct  449  FP-AAPAYVRSPSHGQYPAGVPTY-HSPQPMYGGLSPPTNPYAYSPEAA  495



>ref|XP_006414627.1| hypothetical protein EUTSA_v10024868mg [Eutrema salsugineum]
 gb|ESQ56080.1| hypothetical protein EUTSA_v10024868mg [Eutrema salsugineum]
Length=539

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 131/167 (78%), Gaps = 5/167 (3%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKA+L+DAKK+  +I EDPNN GR+AHL A+K+ SA+RAV+KCIEEYKL
Sbjct  330  GLVHKFPPVPLLKAYLRDAKKSTASITEDPNNPGRSAHLVARKKQSALRAVIKCIEEYKL  389

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPPE LKKRLDQLEKTK+E  K   A  PA KRTR S  GPMPPAKAGR TNAYVSS
Sbjct  390  EEEFPPEDLKKRLDQLEKTKTE--KRKPATIPANKRTRASYNGPMPPAKAGRITNAYVSS  447

Query  401  FPAAAPTFVRSPSHT-QYPTGLPAYPASPIYTHGSMSPQYVYSPEAA  264
            FP A PTF+RSPSH+ QY  G+PAY  SP   + + SP Y YSPEA 
Sbjct  448  FPPAPPTFIRSPSHSPQY--GVPAYTTSPPTIYSNRSPPYQYSPEAV  492



>ref|XP_004139882.1| PREDICTED: uncharacterized protein LOC101210012 [Cucumis sativus]
Length=510

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 136/169 (80%), Gaps = 7/169 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL +KFPPV LLKA+LKDAKKAA AI EDPNN+GRA HLAA+KE SA+RAV+KCIEEYKL
Sbjct  313  GLADKFPPVPLLKAYLKDAKKAAAAISEDPNNTGRAMHLAARKEQSALRAVIKCIEEYKL  372

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            +AEFPPE+LKKRL+QLEK K E  K   A  PA KRTR ++GGPMPPAKAGR TNAYVSS
Sbjct  373  QAEFPPENLKKRLEQLEKVKVE--KRKPAPVPANKRTRANSGGPMPPAKAGRLTNAYVSS  430

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP---QYVYSPEAA  264
            +P AAP FVRSPSH+QYP G+P Y  SP   +GS SP    Y YSPEAA
Sbjct  431  YP-AAPAFVRSPSHSQYPAGVPPY-HSPPSMYGSRSPPTNPYSYSPEAA  477



>gb|KGN44244.1| hypothetical protein Csa_7G234160 [Cucumis sativus]
Length=518

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 136/169 (80%), Gaps = 7/169 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL +KFPPV LLKA+LKDAKKAA AI EDPNN+GRA HLAA+KE SA+RAV+KCIEEYKL
Sbjct  321  GLADKFPPVPLLKAYLKDAKKAAAAISEDPNNTGRAMHLAARKEQSALRAVIKCIEEYKL  380

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            +AEFPPE+LKKRL+QLEK K E  K   A  PA KRTR ++GGPMPPAKAGR TNAYVSS
Sbjct  381  QAEFPPENLKKRLEQLEKVKVE--KRKPAPVPANKRTRANSGGPMPPAKAGRLTNAYVSS  438

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP---QYVYSPEAA  264
            +P AAP FVRSPSH+QYP G+P Y  SP   +GS SP    Y YSPEAA
Sbjct  439  YP-AAPAFVRSPSHSQYPAGVPPY-HSPPSMYGSRSPPTNPYSYSPEAA  485



>ref|XP_008447152.1| PREDICTED: FRIGIDA-like protein 4a [Cucumis melo]
Length=517

 Score =   179 bits (455),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 136/169 (80%), Gaps = 7/169 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            G+ +KFPPV LLKA+LKDAKKAA AI EDPNN+GRA HLAA+KE SA+RAV+KCIEEYKL
Sbjct  320  GIADKFPPVPLLKAYLKDAKKAAAAISEDPNNTGRAMHLAARKEQSALRAVIKCIEEYKL  379

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            +AEFPPE+LKKRL+QLEK K E  K   A  PA KRTR ++GGPMPPAKAGR TNAYVSS
Sbjct  380  QAEFPPENLKKRLEQLEKVKVE--KRKPAPVPANKRTRANSGGPMPPAKAGRLTNAYVSS  437

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP---QYVYSPEAA  264
            +P AAP FVRSPSH+QYP G+P Y  SP   +GS SP    Y YSPEAA
Sbjct  438  YP-AAPAFVRSPSHSQYPAGVPPY-HSPPSMYGSRSPPTNPYTYSPEAA  484



>ref|XP_010256039.1| PREDICTED: FRIGIDA-like protein 4a [Nelumbo nucifera]
Length=522

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 135/175 (77%), Gaps = 13/175 (7%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPP+ LLKA+LKD+KK A +ILED NN G+AAHLA +KE SA+RAV+KCIEEYKL
Sbjct  317  GLVDKFPPIPLLKAYLKDSKKVANSILEDRNNPGKAAHLAGRKEQSALRAVIKCIEEYKL  376

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E++FPPE L+KRL+QLEK K+E  K   AA PA KRTR SNGGPMPPAKAGR  NAYVSS
Sbjct  377  ESDFPPETLRKRLEQLEKAKTE--KKKPAAVPANKRTRASNGGPMPPAKAGRLANAYVSS  434

Query  401  FPAAAPTFVRSPSHTQYPTGLPAY----PASPIYTHGSMSP-----QYVYSPEAA  264
            FP AAPTFVRSPSH QYPTG+P Y     A+P   +GS SP      Y Y PE A
Sbjct  435  FP-AAPTFVRSPSHGQYPTGVPPYAYERSAAPT-MYGSRSPPAVRDHYGYPPEEA  487



>ref|XP_009610915.1| PREDICTED: FRIGIDA-like protein 4a [Nicotiana tomentosiformis]
Length=516

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 135/166 (81%), Gaps = 4/166 (2%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL ++FPPV LLKA+LKDAKKAATAILEDPNNSGRAAHLAAKKE SAIR+VLKCIEEYKL
Sbjct  318  GLADRFPPVPLLKAYLKDAKKAATAILEDPNNSGRAAHLAAKKEQSAIRSVLKCIEEYKL  377

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFPPE+LKK+L+Q EK K+E  K   AA PA KRTR SN GPMPPAKAGRSTNAYVSS
Sbjct  378  EAEFPPENLKKQLEQSEKPKNE--KKRPAAVPANKRTRASNVGPMPPAKAGRSTNAYVSS  435

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYSPEAA  264
            FP  AP FVRSPSHTQY        A+P   +G+ SP Y YSPEAA
Sbjct  436  FP-VAPAFVRSPSHTQY-PAAVPAYAAPPAIYGNRSPPYPYSPEAA  479



>ref|XP_009369844.1| PREDICTED: FRIGIDA-like protein 4a [Pyrus x bretschneideri]
Length=521

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 129/168 (77%), Gaps = 5/168 (3%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKAFLKDAKKAA +ILEDPNN+GRAA+LA +KELSA+RAV+KCIE+Y L
Sbjct  323  GLVHKFPPVPLLKAFLKDAKKAAASILEDPNNAGRAANLAGRKELSALRAVVKCIEDYNL  382

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPPE+LKKRL+QLEK K E  K      PA KRTR +NGGPMPPAKAGR  NAYVSS
Sbjct  383  ETEFPPENLKKRLEQLEKVKPE--KKRPVVVPANKRTRANNGGPMPPAKAGRLMNAYVSS  440

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP--QYVYSPEAA  264
             P   PTFV SPSH QYP G   Y  SP   +GS SP   Y YSPEAA
Sbjct  441  VPTPPPTFVMSPSHGQYPAGFSPY-HSPPTMYGSRSPPTPYAYSPEAA  487



>ref|XP_009784382.1| PREDICTED: FRIGIDA-like protein 4a [Nicotiana sylvestris]
Length=516

 Score =   176 bits (447),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 136/166 (82%), Gaps = 4/166 (2%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL ++FPPV LLKA+LKDAKKAATAILEDPNNSGR+AHLAAKKE SAIR+VLKCIEEYKL
Sbjct  318  GLADRFPPVPLLKAYLKDAKKAATAILEDPNNSGRSAHLAAKKEQSAIRSVLKCIEEYKL  377

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFPPE+LKK+L+Q EK K+E  K   AA PA KRTR SN GPMPPAKAGRSTNAYVSS
Sbjct  378  EAEFPPENLKKQLEQSEKPKNE--KKRPAAVPANKRTRASNVGPMPPAKAGRSTNAYVSS  435

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYSPEAA  264
            FP  AP FVRSPSHTQYP       A+P   +G+ SP Y YSPEAA
Sbjct  436  FP-VAPAFVRSPSHTQYPAA-VPAYAAPPAIYGNRSPPYPYSPEAA  479



>ref|XP_004159038.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101210012 
[Cucumis sativus]
Length=518

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 135/169 (80%), Gaps = 7/169 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL +K PPV LLKA+LKDAKKAA AI EDPNN+GRA HLAA+KE SA+RAV+KCIEEYKL
Sbjct  321  GLADKXPPVPLLKAYLKDAKKAAAAISEDPNNTGRAMHLAARKEQSALRAVIKCIEEYKL  380

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            +AEFPPE+LKKRL+QLEK K E  K   A  PA KRTR ++GGPMPPAKAGR TNAYVSS
Sbjct  381  QAEFPPENLKKRLEQLEKVKVE--KRKPAPVPANKRTRANSGGPMPPAKAGRLTNAYVSS  438

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP---QYVYSPEAA  264
            +P AAP FVRSPSH+QYP G+P Y  SP   +GS SP    Y YSPEAA
Sbjct  439  YP-AAPAFVRSPSHSQYPAGVPPY-HSPPSMYGSRSPPTNPYSYSPEAA  485



>ref|XP_010449973.1| PREDICTED: FRIGIDA-like protein 4b [Camelina sativa]
Length=544

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 129/167 (77%), Gaps = 5/167 (3%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKA+L+DAKKA   I ED NN GR+AHL A+KE SA+RAVLKCIEEYKL
Sbjct  336  GLVHKFPPVPLLKAYLRDAKKATALITEDSNNPGRSAHLVARKEQSALRAVLKCIEEYKL  395

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPPE+LKKRLDQLEKTK+E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSS
Sbjct  396  EEEFPPENLKKRLDQLEKTKTE--KRKPAAIPANKRTRASYNGPMPPAKAGRITNAYVSS  453

Query  401  FPAAAPTFVRSPSHT-QYPTGLPAYPASPIYTHGSMSPQYVYSPEAA  264
            FP   PTF+RSPSH+ QY  G+PAY  SP   + + SP Y YSPE  
Sbjct  454  FPPPPPTFIRSPSHSPQY--GVPAYTTSPPTIYNNRSPPYQYSPEVV  498



>ref|XP_008390891.1| PREDICTED: FRIGIDA-like protein 4a [Malus domestica]
Length=522

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 127/164 (77%), Gaps = 6/164 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKAFLKDAKKAA +ILEDPNN+GRAA+LA +KELSA+RAV+KCIE+Y L
Sbjct  323  GLVHKFPPVPLLKAFLKDAKKAAASILEDPNNAGRAANLAGRKELSAVRAVIKCIEDYNL  382

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFPPE LKKRL+QLEK K E  K      PA KR R +NGGPMPPAKAGR TNAYVSS
Sbjct  383  EAEFPPEDLKKRLEQLEKVKPE--KKRPVVVPANKRVRANNGGPMPPAKAGRLTNAYVSS  440

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP--QYVYS  276
            FP   PTFVRSPSH QYP G   Y  SP   +GS SP   Y YS
Sbjct  441  FP-TPPTFVRSPSHGQYPAGFSPY-HSPPTMYGSRSPPTPYAYS  482



>gb|KFK43732.1| hypothetical protein AALP_AA1G165500 [Arabis alpina]
Length=531

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 126/166 (76%), Gaps = 5/166 (3%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL+ KFPPV LLKA+L+DAKKA   I ED NN GR AHL A+KE +A+RAVL+CIEEYKL
Sbjct  323  GLVQKFPPVPLLKAYLRDAKKATVLITEDSNNPGRVAHLVARKEQAALRAVLRCIEEYKL  382

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPPE+LKKRLDQLEKTK+E  K   A  PA KRTR S  GPMPPAKAGR  NAYVSS
Sbjct  383  EEEFPPENLKKRLDQLEKTKTE--KRKPATIPANKRTRASYNGPMPPAKAGRIANAYVSS  440

Query  401  FPAAAPTFVRSPSHT-QYPTGLPAYPASPIYTHGSMSPQYVYSPEA  267
            FP + PTF+ SPSH+ QY  GLPAY  SP   + + SP Y YSPEA
Sbjct  441  FPPSPPTFITSPSHSPQY--GLPAYTPSPPTIYSNRSPPYQYSPEA  484



>ref|XP_010695287.1| PREDICTED: FRIGIDA-like protein 4a [Beta vulgaris subsp. vulgaris]
Length=524

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 130/164 (79%), Gaps = 5/164 (3%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL+ KFPPV LLK+FLKDA+KAA AILEDPN+ GRAAHLA +KE SA+RAVLKCIEEYKL
Sbjct  326  GLVGKFPPVPLLKSFLKDARKAAAAILEDPNHGGRAAHLANRKEQSALRAVLKCIEEYKL  385

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFP E++KKRL+QLEK K++  K  +A  PA KRTRV N GPMPPAKAGRSTNAYVSS
Sbjct  386  EDEFPQENIKKRLEQLEKNKTD--KKKSAPIPANKRTRVCNNGPMPPAKAGRSTNAYVSS  443

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPAS-PIYT-HGSMSPQYVYS  276
            F A AP +VRSPSH QYP G+  YP   P +  +GS SP Y YS
Sbjct  444  F-APAPAYVRSPSHPQYPAGVAPYPYDRPAHVMYGSSSPPYHYS  486



>gb|AAL31182.1| AT4g14900/dl3490c [Arabidopsis thaliana]
Length=505

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 128/167 (77%), Gaps = 5/167 (3%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++ FPPV LLKA+L+DAKKA   I +D NNSGR+AHL A+KE SA+RAVLKCIEEYKL
Sbjct  298  GLVHLFPPVPLLKAYLRDAKKATALITDDSNNSGRSAHLVARKEQSALRAVLKCIEEYKL  357

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPPE+LKKRLDQLEKTK+E  K   A  PA KRTR S  GPMPPAKAGR TNAYVSS
Sbjct  358  EEEFPPENLKKRLDQLEKTKTE--KRKPAVIPANKRTRASYSGPMPPAKAGRITNAYVSS  415

Query  401  FPAAAPTFVRSPSHT-QYPTGLPAYPASPIYTHGSMSPQYVYSPEAA  264
            FP   PTF+RS SH+ QY  G+PAY  SP   + + SP Y YSPEA 
Sbjct  416  FPPPPPTFIRSQSHSPQY--GVPAYTTSPPTIYSNRSPPYQYSPEAV  460



>ref|NP_567447.1| FRIGIDA-like protein [Arabidopsis thaliana]
 sp|Q940H8.1|FRL4B_ARATH RecName: Full=FRIGIDA-like protein 4b [Arabidopsis thaliana]
 gb|AAK96809.1| hydroxyproline-rich glycoprotein homolog [Arabidopsis thaliana]
 gb|AAM10105.1| hydroxyproline-rich glycoprotein homolog [Arabidopsis thaliana]
 gb|AAM63474.1| hydroxyproline-rich glycoprotein-like protein [Arabidopsis thaliana]
 gb|AEE83517.1| FRIGIDA-like protein [Arabidopsis thaliana]
Length=532

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 128/167 (77%), Gaps = 5/167 (3%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++ FPPV LLKA+L+DAKKA   I +D NNSGR+AHL A+KE SA+RAVLKCIEEYKL
Sbjct  325  GLVHLFPPVPLLKAYLRDAKKATALITDDSNNSGRSAHLVARKEQSALRAVLKCIEEYKL  384

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPPE+LKKRLDQLEKTK+E  K   A  PA KRTR S  GPMPPAKAGR TNAYVSS
Sbjct  385  EEEFPPENLKKRLDQLEKTKTE--KRKPAVIPANKRTRASYSGPMPPAKAGRITNAYVSS  442

Query  401  FPAAAPTFVRSPSHT-QYPTGLPAYPASPIYTHGSMSPQYVYSPEAA  264
            FP   PTF+RS SH+ QY  G+PAY  SP   + + SP Y YSPEA 
Sbjct  443  FPPPPPTFIRSQSHSPQY--GVPAYTTSPPTIYSNRSPPYQYSPEAV  487



>ref|XP_010435051.1| PREDICTED: FRIGIDA-like protein 4b [Camelina sativa]
Length=548

 Score =   171 bits (434),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 130/168 (77%), Gaps = 6/168 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKA+L+DAKKA   I ED NN GR+AHL A+KE SA+RAVLKCIEEYKL
Sbjct  339  GLVHKFPPVPLLKAYLRDAKKATALITEDSNNPGRSAHLVARKEQSALRAVLKCIEEYKL  398

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPPE+LKKRLDQLEKTK+E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSS
Sbjct  399  EEEFPPENLKKRLDQLEKTKTE--KRKPAAIPANKRTRASYNGPMPPAKAGRITNAYVSS  456

Query  401  FPAAAPTFVRSPSHT-QYPTGLP-AYPASPIYTHGSMSPQYVYSPEAA  264
            FP   PTF+RSPSH+ QY  G+P AY  SP   + + SP Y YSPEA 
Sbjct  457  FPPPPPTFIRSPSHSPQY--GVPAAYTTSPPTIYNNRSPPYQYSPEAV  502



>ref|XP_006283490.1| hypothetical protein CARUB_v10004542mg [Capsella rubella]
 gb|EOA16388.1| hypothetical protein CARUB_v10004542mg [Capsella rubella]
Length=540

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 129/167 (77%), Gaps = 5/167 (3%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKA+L+DAKKA   I ED NN GR+AHL A+KE SA+RAVLKCIEEYKL
Sbjct  331  GLVHKFPPVPLLKAYLRDAKKATALITEDSNNPGRSAHLVARKEQSALRAVLKCIEEYKL  390

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPPE+LKKRLDQLEKTK+E  K   A  PA KRTR S  GPMPPAKAGR TNAYVSS
Sbjct  391  EEEFPPENLKKRLDQLEKTKTE--KRKPAVVPANKRTRASYNGPMPPAKAGRITNAYVSS  448

Query  401  FPAAAPTFVRSPSHT-QYPTGLPAYPASPIYTHGSMSPQYVYSPEAA  264
            FP   PTF++SPS++ QY  G+PAY  SP   + + SP Y YSPEA 
Sbjct  449  FPPPPPTFIKSPSYSPQY--GVPAYTPSPPTIYNNRSPPYQYSPEAV  493



>ref|XP_010440374.1| PREDICTED: FRIGIDA-like protein 4b [Camelina sativa]
Length=549

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 129/168 (77%), Gaps = 6/168 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKA+L+DAKKA   I ED NN GR+AHL A+KE SA+RAVLKCIEEYKL
Sbjct  340  GLVHKFPPVPLLKAYLRDAKKATALITEDSNNPGRSAHLVARKEQSALRAVLKCIEEYKL  399

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPPE+LKKRLDQLEKTK+E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSS
Sbjct  400  EEEFPPENLKKRLDQLEKTKTE--KRKPAAIPANKRTRASYNGPMPPAKAGRITNAYVSS  457

Query  401  FPAAAPTFVRSPSHT-QYPTGLP-AYPASPIYTHGSMSPQYVYSPEAA  264
            FP   PTF+RSPSH+ QY  G+P AY  SP   + + SP Y YSPE  
Sbjct  458  FPPPPPTFIRSPSHSPQY--GVPAAYTTSPPTIYNNRSPPYQYSPEVV  503



>ref|XP_002868244.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH44503.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=532

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 128/167 (77%), Gaps = 5/167 (3%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKA+L+DAKKA   I ED NN GR+AHL  +KE SA+RAVLKCIEEYKL
Sbjct  325  GLVHKFPPVPLLKAYLRDAKKATALITEDSNNPGRSAHLVGRKEQSALRAVLKCIEEYKL  384

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPP++LKKRLDQLEKTK+E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSS
Sbjct  385  EEEFPPDNLKKRLDQLEKTKTE--KRKPAAIPANKRTRASYNGPMPPAKAGRITNAYVSS  442

Query  401  FPAAAPTFVRSPSHT-QYPTGLPAYPASPIYTHGSMSPQYVYSPEAA  264
            FP   PTF+RSPSH+ QY   +P+Y  SP   + + SP Y YSPEA 
Sbjct  443  FPPPPPTFIRSPSHSPQY--AVPSYTTSPPTIYSNRSPPYQYSPEAV  487



>gb|AGV54404.1| frigida protein [Phaseolus vulgaris]
Length=525

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 113/148 (76%), Gaps = 9/148 (6%)
 Frame = -1

Query  686  ILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEK---TKSE  516
            ILEDPNN+GRAA+LAA+KE SA+RAV+KCIEEYKLEA+FPPE+LKKRL+QLEK    K+E
Sbjct  346  ILEDPNNAGRAAYLAARKEQSALRAVIKCIEEYKLEADFPPENLKKRLEQLEKVKTVKTE  405

Query  515  kkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLP  336
            K+KP A  A    R   SNGGPMPPAKAGR TNAYVSSFP AAPTFVR PSH QYP  L 
Sbjct  406  KRKPVAVPANKRTRASNSNGGPMPPAKAGRLTNAYVSSFP-AAPTFVRFPSHGQYPAALS  464

Query  335  AYPASPIYTHGSMS----PQYVYSPEAA  264
             +P SP + +GS S    P   YSPE A
Sbjct  465  PHP-SPPHMYGSRSPPANPYAAYSPEPA  491



>ref|XP_010488272.1| PREDICTED: FRIGIDA-like protein 4a [Camelina sativa]
Length=539

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 126/164 (77%), Gaps = 7/164 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKA+L+DAKK+A +I+ED +N+GRA HL A+KE SA++AVLKCIEEYKL
Sbjct  327  GLVDKFPPVPLLKAYLRDAKKSAASIMEDSSNTGRATHLVARKEQSALKAVLKCIEEYKL  386

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPPE+LKKRLDQLEKTK+E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSS
Sbjct  387  EEEFPPENLKKRLDQLEKTKTE--KRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSS  444

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYSPE  270
            FP     F+RSPSH+       AYP+ P   + + SP Y YSPE
Sbjct  445  FP-----FIRSPSHSPQYASPAAYPSPPTTVYSNRSPPYPYSPE  483



>gb|KFK39537.1| hypothetical protein AALP_AA3G257000 [Arabis alpina]
Length=529

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 126/164 (77%), Gaps = 7/164 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKA+L+DAKKAA +I+ED +N+GRA H+ A+KE SA+RAVLKCIEEYKL
Sbjct  323  GLVDKFPPVPLLKAYLRDAKKAAASIMEDSSNNGRATHIVARKEQSALRAVLKCIEEYKL  382

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPPE+LKKRLDQLEKTK+E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSS
Sbjct  383  EEEFPPENLKKRLDQLEKTKTE--KRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSS  440

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYSPE  270
            FP     F+RSPSH+       AYP+ P   + + SP Y YSPE
Sbjct  441  FP-----FIRSPSHSPQYASPAAYPSPPTTVYSNRSPPYPYSPE  479



>ref|NP_566709.1| FRIGIDA-like protein [Arabidopsis thaliana]
 sp|Q9LUV4.1|FRL4A_ARATH RecName: Full=FRIGIDA-like protein 4a [Arabidopsis thaliana]
 dbj|BAB01784.1| hydroxyproline-rich glycoprotein [Arabidopsis thaliana]
 gb|AAK92705.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20275.1| putative hydroxyproline-rich glycoprotein [Arabidopsis thaliana]
 gb|AAM61695.1| hydroxyproline-rich glycoprotein-like protein [Arabidopsis thaliana]
 gb|AEE76640.1| FRIGIDA-like protein [Arabidopsis thaliana]
Length=532

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 126/164 (77%), Gaps = 7/164 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKA+L+DAKK+A +I+ED +N+GRA HL A+KE SA++AVLKCIEEYKL
Sbjct  327  GLVDKFPPVPLLKAYLRDAKKSAASIMEDSSNTGRATHLVARKEQSALKAVLKCIEEYKL  386

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPPE+LKKRLDQLEKTK+E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSS
Sbjct  387  EEEFPPENLKKRLDQLEKTKTE--KRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSS  444

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYSPE  270
            FP     F+RSPSH+       AYP+ P   + + SP Y YSPE
Sbjct  445  FP-----FIRSPSHSPQYASPAAYPSPPTTVYSNRSPPYPYSPE  483



>ref|XP_010511354.1| PREDICTED: FRIGIDA-like protein 4a [Camelina sativa]
Length=530

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 126/164 (77%), Gaps = 7/164 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKA+L+DAKK+A +I+ED +++GRA HL A+KE SA++AVLKCIEEYKL
Sbjct  325  GLVDKFPPVPLLKAYLRDAKKSAASIMEDSSSTGRATHLVARKEQSALKAVLKCIEEYKL  384

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPPE+LKKRLDQLEKTK+E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSS
Sbjct  385  EEEFPPENLKKRLDQLEKTKTE--KRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSS  442

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYSPE  270
            FP     F+RSPSH+       AYP+ P   + + SP Y YSPE
Sbjct  443  FP-----FIRSPSHSPQYASPAAYPSPPTTVYSNRSPAYPYSPE  481



>ref|XP_010551726.1| PREDICTED: FRIGIDA-like protein 4a [Tarenaya hassleriana]
Length=525

 Score =   163 bits (412),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 126/166 (76%), Gaps = 11/166 (7%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL +KFP V LLKA+L+DAKKAA +I+EDP+N GR+ HLA +KE SAIRAVLKCIEEYKL
Sbjct  334  GLSDKFPLVSLLKAYLRDAKKAAASIVEDPSNPGRSVHLAVRKEQSAIRAVLKCIEEYKL  393

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E +FPPE+LKKRLDQLEK K+E  K   A+ PA KRTR S  GPMPPAKAGR TNAYVSS
Sbjct  394  EEKFPPENLKKRLDQLEKAKTE--KRKPASVPANKRTRASYNGPMPPAKAGRITNAYVSS  451

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYSPEAA  264
            FP A PTF+RS +H+      P YP  P  +H  MSP Y YSPEA 
Sbjct  452  FP-APPTFIRSLTHS------PQYPTPPYTSH--MSPPYQYSPEAG  488



>ref|XP_010525189.1| PREDICTED: FRIGIDA-like protein 4a [Tarenaya hassleriana]
Length=548

 Score =   163 bits (412),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 131/170 (77%), Gaps = 9/170 (5%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKA+L+DAKKAA +I+EDPNN GRAA LA +KE SA+RAVLKCIEEYKL
Sbjct  334  GLVDKFPPVPLLKAYLRDAKKAAASIMEDPNNPGRAAQLAVRKEQSALRAVLKCIEEYKL  393

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPPE+LKKRLDQLEK+K+E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSS
Sbjct  394  EEEFPPENLKKRLDQLEKSKTE--KRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSS  451

Query  401  FPAAAPTFVRSPSHT-QYPT---GLPAYPASPIYTHGSMSPQYVYSPEAA  264
            FP   PT++RSP+H+ QY +        P + +Y++G  SP Y YSPE  
Sbjct  452  FP-TPPTYIRSPTHSPQYASPPYASFPPPPTTVYSNG--SPPYPYSPEVG  498



>emb|CDY34252.1| BnaA01g24690D [Brassica napus]
Length=522

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 127/165 (77%), Gaps = 11/165 (7%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKA+L+DAKK    + EDP+N+GRA+HL A+KE SA++AVLKCIEEYKL
Sbjct  315  GLVDKFPPVPLLKAYLRDAKK---TVAEDPSNTGRASHLVARKEQSALKAVLKCIEEYKL  371

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPPE+LKKRL+QLEKTK+E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSS
Sbjct  372  EEEFPPENLKKRLEQLEKTKTE--KRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSS  429

Query  401  FPAAAPTFVRSPSHT-QYPTGLPAYPASPIYTHGSMSPQYVYSPE  270
            FP     F+RSPSH+ QY +   AYP+ P   + + SP Y YSPE
Sbjct  430  FP-----FIRSPSHSPQYASPAAAYPSPPTTVYSNRSPPYPYSPE  469



>ref|XP_006299103.1| hypothetical protein CARUB_v10015242mg [Capsella rubella]
 gb|EOA32001.1| hypothetical protein CARUB_v10015242mg [Capsella rubella]
Length=533

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 125/164 (76%), Gaps = 7/164 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKA+L+DAKKAA +++ED +N+ RA HL A+KE SA++AVLKCIEEYKL
Sbjct  328  GLVDKFPPVPLLKAYLRDAKKAAASMMEDSSNTSRATHLVARKEQSALKAVLKCIEEYKL  387

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPPE+LKKRLDQLEKTK+E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSS
Sbjct  388  EEEFPPENLKKRLDQLEKTKTE--KRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSS  445

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYSPE  270
            FP     F+RSPSH+       AYP+ P   + + SP Y YSPE
Sbjct  446  FP-----FIRSPSHSPQYASPAAYPSPPTTVYSNRSPPYPYSPE  484



>ref|XP_002883367.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59626.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=531

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 125/164 (76%), Gaps = 7/164 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKA+L+DAKK+A +I+E+ +N+GR  HL A+KE SA++AVLKCIEEYKL
Sbjct  326  GLVDKFPPVPLLKAYLRDAKKSAASIMEESSNTGRPTHLVARKEQSALKAVLKCIEEYKL  385

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPPE+LKKRLDQLEKTK+E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSS
Sbjct  386  EEEFPPENLKKRLDQLEKTKTE--KRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSS  443

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYSPE  270
            FP     F+RSPSH+       AYP+ P   + + SP Y YSPE
Sbjct  444  FP-----FIRSPSHSPQYASPAAYPSPPTTVYSNRSPPYPYSPE  482



>gb|AGV54236.1| hydroxyproline-rich glycoprotein [Phaseolus vulgaris]
Length=523

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 110/145 (76%), Gaps = 9/145 (6%)
 Frame = -1

Query  677  DPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEK---TKSEkkk  507
            DPN +GRAA+LAA+KE SA+RAV+KCIEEYKLEA+FPPE+LKKRL+QLEK    K+EK+K
Sbjct  347  DPNLAGRAAYLAARKEQSALRAVIKCIEEYKLEADFPPENLKKRLEQLEKVKTVKTEKRK  406

Query  506  paaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYP  327
            P A  A    R   SNGGPMPPAKAGR TNAYVSSFP AAPTFVRSPSH QYP  LP  P
Sbjct  407  PVAVPANKRTRASNSNGGPMPPAKAGRLTNAYVSSFP-AAPTFVRSPSHGQYPAALPPIP  465

Query  326  ASPIYTHGSMS----PQYVYSPEAA  264
             SP + +GS S    P   YSPE A
Sbjct  466  -SPPHMYGSRSPPANPYAAYSPEPA  489



>ref|XP_009108852.1| PREDICTED: FRIGIDA-like protein 4a [Brassica rapa]
Length=534

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 126/165 (76%), Gaps = 11/165 (7%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKA+L+DAKK    + ED +N+GRA+HL A+KE SA++AVLKCIEEYKL
Sbjct  327  GLVDKFPPVPLLKAYLRDAKK---TVAEDSSNTGRASHLVARKEQSALKAVLKCIEEYKL  383

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPPE+LKKRL+QLEKTK+E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSS
Sbjct  384  EEEFPPENLKKRLEQLEKTKTE--KRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSS  441

Query  401  FPAAAPTFVRSPSHT-QYPTGLPAYPASPIYTHGSMSPQYVYSPE  270
            FP     F+RSPSH+ QY +   AYP+ P   + + SP Y YSPE
Sbjct  442  FP-----FIRSPSHSPQYASPAAAYPSPPTTVYSNRSPPYPYSPE  481



>emb|CDY46317.1| BnaC01g31510D [Brassica napus]
Length=525

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 126/165 (76%), Gaps = 11/165 (7%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKA+L+DAKK    + ED +N+GRA+HL A+KE SA++AVLKCIEEYKL
Sbjct  318  GLVDKFPPVPLLKAYLRDAKK---TVAEDSSNTGRASHLVARKEQSALKAVLKCIEEYKL  374

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPPE+LKKRL+QLEKTK+E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSS
Sbjct  375  EEEFPPENLKKRLEQLEKTKTE--KRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSS  432

Query  401  FPAAAPTFVRSPSHT-QYPTGLPAYPASPIYTHGSMSPQYVYSPE  270
            FP     F+RSPSH+ QY +   AYP+ P   + + SP Y YSPE
Sbjct  433  FP-----FIRSPSHSPQYASPAAAYPSPPTTVYSNRSPPYPYSPE  472



>ref|XP_010466529.1| PREDICTED: FRIGIDA-like protein 4a [Camelina sativa]
Length=533

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 125/164 (76%), Gaps = 8/164 (5%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KF PV LLKA+L+DAKK+A +I+ED +N+GRA HL A+KE SA++AVLKCIEEYKL
Sbjct  327  GLVDKFRPVPLLKAYLRDAKKSAASIMEDSSNTGRATHLVARKEQSALKAVLKCIEEYKL  386

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E EFPPE+LKKRLDQLEKTK+E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSS
Sbjct  387  EEEFPPENLKKRLDQLEKTKTE--KRKPAAVPANKRTRASY-GPMPPAKAGRITNAYVSS  443

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYSPE  270
            FP     F+RSPSH+       AYP+ P   + + SP Y YSPE
Sbjct  444  FP-----FIRSPSHSPQYASPAAYPSPPTTVYSNRSPPYPYSPE  482



>ref|XP_010533277.1| PREDICTED: FRIGIDA-like protein 4a [Tarenaya hassleriana]
Length=539

 Score =   155 bits (391),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 126/168 (75%), Gaps = 6/168 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPN-NSGRAAHLAAKKELSAIRAVLKCIEEYK  585
            GL +KFPPV LLKA+L+DAKKAA +I+EDPN N GRA HLA +KE SA+RAV+KCIEEYK
Sbjct  334  GLTDKFPPVPLLKAYLRDAKKAAASIMEDPNSNPGRAPHLAVRKEQSALRAVVKCIEEYK  393

Query  584  LEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVS  405
            LE EFPPE+LKKRLDQLEK K+E  K   AA PA KRTR    GPMPPAKAGRSTNAYVS
Sbjct  394  LEEEFPPENLKKRLDQLEKAKTE--KRKPAAVPANKRTRAGYNGPMPPAKAGRSTNAYVS  451

Query  404  SFPAAAPTFVRSPSHT-QYPTGLPAYPASPIYTHGSMSPQYVYSPEAA  264
            SFP  +     SP+H+ QY T  P Y + P   + + SP Y YSPEAA
Sbjct  452  SFPPPSAYTRSSPTHSPQYAT--PPYASPPPSVYSNRSPPYPYSPEAA  497



>ref|XP_004299118.1| PREDICTED: FRIGIDA-like protein 4a [Fragaria vesca subsp. vesca]
Length=584

 Score =   155 bits (391),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 124/158 (78%), Gaps = 3/158 (2%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KF PV LLKAFL+DA+KAA +ILED N+ G+AA+LA +KE SA+RAV+KCIE+Y L
Sbjct  326  GLVHKFRPVPLLKAFLRDARKAAASILEDANSPGKAANLAGRKEQSALRAVIKCIEDYNL  385

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFPPE+LKKRL+QL++     +K    AAPA KRTR ++GGPMPPAKAGR  NAYVSS
Sbjct  386  EAEFPPENLKKRLEQLDQKVK-PEKKKPVAAPANKRTRANHGGPMPPAKAGRLANAYVSS  444

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQ  288
            FP + PTFVRSPSH QYP G   Y  SP   +GS SPQ
Sbjct  445  FP-SPPTFVRSPSHAQYPVGFSPY-HSPPTMYGSRSPQ  480



>ref|XP_010277260.1| PREDICTED: FRIGIDA-like protein 4a [Nelumbo nucifera]
Length=534

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 128/165 (78%), Gaps = 11/165 (7%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKA+L+D+KKAAT+ILED NN G+A +LA +KE SA+RAV+KCIEEYKL
Sbjct  317  GLVDKFPPVPLLKAYLRDSKKAATSILEDRNNPGKATYLAGRKEQSALRAVIKCIEEYKL  376

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFPPE L+KRL+QLEK K+  +K   A  PA KRTR SNGGPMPPAKAGR  NAYVSS
Sbjct  377  EAEFPPEPLRKRLEQLEKAKA--EKKKPAVIPANKRTRASNGGPMPPAKAGRLANAYVSS  434

Query  401  F--PAAAPTFVRSPSHTQYP--TGLPAY----PASPIYTHGSMSP  291
            F   AAAPTFVRSPSH  YP   G+P Y    PA P   +GS SP
Sbjct  435  FPAAAAAPTFVRSPSHGPYPAGAGVPPYAYDRPAPPA-IYGSRSP  478



>gb|EPS62727.1| hypothetical protein M569_12062, partial [Genlisea aurea]
Length=454

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 122/162 (75%), Gaps = 11/162 (7%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL+++FPPV LLKAFL DA+KAA +ILED NNSGRAAH+AAKKE SAIRAVLKCIEEYKL
Sbjct  295  GLVDRFPPVPLLKAFLNDARKAANSILEDQNNSGRAAHMAAKKEQSAIRAVLKCIEEYKL  354

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPM-PPAKAGRSTNAYVS  405
            E+EFP E+L+KRLD L+K K E       ++P AKRTR S GGPM PPAKA RS+NAYVS
Sbjct  355  ESEFPTENLRKRLDHLDKAKVE---KKKPSSPTAKRTRASIGGPMPPPAKAVRSSNAYVS  411

Query  404  SFPAAAPT-----FVRSPSHTQYPT--GLPAYPASPIYTHGS  300
            SFP+  P       + SPSHTQYP     P+ P  P+Y HG+
Sbjct  412  SFPSPPPPPPTTYIISSPSHTQYPVSAAYPSAPPPPVYGHGT  453



>ref|XP_008224458.1| PREDICTED: FRIGIDA-like protein 4a [Prunus mume]
Length=497

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 118/169 (70%), Gaps = 31/169 (18%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKAFLKDAKKAA +I+EDPNN+GRAA+LA +KE SA+RAV+KCIE+YKL
Sbjct  323  GLVHKFPPVPLLKAFLKDAKKAAASIMEDPNNAGRAANLAGRKEQSALRAVIKCIEDYKL  382

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            EAEFPPE+LKKRL+QLEK K E  K   AA PA KRTR +NGGPMPPAKAGR TNA    
Sbjct  383  EAEFPPENLKKRLEQLEKVKPE--KKRPAAVPANKRTRANNGGPMPPAKAGRLTNA----  436

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP---QYVYSPEAA  264
                      SP H            SP   +GS SP    Y YSPEAA
Sbjct  437  ----------SPYH------------SPPTMYGSRSPPTNPYAYSPEAA  463



>ref|XP_009389010.1| PREDICTED: FRIGIDA-like protein 4a [Musa acuminata subsp. malaccensis]
Length=528

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 117/162 (72%), Gaps = 9/162 (6%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL +KFPPV LLK+FLKD+KKA T+  +D NN G+ A+   +KE S IRA +KCI+E+KL
Sbjct  315  GLQDKFPPVPLLKSFLKDSKKA-TSTSDDRNNCGQTANNTCRKEQSVIRAAIKCIQEHKL  373

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRST-NAYVS  405
            EAEFP E L+KRL+QLEK K E KK  +   PA KRTR SNGGPMPPAKAGR T NA VS
Sbjct  374  EAEFPLEGLQKRLEQLEKAKVE-KKRPSGGGPANKRTRASNGGPMPPAKAGRLTSNACVS  432

Query  404  SFPAAAPTFVRSP-SHTQYPTGLPAYP-ASP--IYTHGSMSP  291
            SFP AAP FVRSP SH  YP   P YP  SP  +  +GS SP
Sbjct  433  SFP-AAPAFVRSPSSHATYPAAAP-YPYDSPAGLGVYGSRSP  472



>ref|XP_008796767.1| PREDICTED: FRIGIDA-like protein 4a [Phoenix dactylifera]
Length=538

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 106/134 (79%), Gaps = 3/134 (2%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL +KFPPV LLK+FLKD+KKA ++  ED NNSG+A +  ++KE SA+R+V+KCIE++KL
Sbjct  322  GLQDKFPPVPLLKSFLKDSKKATSSCSEDRNNSGQAVNNGSRKEQSALRSVMKCIEDHKL  381

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRST-NAYVS  405
            EAEFP E L+KRL+ LEK K E KK  +   PA KRTR +NGGPMPPAKAGR T NAYVS
Sbjct  382  EAEFPLEALQKRLENLEKAKVE-KKRPSGGGPANKRTRANNGGPMPPAKAGRLTNNAYVS  440

Query  404  SFPAAAPTFVRSPS  363
            SFPA   TFVRSPS
Sbjct  441  SFPATT-TFVRSPS  453



>ref|XP_010906476.1| PREDICTED: FRIGIDA-like protein 4a [Elaeis guineensis]
Length=541

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 105/134 (78%), Gaps = 3/134 (2%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL +KFPPV LLK+FLKD+KKA ++  ED NNSG+A +  ++KE SA+R+V+KCIE+ KL
Sbjct  325  GLQDKFPPVPLLKSFLKDSKKATSSSSEDRNNSGQAVNNGSRKEQSALRSVMKCIEDRKL  384

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRST-NAYVS  405
            EAEFP E L+KRL+ LEK K E KK  +   PA KRTR +NGGPMPPAKAGR T NAYVS
Sbjct  385  EAEFPLEGLQKRLENLEKAKVE-KKKPSGGGPANKRTRANNGGPMPPAKAGRLTNNAYVS  443

Query  404  SFPAAAPTFVRSPS  363
            SFPA   TFVRSPS
Sbjct  444  SFPATT-TFVRSPS  456



>ref|XP_009408489.1| PREDICTED: FRIGIDA-like protein 4a [Musa acuminata subsp. malaccensis]
Length=529

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 107/140 (76%), Gaps = 5/140 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL +KFPP+ LLK+FL+D+KKA T+  ED NN G+ A+   +KELS IRA +KCI+E+KL
Sbjct  315  GLQDKFPPIPLLKSFLEDSKKA-TSTSEDRNNYGQTANTTCRKELSVIRAAMKCIQEHKL  373

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRST-NAYVS  405
            EAEFP + L+KRL+ LEK K E KK  + A PA KRTR +NGGPMPPAKAGR T NA VS
Sbjct  374  EAEFPLDSLQKRLENLEKAKVE-KKKPSGAGPANKRTRANNGGPMPPAKAGRLTNNACVS  432

Query  404  SFPAAAPTFVRSPS-HTQYP  348
            SFP A P +VRSPS HT YP
Sbjct  433  SFP-AGPAYVRSPSAHTTYP  451



>ref|XP_009388157.1| PREDICTED: FRIGIDA-like protein 4a, partial [Musa acuminata subsp. 
malaccensis]
Length=233

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 108/156 (69%), Gaps = 6/156 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL +KF PV LLK+FLKD+ KA T+  ED N  G+  +   +KE S IRA +KCI+E+KL
Sbjct  19   GLQDKFTPVSLLKSFLKDSNKA-TSTFEDHNGGGQTTNYTCRKEQSIIRAAIKCIQEHKL  77

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaa--aapaaKRTRVSNGGPMPPAKAGRSTNAYV  408
            EAEFP E L+KRL+QLEK K EKKKP+    AAPA KRTR +NGGPMPPAKAGR TN   
Sbjct  78   EAEFPLESLQKRLEQLEKAKVEKKKPSGGGPAAPANKRTRANNGGPMPPAKAGRLTNNVH  137

Query  407  SSFPAAAPTFVRSPS-HTQYPTGLPAYPASPIYTHG  303
             S P AAP FVRSPS HT YP   P YP      HG
Sbjct  138  VSSP-AAPAFVRSPSAHTTYPAAAP-YPYDSPAGHG  171



>ref|XP_006406163.1| hypothetical protein EUTSA_v10020440mg [Eutrema salsugineum]
 gb|ESQ47616.1| hypothetical protein EUTSA_v10020440mg [Eutrema salsugineum]
Length=552

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKA+L+DAKK A +I+ED +N+GRA HL A+KE SA+RAVLKCIEEYKL
Sbjct  328  GLVDKFPPVPLLKAYLRDAKKTAASIMEDSSNTGRATHLVARKEQSALRAVLKCIEEYKL  387

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAK  435
            E +FPPE+LKKRLDQLEKTK+E  K   AA PA KRTR S  GPMPPAK
Sbjct  388  EEDFPPENLKKRLDQLEKTKTE--KRKPAAVPANKRTRASYNGPMPPAK  434



>ref|XP_008778905.1| PREDICTED: FRIGIDA-like protein 4a [Phoenix dactylifera]
Length=535

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 104/134 (78%), Gaps = 3/134 (2%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL +KFPPV LLK+FLKD+KK  ++  ED N+SG+A    ++KE SA+RAV+KCIE+ KL
Sbjct  319  GLQDKFPPVPLLKSFLKDSKKGTSSSSEDRNSSGQAVGNGSRKEQSALRAVMKCIEDRKL  378

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRST-NAYVS  405
            EAEFP E L+KRL+ LEK K E KK  +   PA KRTR +NGGPMPPAKAGR T NAYVS
Sbjct  379  EAEFPLEGLQKRLENLEKAKVE-KKKPSGCGPANKRTRANNGGPMPPAKAGRLTNNAYVS  437

Query  404  SFPAAAPTFVRSPS  363
            SFPAA  TFVRSPS
Sbjct  438  SFPAAT-TFVRSPS  450



>ref|XP_010909467.1| PREDICTED: FRIGIDA-like protein 4a [Elaeis guineensis]
Length=534

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 116/177 (66%), Gaps = 23/177 (13%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L +KFPPV LLK+FLKD+KK  ++  ED N+SG+A    ++KE SA+RAV+KCIE++KLE
Sbjct  320  LQDKFPPVPLLKSFLKDSKKGTSSSSEDRNSSGQAVGNGSRKEQSALRAVMKCIEDHKLE  379

Query  578  AEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRST-NAYVSS  402
            AEFP E L+KR + LEK K E KK  +   PA KRTR +NGGPMPPAKAGR T NAYVSS
Sbjct  380  AEFPLEDLQKRFENLEKAKVE-KKKPSGGGPANKRTRANNGGPMPPAKAGRLTNNAYVSS  438

Query  401  FPAAAPTFVRSPS-HT-----------QYPTGLPAYPASPIYTHGSMSPQYVYSPEA  267
            FPAA  TFVRSPS HT             PTG   Y        GS SP  V  P A
Sbjct  439  FPAAT-TFVRSPSAHTTYPAAAPPYPYDRPTGHGVY--------GSRSPPTVRDPYA  486



>ref|XP_006826275.1| hypothetical protein AMTR_s00004p00045050 [Amborella trichopoda]
 gb|ERM93512.1| hypothetical protein AMTR_s00004p00045050 [Amborella trichopoda]
Length=513

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 112/174 (64%), Gaps = 12/174 (7%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GLI K+PPV LL+A+L+++++   +IL+D NNS RA H A  KE +A+RAV+KC+EE+KL
Sbjct  315  GLIEKYPPVPLLEAYLRNSREVVASILKDGNNSTRAMHEAGIKEHAALRAVIKCVEEHKL  374

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E+  P E L+KRL Q++K K+E+KK AA++    KR RV NG  +PPAKAGR  N++   
Sbjct  375  ESNLPLEPLQKRLAQIDKLKAERKKAAASSQQQNKRGRVGNGAALPPAKAGRLANSH---  431

Query  401  FPAAAPTFVRSPSHTQ---YPTGLPAYPASPIYTHGSMSPQ-----YVYSPEAA  264
            FPA    FVRSP+  Q   +P   P Y     Y  G+ SP      Y Y PE A
Sbjct  432  FPARR-VFVRSPNSGQSPQFPAPPPPYNYGQAYMGGNRSPTSLVDAYGYPPENA  484



>gb|AHH02379.1| FRIGIDA-like protein, partial [Aegiceras corniculatum]
Length=74

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = -1

Query  632  ELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGG  453
            E SA+RAV+KCIEEYKLEAEFPPE+LKKRL+QLEKTK+  +K    A PA KRTR + GG
Sbjct  1    EQSALRAVIKCIEEYKLEAEFPPENLKKRLEQLEKTKT-SEKRKPVAVPANKRTRANIGG  59

Query  452  PMPPAKAGRSTNAYV  408
            PMPPAKAGRSTNAYV
Sbjct  60   PMPPAKAGRSTNAYV  74



>ref|XP_009395189.1| PREDICTED: FRIGIDA-like protein 4a [Musa acuminata subsp. malaccensis]
Length=257

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 107/168 (64%), Gaps = 18/168 (11%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAH------------LAAKKELSAI  618
            GL +KF PV LLK+FLKD+ KA T+ +ED N  G+                AA+     I
Sbjct  31   GLQDKFTPVSLLKSFLKDSNKA-TSTIEDHNGGGQTTKSMVLILFYCRITRAARNSQLII  89

Query  617  RAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaa--aapaaKRTRVSNGGPMP  444
            RA +KCI+E+KLEAEFP E L+KRL+Q EKTK EKKKP+    AAPA KRTR +NGGPMP
Sbjct  90   RAAIKCIQEHKLEAEFPLESLQKRLEQSEKTKVEKKKPSGGGPAAPANKRTRANNGGPMP  149

Query  443  PAKAGRSTNAYVSSFPAAAPTFVRSPS-HTQYPTGLPAYPASPIYTHG  303
            PAKAGR TN    S P AAP FVRSPS HT YP   P YP      HG
Sbjct  150  PAKAGRLTNTVHVSSP-AAPAFVRSPSAHTTYPAAAP-YPYDSPAGHG  195



>ref|XP_010228309.1| PREDICTED: FRIGIDA-like protein 4a [Brachypodium distachyon]
Length=569

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 116/170 (68%), Gaps = 9/170 (5%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILED-PNNSGRAAHLAAKKELSAIRAVLKCIEEYK  585
            GL  KFPPV LLK++L+D+KK +  + ++   +SG++     KKE SA+RAV+KCIE+ K
Sbjct  322  GLQEKFPPVPLLKSYLEDSKKTSCTVSDNLSTSSGQSGSNTNKKEQSALRAVIKCIEDRK  381

Query  584  LEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaap------aaKRTRVSNGGPMPPAKAGR-  426
            LE+EFPPE L+K+L+ LEK K+EKKK +++A+       A KR R SNGGPMPPAKAGR 
Sbjct  382  LESEFPPEDLQKQLEDLEKAKTEKKKASSSASSGGSSEPANKRIRASNGGPMPPAKAGRL  441

Query  425  STNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYS  276
            + N  VSS P AA TFVRSPSHT Y +      ASP +T  +  P   Y+
Sbjct  442  ANNTSVSSLPVAA-TFVRSPSHTSYASPSQTSYASPSHTSYASPPHTSYA  490



>emb|CDY38318.1| BnaC05g30110D [Brassica napus]
Length=531

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 75/113 (66%), Gaps = 22/113 (19%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPP                    D +N+GR ++L A+KE SA++AVLKCIEEYKL
Sbjct  300  GLVDKFPP--------------------DSSNTGRPSNLVAQKEQSALKAVLKCIEEYKL  339

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRS  423
            E EFPPE+LKKRLDQLEKTK++  K   AA PA KRTR S  GPMPPA   ++
Sbjct  340  EEEFPPENLKKRLDQLEKTKTD--KRKPAAVPANKRTRASYNGPMPPANVSQT  390



>dbj|BAC83627.1| putative hydroxyproline-rich glycoprotein [Oryza sativa Japonica 
Group]
 dbj|BAG89444.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81597.1| hypothetical protein OsI_25073 [Oryza sativa Indica Group]
Length=534

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 108/161 (67%), Gaps = 10/161 (6%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAA-KKELSAIRAVLKCIEEYK  585
            GL  KFPPV LLK++L D+KK +  + ++ + S   +   A KKE S +RAV+KCIE+ K
Sbjct  311  GLQEKFPPVPLLKSYLADSKKTSCTVSDNSSTSSGQSGSNANKKEQSVLRAVIKCIEDRK  370

Query  584  LEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaap------aaKRTRVSNGGPMPPAKAGRS  423
            LEAEFP E L+++L++LEK K+EKKK  ++A+       A KR R SNGGPMPPAKAGR 
Sbjct  371  LEAEFPLEDLQRQLEELEKAKTEKKKATSSASSGGSSGPATKRIRASNGGPMPPAKAGRL  430

Query  422  T-NAYVSSFPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHG  303
            T NA VSS PAA  TFVRSPSHT Y    P YP      HG
Sbjct  431  TNNACVSSTPAAT-TFVRSPSHTSYAMASP-YPYDRPVGHG  469



>gb|EEE66652.1| hypothetical protein OsJ_23273 [Oryza sativa Japonica Group]
Length=684

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 108/161 (67%), Gaps = 10/161 (6%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAA-KKELSAIRAVLKCIEEYK  585
            GL  KFPPV LLK++L D+KK +  + ++ + S   +   A KKE S +RAV+KCIE+ K
Sbjct  461  GLQEKFPPVPLLKSYLADSKKTSCTVSDNSSTSSGQSGSNANKKEQSVLRAVIKCIEDRK  520

Query  584  LEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaap------aaKRTRVSNGGPMPPAKAGRS  423
            LEAEFP E L+++L++LEK K+EKKK  ++A+       A KR R SNGGPMPPAKAGR 
Sbjct  521  LEAEFPLEDLQRQLEELEKAKTEKKKATSSASSGGSSGPATKRIRASNGGPMPPAKAGRL  580

Query  422  T-NAYVSSFPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHG  303
            T NA VSS PAA  TFVRSPSHT Y    P YP      HG
Sbjct  581  TNNACVSSTPAAT-TFVRSPSHTSYAMASP-YPYDRPVGHG  619



>ref|XP_006658319.1| PREDICTED: FRIGIDA-like protein 4a-like [Oryza brachyantha]
Length=394

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 8/149 (5%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAA-KKELSAIRAVLKCIEEYK  585
            GL  KFPPV LLK++L+DAKK +  + ++ + S   +   A KKE SA+RAV+KCIE+ K
Sbjct  172  GLQEKFPPVPLLKSYLEDAKKTSYTVSDNSSTSSGQSGSNANKKEQSALRAVIKCIEDRK  231

Query  584  LEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaap-----aaKRTRVSNGGPMPPAKAGRST  420
            LE E+P E L+++L++LEK K++KK  ++A++      A KR R SNGGPMPPA+AG  T
Sbjct  232  LETEYPLEDLQRQLEELEKAKTKKKATSSASSGGSSGPATKRIRASNGGPMPPARAGHLT  291

Query  419  -NAYVSSFPAAAPTFVRSPSHTQYPTGLP  336
             NA VSS PAA  TFVRSPSHT Y T  P
Sbjct  292  NNACVSSTPAAT-TFVRSPSHTSYATASP  319



>ref|XP_004955594.1| PREDICTED: protein FRIGIDA-like [Setaria italica]
Length=570

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 82/109 (75%), Gaps = 7/109 (6%)
 Frame = -1

Query  638  KKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaap------aaK  477
            KKE SA+RAV+KC+E+ KLEAEFP E L+K+L++LEK K+EKKK A++A+       A K
Sbjct  368  KKEQSALRAVIKCVEDRKLEAEFPLEDLRKQLEELEKAKTEKKKAASSASSGGSSGPATK  427

Query  476  RTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAY  330
            R R SNGGPMPPAKAGR+ NA VSSFP    TF RSPSHT Y T  P++
Sbjct  428  RIRASNGGPMPPAKAGRTNNASVSSFPTPT-TFARSPSHTSYATTSPSH  475



>emb|CAB10269.1| hydroxyproline-rich glycoprotein homolog [Arabidopsis thaliana]
 emb|CAB78532.1| hydroxyproline-rich glycoprotein homolog [Arabidopsis thaliana]
Length=507

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 96/167 (57%), Gaps = 30/167 (18%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++ FPPV LLKA+L+DAKKA   I +D NNSGR+A   +    SA+     C+E+ K 
Sbjct  325  GLVHLFPPVPLLKAYLRDAKKATALITDDSNNSGRSAGSVS----SALAYQCMCLEKTKT  380

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E   P                       A  PA KRTR S  GPMPPAKAGR TNAYVSS
Sbjct  381  EKRKP-----------------------AVIPANKRTRASYSGPMPPAKAGRITNAYVSS  417

Query  401  FPAAAPTFVRSPSHT-QYPTGLPAYPASPIYTHGSMSPQYVYSPEAA  264
            FP   PTF+RS SH+ QY  G+PAY  SP   + + SP Y YSPEA 
Sbjct  418  FPPPPPTFIRSQSHSPQY--GVPAYTTSPPTIYSNRSPPYQYSPEAV  462



>ref|XP_002461525.1| hypothetical protein SORBIDRAFT_02g004090 [Sorghum bicolor]
 gb|EER98046.1| hypothetical protein SORBIDRAFT_02g004090 [Sorghum bicolor]
Length=524

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 105/150 (70%), Gaps = 9/150 (6%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAA-KKELSAIRAVLKCIEEYK  585
            GL  KFPPV LLK++L+D+KK +TA  ++ + S   +   A KKE SA+RAV+KC+E++ 
Sbjct  333  GLQEKFPPVPLLKSYLEDSKKTSTAASDNSSTSSGQSGSNANKKEQSALRAVIKCVEDHN  392

Query  584  LEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaap------aaKRTRVSNGGPMPPAKAGRS  423
            LEAEF  E L+K+L++LEK K+EKKK A++A        A KR R SNGGPMPPAKAGR 
Sbjct  393  LEAEFSLEDLRKQLEELEKAKTEKKKAASSATSGSSSGPATKRIRASNGGPMPPAKAGRL  452

Query  422  T-NAYVSSFPAAAPTFVRSPSHTQYPTGLP  336
            T NA VSSFPA   TF +SPSH  Y   LP
Sbjct  453  TNNACVSSFPAPT-TFTQSPSHASYANDLP  481



>gb|ABK25209.1| unknown [Picea sitchensis]
 gb|ACN40848.1| unknown [Picea sitchensis]
Length=534

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 90/143 (63%), Gaps = 5/143 (3%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  KFPPV LLKA+LK++KKA  A L+  NNS  A + A  KEL+A+R V+KCIEE+ L
Sbjct  310  GLFEKFPPVPLLKAYLKNSKKATLATLKSGNNSA-AVNEANTKELTALRTVIKCIEEHNL  368

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGP---MPPAKAGRSTNAY  411
            E+ FP   L+ R+  LEK ++E+KK   +     KR+R + GG    MPPAKAG++ NAY
Sbjct  369  ESLFPINSLQSRVADLEKKRAERKKSGGSLKSQNKRSRSNAGGSGAHMPPAKAGKAPNAY  428

Query  410  VSSFPAAAPTFVRSPSHTQYPTG  342
             SS   +   + R     QYP G
Sbjct  429  ASS-NISDRNYYRPSDMVQYPVG  450



>emb|CBI26255.3| unnamed protein product [Vitis vinifera]
Length=103

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KFPPV LLKAFL+D+KKAAT+ILEDPNNSGRA +LA +KE SA+RAV+KCIEEYKL
Sbjct  38   GLVDKFPPVPLLKAFLRDSKKAATSILEDPNNSGRAVNLAGRKEQSALRAVIKCIEEYKL  97

Query  581  EAEF  570
            EAE 
Sbjct  98   EAEL  101



>gb|ABR17868.1| unknown [Picea sitchensis]
Length=601

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 92/147 (63%), Gaps = 5/147 (3%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  KFPPV LLK +LKDAKKA+ A L+  NNS  A + A  KELSA RAV+KCIEE+KL
Sbjct  373  GLTEKFPPVPLLKEYLKDAKKASQASLKSGNNSTAAQNEANTKELSAYRAVIKCIEEHKL  432

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGP----MPPAKAGRSTNA  414
            E++F P+ L+KR+ QLEK K+++K+ A A     KR R +NGG     MPP  A   T A
Sbjct  433  ESQFSPDPLQKRVAQLEKAKADRKRSAGAVKSQPKRPR-ANGGNAGVYMPPLSAAERTPA  491

Query  413  YVSSFPAAAPTFVRSPSHTQYPTGLPA  333
              +S  AA  +F RS    QY    P 
Sbjct  492  LYASSNAADRSFYRSLDRVQYSGAAPG  518



>gb|ABK95640.1| unknown [Populus trichocarpa]
Length=96

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 51/64 (80%), Gaps = 4/64 (6%)
 Frame = -1

Query  449  MPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP--QYVYS  276
            MPPAKAGR TNAYVSSFPA  P FVRSPSHTQYPTG+PAYP+ P   +GS SP   Y YS
Sbjct  1    MPPAKAGRLTNAYVSSFPAP-PAFVRSPSHTQYPTGVPAYPSPPA-VYGSRSPPSPYAYS  58

Query  275  PEAA  264
            PEAA
Sbjct  59   PEAA  62



>gb|AIZ49817.1| ABI3-interacting protein 2, partial [Araucaria biramulata]
Length=162

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 94/148 (64%), Gaps = 6/148 (4%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            LI KFPPV LLK +LKDAKKA+ A ++  NNS  A + A  KELSA+RAV+KCIEE+KLE
Sbjct  1    LIEKFPPVPLLKEYLKDAKKASQASIKSGNNSTAAQNEANTKELSALRAVIKCIEEHKLE  60

Query  578  AEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGP----MPPAKAGRSTNAY  411
            +++ P+ L+KR+ QLEK K+++K+ A A     KR R +NGG     + P  A   T A 
Sbjct  61   SQYSPDSLQKRVAQLEKAKADRKRSAGAVKSQPKRPR-ANGGNVGAYVAPLSAPERTPAM  119

Query  410  VSSFPAAAPTFVRSPSHTQYP-TGLPAY  330
             +S  AA  +F R     QY   G+ +Y
Sbjct  120  YASSNAADRSFYRPVERVQYSGAGVASY  147



>gb|AIZ49827.1| ABI3-interacting protein 2, partial [Araucaria montana]
Length=174

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 94/148 (64%), Gaps = 6/148 (4%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            LI KFPPV LLK +LKDAKKA+ A ++  NNS  A + A  KELSA+RAV+KCIEE+KLE
Sbjct  3    LIEKFPPVPLLKEYLKDAKKASQASIKSGNNSTAAQNEANTKELSALRAVIKCIEEHKLE  62

Query  578  AEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGP----MPPAKAGRSTNAY  411
            +++ P+ L+KR+ QLEK K+++K+ A A     KR R +NGG     + P  A   T A 
Sbjct  63   SQYSPDSLQKRVAQLEKAKADRKRSAGAVKSQPKRPR-ANGGNVGAYVAPLSAPERTPAM  121

Query  410  VSSFPAAAPTFVRSPSHTQYP-TGLPAY  330
             +S  AA  +F R     QY   G+ +Y
Sbjct  122  YASSNAADRSFYRPVERVQYSGAGVASY  149



>gb|AIZ49820.1| ABI3-interacting protein 2, partial [Araucaria muelleri]
 gb|AIZ49828.1| ABI3-interacting protein 2, partial [Araucaria montana]
 gb|AIZ49838.1| ABI3-interacting protein 2, partial [Araucaria subulata]
Length=176

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 94/148 (64%), Gaps = 6/148 (4%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            LI KFPPV LLK +LKDAKKA+ A ++  NNS  A + A  KELSA+RAV+KCIEE+KLE
Sbjct  11   LIEKFPPVPLLKEYLKDAKKASQASIKSGNNSTAAQNEANTKELSALRAVIKCIEEHKLE  70

Query  578  AEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGP----MPPAKAGRSTNAY  411
            +++ P+ L+KR+ QLEK K+++K+ A A     KR R +NGG     + P  A   T A 
Sbjct  71   SQYSPDSLQKRVAQLEKAKADRKRSAGAVKSQPKRPR-ANGGNVGAYVAPLSAPERTPAM  129

Query  410  VSSFPAAAPTFVRSPSHTQYP-TGLPAY  330
             +S  AA  +F R     QY   G+ +Y
Sbjct  130  YASSNAADRSFYRPVERVQYSGAGVASY  157



>gb|AIZ49839.1| ABI3-interacting protein 2, partial [Araucaria columnaris]
Length=168

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 94/148 (64%), Gaps = 6/148 (4%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            LI KFPPV LLK +LKDAKKA+ A ++  NNS  A + A  KELSA+RAV+KCIEE+KLE
Sbjct  11   LIEKFPPVPLLKEYLKDAKKASQASIKSGNNSTAAQNEANTKELSALRAVIKCIEEHKLE  70

Query  578  AEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGP----MPPAKAGRSTNAY  411
            +++ P+ L+KR+ QLEK K+++K+ A A     KR R +NGG     + P  A   T A 
Sbjct  71   SQYSPDSLQKRVAQLEKAKADRKRSAGAVKSQPKRPR-ANGGNVGAYVAPLSAPERTPAM  129

Query  410  VSSFPAAAPTFVRSPSHTQYP-TGLPAY  330
             +S  AA  +F R     QY   G+ +Y
Sbjct  130  YASSNAADRSFYRPVERVQYSGAGVASY  157



>gb|AIZ49833.1| ABI3-interacting protein 2, partial [Araucaria rulei]
Length=178

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 94/148 (64%), Gaps = 6/148 (4%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            LI KFPPV LLK +LKDAKKA+ A ++  NNS  A + A  KELSA+RAV+KCIEE+KLE
Sbjct  11   LIEKFPPVPLLKEYLKDAKKASQASIKSGNNSTAAQNEANTKELSALRAVIKCIEEHKLE  70

Query  578  AEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGP----MPPAKAGRSTNAY  411
            +++ P+ L+KR+ QLEK K+++K+ A A     KR R +NGG     + P  A   T A 
Sbjct  71   SQYSPDSLQKRVAQLEKAKADRKRSAGAVKSQPKRPR-ANGGNVGAYVAPLSAPERTPAM  129

Query  410  VSSFPAAAPTFVRSPSHTQYP-TGLPAY  330
             +S  AA  +F R     QY   G+ +Y
Sbjct  130  YASSNAADRSFYRPVERVQYSGAGVASY  157



>gb|AIZ49836.1| ABI3-interacting protein 2, partial [Araucaria scopulorum]
 gb|AIZ49837.1| ABI3-interacting protein 2, partial [Araucaria subulata]
Length=175

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 94/148 (64%), Gaps = 6/148 (4%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            LI KFPPV LLK +LKDAKKA+ A ++  NNS  A + A  KELSA+RAV+KCIEE+KLE
Sbjct  11   LIEKFPPVPLLKEYLKDAKKASQASIKSGNNSTAAQNEANTKELSALRAVIKCIEEHKLE  70

Query  578  AEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGP----MPPAKAGRSTNAY  411
            +++ P+ L+KR+ QLEK K+++K+ A A     KR R +NGG     + P  A   T A 
Sbjct  71   SQYSPDSLQKRVAQLEKAKADRKRSAGAVKSQPKRPR-ANGGNVGAYVAPLSAPERTPAM  129

Query  410  VSSFPAAAPTFVRSPSHTQYP-TGLPAY  330
             +S  AA  +F R     QY   G+ +Y
Sbjct  130  YASSNAADRSFYRPVERVQYSGAGVASY  157



>gb|EEC76321.1| hypothetical protein OsI_13877 [Oryza sativa Indica Group]
Length=550

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 96/163 (59%), Gaps = 32/163 (20%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILED----PNNS-------GRAAHLAAKKELSAIR  615
            GL  KFPP  LLK           A LED    P+NS       G++   A KKE SA+R
Sbjct  324  GLQEKFPPAPLLK-----------AYLEDSKKIPSNSDNLSTSTGQSGSNANKKEQSALR  372

Query  614  AVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaap------aaKRTRVSNGG  453
            AV+KC+E++KLEAEFP E L++RL++LEK K+EKKK A++++       A KR R S GG
Sbjct  373  AVIKCVEDHKLEAEFPLEDLRERLEELEKAKTEKKKAASSSSSGGSSGPANKRIRASTGG  432

Query  452  PMPPAKAGRSTN----AYVSSFPAAAPTFVRSPSHTQYPTGLP  336
            PMPPAKAGR T+        +      TF+RSPSH  Y T  P
Sbjct  433  PMPPAKAGRLTDYTGTPSSPATTTTNATFIRSPSHASYGTASP  475



>gb|AIZ49823.1| ABI3-interacting protein 2, partial [Araucaria humboldtensis]
 gb|AIZ49824.1| ABI3-interacting protein 2, partial [Araucaria laubenfelsii]
Length=172

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 94/148 (64%), Gaps = 6/148 (4%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            LI KFPPV LLK +LKDAKKA+ A ++  NNS  A + A  KELSA+RAV+KCIEE+KLE
Sbjct  11   LIEKFPPVPLLKEYLKDAKKASQASIKSGNNSTAAQNEANTKELSALRAVIKCIEEHKLE  70

Query  578  AEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGP----MPPAKAGRSTNAY  411
            +++ P+ L+KR+ QLEK K+++K+ A A     KR R +NGG     + P  A   T A 
Sbjct  71   SQYSPDSLQKRVAQLEKAKADRKRSAGAVKSQPKRPR-ANGGNVGAYVAPLSAPERTPAM  129

Query  410  VSSFPAAAPTFVRSPSHTQYP-TGLPAY  330
             +S  AA  +F R     QY   G+ +Y
Sbjct  130  YASSNAADRSFYRPVERVQYSGAGVASY  157



>ref|NP_001051543.1| Os03g0794900 [Oryza sativa Japonica Group]
 gb|AAT76425.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99329.1| hydroxyproline-rich glycoprotein family protein, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13457.1| Os03g0794900 [Oryza sativa Japonica Group]
 dbj|BAG95534.1| unnamed protein product [Oryza sativa Japonica Group]
Length=550

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 96/163 (59%), Gaps = 32/163 (20%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILED----PNNS-------GRAAHLAAKKELSAIR  615
            GL  KFPP  LLK           A LED    P+NS       G++   A KKE SA+R
Sbjct  324  GLQEKFPPAPLLK-----------AYLEDSKKIPSNSDNLSTSTGQSGSNANKKEQSALR  372

Query  614  AVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaap------aaKRTRVSNGG  453
            AV+KC+E++KLEAEFP E L++RL++LEK K+EKKK A++++       A KR R S GG
Sbjct  373  AVIKCVEDHKLEAEFPLEDLRERLEELEKAKTEKKKAASSSSSGGSSGPANKRIRASTGG  432

Query  452  PMPPAKAGRSTN----AYVSSFPAAAPTFVRSPSHTQYPTGLP  336
            PMPPAKAGR T+        +      TF+RSPSH  Y T  P
Sbjct  433  PMPPAKAGRLTDYTGTPSSPATTTTNATFIRSPSHASYGTASP  475



>gb|AIZ49835.1| ABI3-interacting protein 2, partial [Araucaria scopulorum]
Length=174

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 94/148 (64%), Gaps = 6/148 (4%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            LI KFPPV LLK +LKDAKKA+ A ++  NNS  A + A  KELSA+RAV+KCIEE+KLE
Sbjct  11   LIEKFPPVPLLKEYLKDAKKASQASIKSGNNSTAAQNEANTKELSALRAVIKCIEEHKLE  70

Query  578  AEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGP----MPPAKAGRSTNAY  411
            +++ P+ L+KR+ QLEK K+++K+ A A     KR R +NGG     + P  A   T A 
Sbjct  71   SQYSPDSLQKRVAQLEKAKADRKRSAGAVKSQPKRPR-ANGGNVGAYVAPLSAPERTPAM  129

Query  410  VSSFPAAAPTFVRSPSHTQYP-TGLPAY  330
             +S  AA  +F R     QY   G+ +Y
Sbjct  130  YASSNAADRSFYRPVERVQYSGAGVASY  157



>gb|EEE60086.1| hypothetical protein OsJ_12936 [Oryza sativa Japonica Group]
Length=516

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 96/163 (59%), Gaps = 32/163 (20%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILED----PNNS-------GRAAHLAAKKELSAIR  615
            GL  KFPP  LLK           A LED    P+NS       G++   A KKE SA+R
Sbjct  290  GLQEKFPPAPLLK-----------AYLEDSKKIPSNSDNLSTSTGQSGSNANKKEQSALR  338

Query  614  AVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaap------aaKRTRVSNGG  453
            AV+KC+E++KLEAEFP E L++RL++LEK K+EKKK A++++       A KR R S GG
Sbjct  339  AVIKCVEDHKLEAEFPLEDLRERLEELEKAKTEKKKAASSSSSGGSSGPANKRIRASTGG  398

Query  452  PMPPAKAGRSTN----AYVSSFPAAAPTFVRSPSHTQYPTGLP  336
            PMPPAKAGR T+        +      TF+RSPSH  Y T  P
Sbjct  399  PMPPAKAGRLTDYTGTPSSPATTTTNATFIRSPSHASYGTASP  441



>gb|AIZ49814.1| ABI3-interacting protein 2, partial [Araucaria bernieri]
 gb|AIZ49815.1| ABI3-interacting protein 2, partial [Araucaria bernieri]
 gb|AIZ49816.1| ABI3-interacting protein 2, partial [Araucaria biramulata]
 gb|AIZ49818.1| ABI3-interacting protein 2, partial [Araucaria columnaris]
 gb|AIZ49819.1| ABI3-interacting protein 2, partial [Araucaria columnaris]
 gb|AIZ49821.1| ABI3-interacting protein 2, partial [Araucaria heterophylla]
 gb|AIZ49822.1| ABI3-interacting protein 2, partial [Araucaria humboldtensis]
 gb|AIZ49825.1| ABI3-interacting protein 2, partial [Araucaria laubenfelsii]
 gb|AIZ49826.1| ABI3-interacting protein 2, partial [Araucaria luxurians]
 gb|AIZ49829.1| ABI3-interacting protein 2, partial [Araucaria muelleri]
 gb|AIZ49830.1| ABI3-interacting protein 2, partial [Araucaria nemorosa]
 gb|AIZ49831.1| ABI3-interacting protein 2, partial [Araucaria nemorosa]
 gb|AIZ49832.1| ABI3-interacting protein 2, partial [Araucaria rulei]
 gb|AIZ49834.1| ABI3-interacting protein 2, partial [Araucaria schmidii]
Length=182

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 94/148 (64%), Gaps = 6/148 (4%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            LI KFPPV LLK +LKDAKKA+ A ++  NNS  A + A  KELSA+RAV+KCIEE+KLE
Sbjct  11   LIEKFPPVPLLKEYLKDAKKASQASIKSGNNSTAAQNEANTKELSALRAVIKCIEEHKLE  70

Query  578  AEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGP----MPPAKAGRSTNAY  411
            +++ P+ L+KR+ QLEK K+++K+ A A     KR R +NGG     + P  A   T A 
Sbjct  71   SQYSPDSLQKRVAQLEKAKADRKRSAGAVKSQPKRPR-ANGGNVGAYVAPLSAPERTPAM  129

Query  410  VSSFPAAAPTFVRSPSHTQYP-TGLPAY  330
             +S  AA  +F R     QY   G+ +Y
Sbjct  130  YASSNAADRSFYRPVERVQYSGAGVASY  157



>ref|XP_008652075.1| PREDICTED: FRIGIDA-like protein 4a [Zea mays]
 tpg|DAA59721.1| TPA: hypothetical protein ZEAMMB73_037297 [Zea mays]
Length=607

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 102/151 (68%), Gaps = 9/151 (6%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAA-KKELSAIRAVLKCIEEYK  585
            GL  KFPPV LLK++L+D+KK +TA  ++ + S   +     KKE SA+RAV+KC+E+ K
Sbjct  341  GLQEKFPPVPLLKSYLEDSKKTSTAASDNSSTSSGQSGSNVNKKEQSALRAVIKCVEDRK  400

Query  584  LEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaap------aaKRTRVSNGGPMPPAKAGRS  423
            LEAEFP E L+K+L++LEK K+EKKK A++A        A KR R S GGPMPPAKAGR 
Sbjct  401  LEAEFPLEGLRKQLEELEKAKTEKKKAASSATSGGSGGPATKRIRASTGGPMPPAKAGRL  460

Query  422  T-NAYVSSFPAAAPTFVRSPSHTQYPTGLPA  333
            T NA VSS PA   T  +SPSH  Y    P+
Sbjct  461  TNNACVSSLPAPT-TLTQSPSHASYANTSPS  490



>gb|AIZ49840.1| ABI3-interacting protein 2, partial [Araucaria muelleri]
Length=158

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 93/147 (63%), Gaps = 6/147 (4%)
 Frame = -1

Query  755  INKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEA  576
            I KFPPV LLK +LKDAKKA+ A ++  NNS  A + A  KELSA+RAV+KCIEE+KLE+
Sbjct  1    IEKFPPVPLLKEYLKDAKKASQASIKSGNNSTAAQNEANTKELSALRAVIKCIEEHKLES  60

Query  575  EFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGP----MPPAKAGRSTNAYV  408
            ++ P+ L+KR+ QLEK K+++K+ A A     KR R +NGG     + P  A   T A  
Sbjct  61   QYSPDSLQKRVAQLEKAKADRKRSAGAVKSQPKRPR-ANGGNVGAYVAPLSAPERTPAMY  119

Query  407  SSFPAAAPTFVRSPSHTQYP-TGLPAY  330
            +S  AA  +F R     QY   G+ +Y
Sbjct  120  ASSNAADRSFYRPVERVQYSGAGVASY  146



>ref|NP_001145922.1| uncharacterized protein LOC100279445 [Zea mays]
 gb|ACL52856.1| unknown [Zea mays]
Length=302

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 91/155 (59%), Gaps = 33/155 (21%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHL-------------AAKKELSA  621
            GL  KFPPV LLK           + LED   +  AA               A KKE SA
Sbjct  54   GLQEKFPPVPLLK-----------SYLEDSKKTSTAASDNSSTSSSGQSGSNANKKEQSA  102

Query  620  IRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaap-------aaKRTRVS  462
            +RAV+KC+E+  LE EFP E L+K+L++LEK K+EKKK A++A         A KR R S
Sbjct  103  LRAVIKCVEDRNLEVEFPLEGLRKQLEELEKAKTEKKKAASSATSGGSSSGPATKRIRAS  162

Query  461  NGGPMPPAKAGR-STNAYVSSFPAAAPTFVRSPSH  360
            NGGPMPPAKAGR +TNA  SSFP    TF +SPSH
Sbjct  163  NGGPMPPAKAGRLATNACASSFPGPT-TFTQSPSH  196



>dbj|BAK00009.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 96/153 (63%), Gaps = 11/153 (7%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL+ KF PV LLK +L+D+KK   A      +SG++   A KKE SA+RAV+KC+E++KL
Sbjct  333  GLLEKFSPVPLLKTYLEDSKKIYCAPDNVSTSSGQSGVNANKKEQSALRAVIKCVEDHKL  392

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaap---aaKRTRVSNGGPMPPAKAGRSTN--  417
            EAEFP E L+KRL++LE  K+EKKK A++ +    A+KR + S GG M P+KAGR  +  
Sbjct  393  EAEFPLEDLRKRLEELEMAKTEKKKAASSCSSGGPASKRIKGSAGGAMSPSKAGRLGDNT  452

Query  416  -----AYVSSFPAAAPTFVRSP-SHTQYPTGLP  336
                    ++  +    F+ SP SH  Y TG P
Sbjct  453  GAPSSPATATSSSTTTAFIGSPASHVSYGTGSP  485



>tpg|DAA42568.1| TPA: hypothetical protein ZEAMMB73_160821 [Zea mays]
Length=578

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 91/155 (59%), Gaps = 33/155 (21%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHL-------------AAKKELSA  621
            GL  KFPPV LL            + LED   +  AA               A KKE SA
Sbjct  330  GLQEKFPPVPLL-----------KSYLEDSKKTSTAASDNSSTSSSGQSGSNANKKEQSA  378

Query  620  IRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaap-------aaKRTRVS  462
            +RAV+KC+E+  LEAEFP E L+K+L++LEK K+EKKK A++A         A KR R S
Sbjct  379  LRAVIKCVEDRNLEAEFPLEGLRKQLEELEKAKTEKKKAASSATSGGSSSGPATKRIRAS  438

Query  461  NGGPMPPAKAGR-STNAYVSSFPAAAPTFVRSPSH  360
            NGGPMPPAKAGR +TNA  SSFP    TF +SPSH
Sbjct  439  NGGPMPPAKAGRLATNACASSFPGPT-TFTQSPSH  472



>gb|AGX28284.1| hydroxyproline-rich glycoprotein-like protein, partial [Populus 
euphratica]
 gb|AGX28285.1| hydroxyproline-rich glycoprotein-like protein, partial [Populus 
euphratica]
 gb|AGX28286.1| hydroxyproline-rich glycoprotein-like protein, partial [Populus 
euphratica]
 gb|AGX28287.1| hydroxyproline-rich glycoprotein-like protein, partial [Populus 
euphratica]
 gb|AGX28288.1| hydroxyproline-rich glycoprotein-like protein, partial [Populus 
euphratica]
 gb|AGX28289.1| hydroxyproline-rich glycoprotein-like protein, partial [Populus 
euphratica]
 gb|AGX28290.1| hydroxyproline-rich glycoprotein-like protein, partial [Populus 
euphratica]
 gb|AGX28291.1| hydroxyproline-rich glycoprotein-like protein, partial [Populus 
euphratica]
 gb|AGX28292.1| hydroxyproline-rich glycoprotein-like protein, partial [Populus 
euphratica]
 gb|AGX28293.1| hydroxyproline-rich glycoprotein-like protein, partial [Populus 
euphratica]
 gb|AGX28294.1| hydroxyproline-rich glycoprotein-like protein, partial [Populus 
euphratica]
 gb|AGX28295.1| hydroxyproline-rich glycoprotein-like protein, partial [Populus 
euphratica]
 gb|AGX28296.1| hydroxyproline-rich glycoprotein-like protein, partial [Populus 
euphratica]
 gb|AGX28297.1| hydroxyproline-rich glycoprotein-like protein, partial [Populus 
euphratica]
 gb|AGX28298.1| hydroxyproline-rich glycoprotein-like protein, partial [Populus 
euphratica]
 gb|AGX28299.1| hydroxyproline-rich glycoprotein-like protein, partial [Populus 
pruinosa]
 gb|AGX28300.1| hydroxyproline-rich glycoprotein-like protein, partial [Populus 
pruinosa]
 gb|AGX28301.1| hydroxyproline-rich glycoprotein-like protein, partial [Populus 
pruinosa]
 gb|AGX28302.1| hydroxyproline-rich glycoprotein-like protein, partial [Populus 
pruinosa]
 gb|AGX28303.1| hydroxyproline-rich glycoprotein-like protein, partial [Populus 
pruinosa]
 gb|AGX28304.1| hydroxyproline-rich glycoprotein-like protein, partial [Populus 
pruinosa]
 gb|AGX28305.1| hydroxyproline-rich glycoprotein-like protein, partial [Populus 
pruinosa]
Length=44

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  650  HLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKS  519
            HLAA+KE SA+RAV+KC+E+YKLEA+FPPE+LKKRL+QLEK K+
Sbjct  1    HLAARKEQSALRAVIKCVEDYKLEAQFPPENLKKRLEQLEKAKT  44



>ref|XP_006650719.1| PREDICTED: FRIGIDA-like protein 4a-like, partial [Oryza brachyantha]
Length=536

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 89/141 (63%), Gaps = 23/141 (16%)
 Frame = -1

Query  689  AILED----PNNS-------GRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRL  543
            A LED    P+NS       G++   A KKE SA+RAV+KC+E+ KLEAEFP E L +RL
Sbjct  319  AYLEDSKKIPSNSDNLSTSTGQSGTNANKKEQSALRAVIKCVEDRKLEAEFPLEDLCERL  378

Query  542  DQLEKTKSEkkkpaaaaap------aaKRTRVSNGGPMPPAKAGRSTN------AYVSSF  399
            ++LEK K+EKKK A++++       A KR R SNGGPMPPAKAGR T+      +  ++ 
Sbjct  379  EELEKAKTEKKKAASSSSSGASSGPANKRIRASNGGPMPPAKAGRHTDYTGTPSSPATTT  438

Query  398  PAAAPTFVRSPSHTQYPTGLP  336
               A TFVRSPSH  Y T  P
Sbjct  439  TTTAATFVRSPSHASYGTASP  459



>ref|XP_010228481.1| PREDICTED: LOW QUALITY PROTEIN: 5'-3' exoribonuclease 4-like 
[Brachypodium distachyon]
Length=1306

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 97/159 (61%), Gaps = 11/159 (7%)
 Frame = -1

Query  761   GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
             GL+ KF PV LLK++L+D+KK +          G++   A KKE SA+RAV+KC+E++KL
Sbjct  1081  GLLEKFSPVPLLKSYLEDSKKISCTSDNLSTGCGQSGTNANKKEQSALRAVIKCVEDHKL  1140

Query  581   EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaap------aaKRTRVSNGGPMPPAKAGRST  420
             E +FP E L+KRL++LE  K+EKKK A++++       A KR R SNGG + PAKAG   
Sbjct  1141  EPDFPLEDLRKRLEELEMAKTEKKKAASSSSSGGASEPANKRIRASNGGAISPAKAGGLN  1200

Query  419   NA----YVSSFPAAAPTFVRSP-SHTQYPTGLPAYPASP  318
             +        +   +  TF+RSP SH  Y TG P    SP
Sbjct  1201  DCTGAPSSPAATTSTTTFIRSPSSHASYGTGSPYSYDSP  1239



>gb|EMS54431.1| 5'-3' exoribonuclease 4 [Triticum urartu]
Length=1362

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 97/153 (63%), Gaps = 11/153 (7%)
 Frame = -1

Query  761   GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
             GL+ KF PV LLK++L+D+KK          +SG++   A KKE SA+RAV+KC+E++KL
Sbjct  1135  GLLEKFSPVPLLKSYLEDSKKIYCTSDNVSTSSGQSGVNANKKEQSALRAVIKCVEDHKL  1194

Query  581   EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaap---aaKRTRVSNGGPMPPAKAGRSTN--  417
             EAEFP E L+KRL+ LE  K+EKKK A++ +    A+KR + S GG M P+K+GR ++  
Sbjct  1195  EAEFPLEDLRKRLEDLEMAKTEKKKAASSCSSGGPASKRIKGSTGGAMSPSKSGRLSDNT  1254

Query  416   -----AYVSSFPAAAPTFVRSP-SHTQYPTGLP  336
                     ++  + A  F+ SP SH  Y TG P
Sbjct  1255  GAPSSPATATSSSTATAFIGSPASHVSYGTGSP  1287



>gb|EMT08825.1| 5'-3' exoribonuclease 4 [Aegilops tauschii]
Length=1323

 Score = 78.2 bits (191),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 98/153 (64%), Gaps = 11/153 (7%)
 Frame = -1

Query  761   GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
             GL+ KF PV LLK++L+D+KK          +SG++   A KKE SA+RAV+KC+E++KL
Sbjct  1096  GLLEKFSPVPLLKSYLEDSKKMYCTSDNVSTSSGQSGVNANKKEQSALRAVIKCVEDHKL  1155

Query  581   EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaap---aaKRTRVSNGGPMPPAKAGRSTN--  417
             EAEFP E L+KRL++LE  K+EKKK A++ +    A+KR + S GG M P+K+GR ++  
Sbjct  1156  EAEFPLEDLRKRLEELEMAKTEKKKAASSCSSGGPASKRIKGSAGGAMSPSKSGRLSDNT  1215

Query  416   -----AYVSSFPAAAPTFVRSP-SHTQYPTGLP  336
                     ++  + A  F+ SP SH  Y TG P
Sbjct  1216  GAPSSPATATSSSTATAFIGSPASHVSYGTGSP  1248



>ref|XP_002961449.1| hypothetical protein SELMODRAFT_76871 [Selaginella moellendorffii]
 gb|EFJ36709.1| hypothetical protein SELMODRAFT_76871 [Selaginella moellendorffii]
Length=579

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 99/170 (58%), Gaps = 6/170 (4%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            ++++  PV LLKA+LKDA+K+A  IL++ NNS  A + ++ KELSA+++V+KCIEEYKL+
Sbjct  372  IMDRVEPVPLLKAYLKDARKSAQVILKNGNNSAAAQNDSSMKELSALKSVIKCIEEYKLD  431

Query  578  AEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTN--AYVS  405
            A+FPP+ L+KR+D LE+ K+++K+ A A    AKR R  NG         RS    +  +
Sbjct  432  AQFPPQSLQKRIDVLERAKADRKRAAVAVKAQAKRPRACNGNGTVYGNGERSFYRPSDRA  491

Query  404  SFPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHG----SMSPQYVYSPEA  267
             F     +     S T Y        A+  YT      SMS  Y+YS + 
Sbjct  492  QFGGVGLSTYGLASQTGYDRRNQGGFATTTYTGNRTPVSMSTSYLYSADG  541



>ref|XP_006842236.1| hypothetical protein AMTR_s00078p00186900 [Amborella trichopoda]
 gb|ERN03911.1| hypothetical protein AMTR_s00078p00186900 [Amborella trichopoda]
Length=568

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 99/171 (58%), Gaps = 12/171 (7%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +F P+ L+KA+LK++++ A AI ++ NNS      +   EL+A+R+V+KCIE+ KL
Sbjct  304  GLTERFAPIPLIKAYLKNSRRNAQAISKNGNNSASTPEESNALELNALRSVIKCIEDNKL  363

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGP--MP---PAKAGRSTN  417
            E EFP E+LKKR+ +LEK K+   +   A  P  KR+R S GG   +P   PAKAGR TN
Sbjct  364  EHEFPIENLKKRVIELEKAKA--SRRKTANRPNPKRSRASTGGSSALPSGRPAKAGRHTN  421

Query  416  AYVSSFPAAAPTF-VRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYSPEA  267
            +  S F        V S +H Q P G+P     P++    M    +++  A
Sbjct  422  S--SRFVGGRNQSPVASLAHYQAPMGVPM--GQPVHHQSPMGSTMIHAVGA  468



>gb|AIZ49841.1| ABI3-interacting protein 2, partial [Araucaria subulata]
Length=138

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 72/119 (61%), Gaps = 6/119 (5%)
 Frame = -1

Query  671  NNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaa  492
            NNS  A + A  KELSA+RAV+KCIEE+KLE+++ P+ L+KR+ QLEK K+++K+ A A 
Sbjct  1    NNSTAAQNEANTKELSALRAVIKCIEEHKLESQYSPDSLQKRVAQLEKAKADRKRSAGAV  60

Query  491  apaaKRTRVSNGGP----MPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYP-TGLPAY  330
                KR R +NGG     + P  A   T A  +S  AA  +F R     QY   G+ +Y
Sbjct  61   KSQPKRPR-ANGGNVGAYVAPLSAPERTPAMYASSNAADRSFYRPVERVQYSGAGVASY  118



>ref|XP_010254145.1| PREDICTED: FRIGIDA-like protein 4a [Nelumbo nucifera]
Length=539

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 82/121 (68%), Gaps = 4/121 (3%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +FPP+ LLK++L+++++ AT IL++ + S  A   A+  EL++I+A++KC+E++KL
Sbjct  316  GLTERFPPLSLLKSYLRNSRRNATTILKNGHYSAAATEEASVLELNSIKAIIKCVEDHKL  375

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMP----PAKAGRSTNA  414
            EAEF  + LKKRL QLEK K+++KK  AA +    +      G  P    P+KAGR +N+
Sbjct  376  EAEFTLDSLKKRLTQLEKAKADRKKNMAATSKPQNKRGRGGSGGGPPNFRPSKAGRPSNS  435

Query  413  Y  411
            Y
Sbjct  436  Y  436



>gb|KHG13959.1| Protein FRIGIDA -like protein [Gossypium arboreum]
Length=534

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 81/124 (65%), Gaps = 7/124 (6%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +FPPV LLK++ +++KK AT IL++ N S  A   +   EL++I+A++KC+E++KL
Sbjct  308  GLTERFPPVYLLKSYQQNSKKNATTILKNGNFSTAATEESKNVELNSIKAIIKCVEDHKL  367

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNG-----GP--MPPAKAGRS  423
            E+EF  + L+KR  QLEK KS++KK +AAA     +   S G     GP    PAKA + 
Sbjct  368  ESEFSTDLLRKRATQLEKVKSDRKKSSAAAGKPQNKRSHSAGSARGSGPPAFRPAKAAKF  427

Query  422  TNAY  411
            +NAY
Sbjct  428  SNAY  431



>gb|AAP31312.2| ABI3-interacting protein 2 [Callitropsis nootkatensis]
Length=672

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 86/141 (61%), Gaps = 2/141 (1%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++ +PPV LLKA+LK+A+K   A ++  N S  A + A  +EL A++AV+KCIEE+ L
Sbjct  422  GLVDTYPPVPLLKAYLKEARK--AAQVKSGNTSVAAQNEANARELFALKAVVKCIEEHNL  479

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
            E+E+P + L+KR+ QLEK K++KK+ A       K+ R +  G   P  +G   +   ++
Sbjct  480  ESEYPSDTLRKRVLQLEKAKTDKKRSADGIKSQYKKPRTNTAGGYLPTASGIDRSGVFAT  539

Query  401  FPAAAPTFVRSPSHTQYPTGL  339
              AA  +  RS    QYP+ +
Sbjct  540  ANAADMSLYRSADRVQYPSSV  560



>gb|KJB06948.1| hypothetical protein B456_001G004500 [Gossypium raimondii]
Length=534

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 80/124 (65%), Gaps = 7/124 (6%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +FPPV LLK++ +++KK AT IL++ N S  A   +   EL++I+A++KC+E++KL
Sbjct  308  GLTERFPPVSLLKSYQQNSKKNATTILKNGNFSAAATEESKNVELNSIKAIIKCVEDHKL  367

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNG---GPMPPA----KAGRS  423
            E+EF  + L+KR  QLEK KS++KK +AAA     +   S G   G  PPA    KA + 
Sbjct  368  ESEFSTDLLRKRATQLEKVKSDRKKSSAAAGKPQNKRSHSAGSARGSGPPAFRPTKAAKF  427

Query  422  TNAY  411
            +N Y
Sbjct  428  SNVY  431



>ref|XP_009338911.1| PREDICTED: FRIGIDA-like protein 2 [Pyrus x bretschneideri]
Length=562

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL +KFPPV +LK+++K++KK A  + +D NNS ++ + A  KE  A+++V+K IE+ KL
Sbjct  355  GLTDKFPPVTILKSYVKESKKLAKKVCKDGNNSRQSMNEATAKESGALKSVIKVIEDLKL  414

Query  581  EAEFPPEHLKKRLDQLEKTKSE  516
            E+E+PP  L+KRL+QLEK K++
Sbjct  415  ESEYPPTFLQKRLEQLEKEKAD  436



>ref|XP_009338897.1| PREDICTED: FRIGIDA-like protein 2 [Pyrus x bretschneideri]
Length=571

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL +KFPPV +LK+++K++KK A  + +D NNS ++ + A  KE  A+++V+K IE+ KL
Sbjct  355  GLTDKFPPVTILKSYVKESKKLAKKVCKDGNNSRQSMNEATAKESGALKSVIKVIEDLKL  414

Query  581  EAEFPPEHLKKRLDQLEKTKSE  516
            E+E+PP  L+KRL+QLEK K++
Sbjct  415  ESEYPPTFLQKRLEQLEKEKAD  436



>gb|KDO50860.1| hypothetical protein CISIN_1g009377mg [Citrus sinensis]
Length=536

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  KFPPV LLK+ L+++KK +T+IL++ N+S  A   +   EL++I+A++KC+E++KL
Sbjct  307  GLTEKFPPVSLLKSHLRNSKKNSTSILKNGNHSNSATEESNNLELNSIKAIIKCVEDHKL  366

Query  581  EAEFPPEHLKKRLDQLEKTKSE  516
            E+ F  ++L+KR  QLEK K E
Sbjct  367  ESAFSVDNLRKRATQLEKVKVE  388



>ref|XP_006451127.1| hypothetical protein CICLE_v10007961mg [Citrus clementina]
 ref|XP_006475599.1| PREDICTED: FRIGIDA-like protein 4a-like [Citrus sinensis]
 gb|ESR64367.1| hypothetical protein CICLE_v10007961mg [Citrus clementina]
Length=536

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  KFPPV LLK+ L+++KK +T+IL++ N+S  A   +   EL++I+A++KC+E++KL
Sbjct  307  GLTEKFPPVSLLKSHLRNSKKNSTSILKNGNHSNSATEESNNLELNSIKAIIKCVEDHKL  366

Query  581  EAEFPPEHLKKRLDQLEKTKSE  516
            E+ F  ++L+KR  QLEK K E
Sbjct  367  ESAFSVDNLRKRATQLEKVKVE  388



>ref|XP_006371903.1| hypothetical protein POPTR_0018s05930g, partial [Populus trichocarpa]
 gb|ERP49700.1| hypothetical protein POPTR_0018s05930g, partial [Populus trichocarpa]
Length=230

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 82/130 (63%), Gaps = 10/130 (8%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL   F PV LLK++LK++KK  T +L++ N S  A   ++  EL++I+A++KC+E++KL
Sbjct  61   GLTKIFSPVSLLKSYLKNSKKITTTVLKNGNYSAAATDESSTLELNSIKAIIKCVEDHKL  120

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNG-------GPMP--PAKAG  429
            E+EF  + L+KR   LEKTK+E+K+  +AA     + +  +G       GP P   AKA 
Sbjct  121  ESEFSLDSLRKRASLLEKTKAERKRGTSAATATKSQNKRGHGSSGARDSGPTPYRQAKAA  180

Query  428  RSTNAYVSSF  399
            + +N Y SSF
Sbjct  181  KFSNNY-SSF  189



>ref|XP_010097353.1| hypothetical protein L484_010231 [Morus notabilis]
 gb|EXB67663.1| hypothetical protein L484_010231 [Morus notabilis]
Length=674

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L++KFPPV LL+  LKD K AA  I +  N+S +    AA KE++A+R V++CIEEYKLE
Sbjct  277  LVDKFPPVPLLQDHLKDVKMAARTIWKKNNSSPKEKDDAANKEIAALRGVIRCIEEYKLE  336

Query  578  AEFPPEHLKKRLDQLEKTKSE  516
            +E+ PE LK+R++ L K K E
Sbjct  337  SEYSPEELKERVEWLRKQKYE  357



>ref|XP_004295864.1| PREDICTED: truncated FRIGIDA-like protein 1 [Fragaria vesca subsp. 
vesca]
Length=544

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            + +KFPPV +LKA++K++K+ A  + E+ NNS +AA+ A  KE  A+++V+K IE+ KLE
Sbjct  329  MTDKFPPVPILKAYVKESKRLAKKVSEEGNNSKKAANEAIAKETGALKSVIKIIEDLKLE  388

Query  578  AEFPPEHLKKRLDQLEKTKS  519
            +E+PP  L+KR+DQLEK K+
Sbjct  389  SEYPPSSLEKRIDQLEKKKA  408



>ref|XP_011043451.1| PREDICTED: FRIGIDA-like protein 4a [Populus euphratica]
Length=561

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 83/130 (64%), Gaps = 10/130 (8%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +F PV LLK++LK++KK  T +L++ N S  A   ++  EL++I+A++KC+E++KL
Sbjct  318  GLTKRFSPVSLLKSYLKNSKKITTTVLKNGNYSAAATDESSTLELNSIKAIIKCVEDHKL  377

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNG-------GPMP--PAKAG  429
            E+EF  + L+KR   LEKTK+E+K+  +AA     + +  +G       GP P   AKA 
Sbjct  378  ESEFSLDSLRKRASLLEKTKAERKRGTSAATATKSQNKRGHGSSGGRDSGPTPYRQAKAA  437

Query  428  RSTNAYVSSF  399
            + +N Y SSF
Sbjct  438  KFSNNY-SSF  446



>ref|XP_008337438.1| PREDICTED: FRIGIDA-like protein 4a [Malus domestica]
Length=539

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL   FPPV LLK++L++++ +AT IL++ NNS  A   ++  EL++I+A++KC+E++KL
Sbjct  309  GLTESFPPVSLLKSYLRNSRXSATIILKNGNNSVAATEESSTLELNSIKAIIKCVEDHKL  368

Query  581  EAEFPPEHLKKRLDQLEKTKSE  516
            E+EF  E L+KR   LEK K+E
Sbjct  369  ESEFSLESLRKRATHLEKAKTE  390



>ref|XP_006371900.1| hypothetical protein POPTR_0018s05910g [Populus trichocarpa]
 gb|ERP49697.1| hypothetical protein POPTR_0018s05910g [Populus trichocarpa]
Length=564

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 83/130 (64%), Gaps = 10/130 (8%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +F PV LLK++LK++KK  T +L++ N S  A   ++  EL++I+A++KC+E++KL
Sbjct  321  GLTKRFSPVSLLKSYLKNSKKITTTVLKNGNYSAAATDESSTLELNSIKAIIKCVEDHKL  380

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNG-------GPMP--PAKAG  429
            E+EF  + L+KR   LEKTK+E+K+  +AA     + +  +G       GP P   AKA 
Sbjct  381  ESEFSLDSLRKRASLLEKTKAERKRGTSAATATKSQNKRGHGSSGARDSGPTPYRQAKAA  440

Query  428  RSTNAYVSSF  399
            + +N Y SSF
Sbjct  441  KFSNNY-SSF  449



>gb|KDP33654.1| hypothetical protein JCGZ_07225 [Jatropha curcas]
Length=539

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 83/124 (67%), Gaps = 7/124 (6%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL ++FPPV LLK+++K++KK    IL++ N +  A   +   EL++I+AV+KC+E++KL
Sbjct  311  GLTDRFPPVSLLKSYIKNSKKNTATILKNGNYNAAATEESNAVELNSIKAVIKCVEDHKL  370

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNG---GPMPPA----KAGRS  423
            E+EFP + L+KR+ +LEK K+E+KK +AAA  A  + +       G  PPA    KA + 
Sbjct  371  ESEFPLDSLRKRVTRLEKAKAERKKSSAAAVAAKSQNKRGANIGRGQRPPAFRPPKAAKF  430

Query  422  TNAY  411
            +NAY
Sbjct  431  SNAY  434



>ref|XP_008242610.1| PREDICTED: FRIGIDA-like protein 4a [Prunus mume]
Length=551

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +FPPV LLK++L+++KK AT IL + NNS  A   ++  EL++I+A++KC+E++KL
Sbjct  313  GLTERFPPVSLLKSYLRNSKKNATTILRNGNNSLAATEESSTLELNSIKAIIKCVEDHKL  372

Query  581  EAEFPPEHLKKRLDQLEKTKSE  516
            E+EF  + L+KR   LEK K+E
Sbjct  373  ESEFSLDSLRKRATHLEKAKAE  394



>ref|XP_007204566.1| hypothetical protein PRUPE_ppa003799mg [Prunus persica]
 gb|EMJ05765.1| hypothetical protein PRUPE_ppa003799mg [Prunus persica]
Length=548

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +FPPV LLK++L+++KK AT IL + NNS  A   ++  EL++I+A++KC+E++KL
Sbjct  311  GLTERFPPVSLLKSYLRNSKKNATTILRNGNNSLAATEESSTLELNSIKAIIKCVEDHKL  370

Query  581  EAEFPPEHLKKRLDQLEKTKSE  516
            E+EF  + L+KR   LEK K+E
Sbjct  371  ESEFSLDSLRKRATHLEKAKAE  392



>gb|AIN75610.1| FRIGIDA4a [Dimocarpus longan]
Length=408

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 78/126 (62%), Gaps = 7/126 (6%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +FPPV LLK++L+++KK AT  L++ N    A   ++  EL++I+A+++C+E++KL
Sbjct  181  GLTERFPPVSLLKSYLRNSKKNATNKLKNGNYRNAATEESSNMELNSIKAIIRCVEDHKL  240

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGG-------PMPPAKAGRS  423
            ++EF  + LKKR  QLEK K+E+KK +        +     G        P+ P+KA + 
Sbjct  241  DSEFSIDSLKKRASQLEKAKAERKKSSVTNTKPQNKRGYGAGSSRGSGPPPLRPSKAAKF  300

Query  422  TNAYVS  405
            +NAY S
Sbjct  301  SNAYQS  306



>ref|XP_006371906.1| hypothetical protein POPTR_0018s059601g, partial [Populus trichocarpa]
 gb|ERP49703.1| hypothetical protein POPTR_0018s059601g, partial [Populus trichocarpa]
Length=215

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 82/130 (63%), Gaps = 10/130 (8%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL   F PV LLK++LK++KK  T +L++ N S  A   ++  EL++I+A++KC+E++KL
Sbjct  22   GLTKIFSPVSLLKSYLKNSKKITTTVLKNGNYSAAATDESSTLELNSIKAIIKCVEDHKL  81

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNG-------GPMP--PAKAG  429
            E+EF  + L+KR   LEKTK+E+K+  +AA     + +  +G       GP P   AKA 
Sbjct  82   ESEFSLDSLRKRASLLEKTKAERKRGTSAATATKSQNKRGHGSSGARDSGPPPYRQAKAA  141

Query  428  RSTNAYVSSF  399
            + +N Y SSF
Sbjct  142  KFSNNY-SSF  150



>ref|XP_006387116.1| hypothetical protein POPTR_1811s00200g, partial [Populus trichocarpa]
 gb|ERP46030.1| hypothetical protein POPTR_1811s00200g, partial [Populus trichocarpa]
Length=265

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 80/128 (63%), Gaps = 9/128 (7%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL   F PV LLK++LK++KK  T +L++ N S  A   ++  EL++I+A++KC+E++KL
Sbjct  22   GLTKIFSPVSLLKSYLKNSKKITTTVLKNGNYSAAATDESSTLELNSIKAIIKCVEDHKL  81

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNG-------GPMP--PAKAG  429
            E+EF  + L+KR   LEKTK+E+K+  +AA     + +  +G       GP P   AKA 
Sbjct  82   ESEFSLDSLRKRASLLEKTKAERKRGTSAATATKSQNKRGHGSSGARDSGPPPYRQAKAA  141

Query  428  RSTNAYVS  405
            + +N Y S
Sbjct  142  KFSNNYSS  149



>ref|XP_004287092.1| PREDICTED: FRIGIDA-like protein 4a isoform X1 [Fragaria vesca 
subsp. vesca]
Length=570

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +FPP+ LLK++LK++KK A+ I+++ NNS  A+  ++  EL++IRAV+KC+E++KL
Sbjct  310  GLTERFPPISLLKSYLKNSKKNASTIMKNGNNSVAASEESSTLELNSIRAVIKCVEDHKL  369

Query  581  EAEFPPEHLKKRLDQLEKTKSE  516
            E+EF  + L+KR+  LE+ K++
Sbjct  370  ESEFTLDSLRKRVTALERAKAD  391



>ref|XP_011458926.1| PREDICTED: FRIGIDA-like protein 4a isoform X2 [Fragaria vesca 
subsp. vesca]
Length=547

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +FPP+ LLK++LK++KK A+ I+++ NNS  A+  ++  EL++IRAV+KC+E++KL
Sbjct  310  GLTERFPPISLLKSYLKNSKKNASTIMKNGNNSVAASEESSTLELNSIRAVIKCVEDHKL  369

Query  581  EAEFPPEHLKKRLDQLEKTKSE  516
            E+EF  + L+KR+  LE+ K++
Sbjct  370  ESEFTLDSLRKRVTALERAKAD  391



>ref|XP_006371905.1| hypothetical protein POPTR_0018s059601g [Populus trichocarpa]
 gb|ERP49702.1| hypothetical protein POPTR_0018s059601g [Populus trichocarpa]
Length=278

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 82/130 (63%), Gaps = 10/130 (8%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL   F PV LLK++LK++KK  T +L++ N S  A   ++  EL++I+A++KC+E++KL
Sbjct  35   GLTKIFSPVSLLKSYLKNSKKITTTVLKNGNYSAAATDESSTLELNSIKAIIKCVEDHKL  94

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNG-------GPMP--PAKAG  429
            E+EF  + L+KR   LEKTK+E+K+  +AA     + +  +G       GP P   AKA 
Sbjct  95   ESEFSLDSLRKRASLLEKTKAERKRGTSAATATKSQNKRGHGSSGARDSGPPPYRQAKAA  154

Query  428  RSTNAYVSSF  399
            + +N Y SSF
Sbjct  155  KFSNNY-SSF  163



>ref|XP_008344098.1| PREDICTED: FRIGIDA-like protein 4a [Malus domestica]
Length=253

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L  +FPPV LLK++LK+++K A  IL++ NNS  A   ++  EL++I+A++KC+E++KLE
Sbjct  27   LTERFPPVSLLKSYLKNSRKNAATILKNGNNSVAATEESSTFELNSIKAIIKCVEDHKLE  86

Query  578  AEFPPEHLKKRLDQLEKTKSE  516
            +EF  E+L+KR   LEK ++E
Sbjct  87   SEFSLENLRKRAAHLEKARTE  107



>ref|XP_007020622.1| FRIGIDA like 1, putative [Theobroma cacao]
 gb|EOY12147.1| FRIGIDA like 1, putative [Theobroma cacao]
Length=596

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  KFPPV LLK +LK+  K A  + +D  NS ++ + A  KE+ A++AV+K I+E+KL
Sbjct  357  GLAEKFPPVHLLKEYLKETTKLAKQVCKDGKNSLKSQNEATAKEIGALKAVIKVIQEHKL  416

Query  581  EAEFPPEHLKKRLDQLEKTKSE  516
            E E+P E L+KR++QLEK +++
Sbjct  417  ETEYPQEDLQKRIEQLEKQQAD  438



>ref|XP_007013214.1| FRIGIDA-like protein [Theobroma cacao]
 gb|EOY30833.1| FRIGIDA-like protein [Theobroma cacao]
Length=534

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 79/124 (64%), Gaps = 7/124 (6%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +F PV LLK++L+++KK AT IL++ N S  A   +   EL++I+A++KC+E++KL
Sbjct  308  GLTERFSPVSLLKSYLRNSKKNATTILKNENYSAAATEESNNVELNSIKAIIKCVEDHKL  367

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKR-------TRVSNGGPMPPAKAGRS  423
            E+EF  + L+KR  QLEK K++++K ++A      +       +R S      PAKA + 
Sbjct  368  ESEFSVDSLRKRATQLEKVKADRRKSSSATGKPQNKRGHNAGSSRGSGPSAFRPAKAAKF  427

Query  422  TNAY  411
            +N+Y
Sbjct  428  SNSY  431



>ref|XP_010270166.1| PREDICTED: truncated FRIGIDA-like protein 1 [Nelumbo nucifera]
Length=519

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L++KFPPV LLKA +K +KK A  I +  N+S +A + A+ KE++A++AV+K IE++KLE
Sbjct  297  LVDKFPPVPLLKAHVKASKKVAQEIRKKGNDSIQAQNEASAKEIAALKAVIKYIEDHKLE  356

Query  578  AEFPPEHLKKRLDQLEKTKSE  516
            +E+P E L KR++Q+EK KS+
Sbjct  357  SEYPRESLDKRIEQMEKQKSD  377



>ref|XP_002514326.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48280.1| conserved hypothetical protein [Ricinus communis]
Length=547

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 93/166 (56%), Gaps = 11/166 (7%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L  KFPPV LLK+++K++KK    IL++ N S  A   +   ELS+I+AV+ C+E++KLE
Sbjct  319  LTEKFPPVSLLKSYIKNSKKITATILKNGNFSAAATDESNTVELSSIKAVINCVEDHKLE  378

Query  578  AEFPPEHLKKRLDQLEKTKSE----kkkpaaaaapaaKRTRVSNGGPMP------PAKAG  429
            +EF  + L+KR+ +LEKTK+E        AAAA    KR   ++GG  P      P KA 
Sbjct  379  SEFSLDSLRKRVTRLEKTKAERKKSSAAAAAAAKSQNKRGPSASGGRDPRAPTFRPGKAA  438

Query  428  RSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP  291
            + +NAY S F    P  V   S     +G   YP+  +Y   S +P
Sbjct  439  KFSNAY-SPFGRRNPAPVTQHSPAARYSGPYNYPSQNVYEGHSTAP  483



>ref|XP_008227104.1| PREDICTED: FRIGIDA-like protein 1 [Prunus mume]
Length=585

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L +KFPPV LLK++LK++KK A  + +D NNS ++ + A  KE  A+++V+K IE+ KLE
Sbjct  371  LTDKFPPVPLLKSYLKESKKLAKKVCKDGNNSRKSMNEATAKETGALKSVIKVIEDLKLE  430

Query  578  AEFPPEHLKKRLDQLEKTKS  519
            +E+PP  L+KRL+QLEK K+
Sbjct  431  SEYPPAVLQKRLEQLEKEKA  450



>ref|XP_011016586.1| PREDICTED: FRIGIDA-like protein 4a, partial [Populus euphratica]
Length=207

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 79/131 (60%), Gaps = 10/131 (8%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +F PV LLK++LK+ KK  T +L++ N +  A   ++  EL++I+A++KC+E++ L
Sbjct  70   GLTKRFSPVSLLKSYLKNFKKITTTVLKNSNYNAAATDESSTLELNSIKAIIKCVEDHNL  129

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNG-------GPMP--PAKAG  429
            E+EF  + L KR   LEKTK+E+K+  +AA     R +   G       GP P   AKA 
Sbjct  130  ESEFSLDSLGKRASLLEKTKAERKRGTSAATATKSRNKRGYGSSGARDSGPTPYRKAKAA  189

Query  428  RSTNAYVSSFP  396
            + +N Y SSF 
Sbjct  190  KFSNNY-SSFS  199



>ref|XP_009347163.1| PREDICTED: FRIGIDA-like protein 4a [Pyrus x bretschneideri]
Length=539

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL   FPPV LLK++L+ ++K AT IL++ NNS  A   ++  EL++I+A++KC+E++KL
Sbjct  309  GLTESFPPVSLLKSYLRSSRKNATTILKNGNNSVAATEESSTVELNSIKAIIKCVEDHKL  368

Query  581  EAEFPPEHLKKRLDQLEKT  525
            E+EF  E L+KR   LEK 
Sbjct  369  ESEFSLESLRKRATHLEKV  387



>ref|XP_009336927.1| PREDICTED: FRIGIDA-like protein 4a [Pyrus x bretschneideri]
Length=554

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L  +FPPV LLK++LK+++K A  IL++ NNS  A   ++  EL++I+A++KC+E++KLE
Sbjct  320  LTERFPPVSLLKSYLKNSRKNAATILKNGNNSVAATEESSTFELNSIKAIIKCVEDHKLE  379

Query  578  AEFPPEHLKKRLDQLEKTKSE  516
            +EF  E+L+KR   LEK ++E
Sbjct  380  SEFSLENLRKRATHLEKARTE  400



>ref|XP_008386583.1| PREDICTED: FRIGIDA-like protein 4a [Malus domestica]
 ref|XP_008386605.1| PREDICTED: FRIGIDA-like protein 4a [Malus domestica]
Length=546

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L  +FPPV LLK++LK+++K A  IL++ NN   AA  ++  EL++I+A++KC+E++KLE
Sbjct  312  LTERFPPVSLLKSYLKNSRKNAATILKNGNNCVAAAEESSTFELNSIKAIIKCVEDHKLE  371

Query  578  AEFPPEHLKKRLDQLEKTKSE  516
            +EF  E+L+KR   LEK ++E
Sbjct  372  SEFSLENLRKRATHLEKARTE  392



>ref|XP_002967308.1| hypothetical protein SELMODRAFT_144478 [Selaginella moellendorffii]
 gb|EFJ31907.1| hypothetical protein SELMODRAFT_144478 [Selaginella moellendorffii]
Length=405

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 69/103 (67%), Gaps = 0/103 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            G++++  PV LLK +LKDA++ A ++L+  ++   A + +  KELSA R+VLKCIEEY L
Sbjct  193  GIMDRIQPVSLLKNYLKDARRIAHSMLKSGHSPAAAQNDSMMKELSATRSVLKCIEEYNL  252

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGG  453
            EA+FP   L KR+ QLEK K +KK+   +    +KR R SN G
Sbjct  253  EADFPSSPLHKRIFQLEKAKLDKKRTGGSMKGQSKRPRGSNNG  295



>ref|XP_010047742.1| PREDICTED: FRIGIDA-like protein 4a [Eucalyptus grandis]
 gb|KCW79702.1| hypothetical protein EUGRSUZ_C01055 [Eucalyptus grandis]
Length=568

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            G+ ++F P  LLK++L +AKK A  +L+  NNS  +A  A+  ELSAIRAV+KC+E+ KL
Sbjct  320  GMTDRFSPASLLKSYLGNAKKNAQNVLKSGNNSVVSAEEASTIELSAIRAVVKCVEDQKL  379

Query  581  EAEFPPEHLKKRLDQLEKTKSE  516
            E+ FP + LKKR   LEK K+E
Sbjct  380  ESVFPLDSLKKRAGILEKAKAE  401



>ref|XP_006858746.1| hypothetical protein AMTR_s00066p00134410 [Amborella trichopoda]
 gb|ERN20213.1| hypothetical protein AMTR_s00066p00134410 [Amborella trichopoda]
Length=544

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 75/129 (58%), Gaps = 15/129 (12%)
 Frame = -1

Query  656  AAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaK  477
            A + A+++ELSA++AV+KCIEE+KLE ++P + L+KR+ QLEK K++K++   A+ P +K
Sbjct  396  ALNEASERELSALKAVIKCIEEHKLEEQYPIDPLQKRIAQLEKAKADKRRAVEASKPQSK  455

Query  476  RTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSM  297
            R R +NG    P    R T             F R+P   +YP G    P   +Y   ++
Sbjct  456  RPR-ANGISYAP----RPT--------VQEKVFYRAPE--RYPYGTYDRPGQDLYAQSTL  500

Query  296  SPQYVYSPE  270
               Y+Y+PE
Sbjct  501  QRPYLYAPE  509



>ref|XP_010088834.1| hypothetical protein L484_020817 [Morus notabilis]
 gb|EXB37031.1| hypothetical protein L484_020817 [Morus notabilis]
Length=541

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +F PV LLK+FL+++KK A+ IL++ NN+  A   +   EL++IRA++KC+E++KL
Sbjct  308  GLTERFSPVALLKSFLQNSKKNASNILKNGNNNLSAMEESNNLELNSIRAIIKCVEDHKL  367

Query  581  EAEFPPEHLKKRLDQLEKTKSE  516
            E+EF  ++L+KR   +EK K+E
Sbjct  368  ESEFSVDNLRKRATHIEKAKAE  389



>ref|XP_007211879.1| hypothetical protein PRUPE_ppa003499mg [Prunus persica]
 gb|EMJ13078.1| hypothetical protein PRUPE_ppa003499mg [Prunus persica]
Length=569

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L +KFPPV LLK++LK++KK A  + +D NNS ++ + A  KE  A+++V+K IE+ KL+
Sbjct  355  LTDKFPPVPLLKSYLKESKKLAKKVCKDGNNSRKSMNEATAKETGALKSVIKVIEDLKLQ  414

Query  578  AEFPPEHLKKRLDQLEKTKS  519
            +++PP  L+KRL+QLEK K+
Sbjct  415  SDYPPAVLQKRLEQLEKEKA  434



>ref|XP_004503419.1| PREDICTED: uncharacterized protein LOC101489761 [Cicer arietinum]
Length=537

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 58/82 (71%), Gaps = 4/82 (5%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +F P+ LL +++++     T+IL   NN+  A++ +   EL++I+ V+KC+E++KL
Sbjct  305  GLTERFQPIKLLNSYVQNY----TSILTSGNNTQSASNESTTLELNSIKDVIKCVEDHKL  360

Query  581  EAEFPPEHLKKRLDQLEKTKSE  516
            E+EF  + LK+R+ QLEK+K+E
Sbjct  361  ESEFKLDKLKRRVSQLEKSKAE  382



>ref|XP_007160344.1| hypothetical protein PHAVU_002G313900g [Phaseolus vulgaris]
 gb|ESW32338.1| hypothetical protein PHAVU_002G313900g [Phaseolus vulgaris]
Length=529

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 72/136 (53%), Gaps = 28/136 (21%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +FPP+ LLK++ ++ KK  T      NN+      ++  EL++I++++KC+E++KL
Sbjct  300  GLTERFPPINLLKSYHRNYKKNVTTTSRKGNNNHATTDDSSTSELNSIKSIIKCVEDHKL  359

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMP--------------  444
            E+EF  +HL+KR   LEK K+E             R + S  G  P              
Sbjct  360  ESEFNLDHLRKRATLLEKAKAE-------------RKKSSTSGTKPQNKRGSRGNGSSSS  406

Query  443  -PAKAGRSTNAYVSSF  399
             PAK+ + +NA+ SSF
Sbjct  407  RPAKSAKFSNAHSSSF  422



>ref|XP_006474949.1| PREDICTED: FRIGIDA-like protein 1-like [Citrus sinensis]
Length=545

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L +K+PPV +L+ ++K++ K A  I ED  NS ++ + A  KE+ A++AV+K IEE+KLE
Sbjct  315  LTSKYPPVPILETYVKESNKIAMKICEDGKNSLKSQNEATAKEIGALKAVIKVIEEHKLE  374

Query  578  AEFPPEHLKKRLDQLEKTKS  519
            +E+P   L+KR++QLEK K+
Sbjct  375  SEYPKGTLEKRIEQLEKQKA  394



>gb|KDO62201.1| hypothetical protein CISIN_1g009061mg [Citrus sinensis]
Length=545

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L +K+PPV +L+ ++K++ K A  I ED  NS ++ + A  KE+ A++AV+K IEE+KLE
Sbjct  315  LTSKYPPVPILETYVKESNKIAMKICEDGKNSLKSQNEATAKEIGALKAVIKVIEEHKLE  374

Query  578  AEFPPEHLKKRLDQLEKTKS  519
            +E+P   L+KR++QLEK K+
Sbjct  375  SEYPKGTLEKRIEQLEKQKA  394



>emb|CBI28087.3| unnamed protein product [Vitis vinifera]
Length=297

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +F PV LLK++L +++K AT IL++ N S  A   +   EL++I+ ++KC+E++KL
Sbjct  70   GLTERFSPVSLLKSYLHNSRKNATTILKNGNYSTAATEESGNVELNSIKTIIKCVEDHKL  129

Query  581  EAEFPPEHLKKRLDQLEKTKSE  516
            E+EF  + L+KR  QLEK K E
Sbjct  130  ESEFSIDSLRKRATQLEKAKVE  151



>ref|XP_010656337.1| PREDICTED: FRIGIDA-like protein 4a isoform X1 [Vitis vinifera]
Length=539

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 64/109 (59%), Gaps = 13/109 (12%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +F PV LLK++L +++K AT IL++ N S  A   +   EL++I+ ++KC+E++KL
Sbjct  312  GLTERFSPVSLLKSYLHNSRKNATTILKNGNYSTAATEESGNVELNSIKTIIKCVEDHKL  371

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAK  435
            E+EF  + L+KR  QLEK K E             R + S G   PP K
Sbjct  372  ESEFSIDSLRKRATQLEKAKVE-------------RKKSSAGASKPPNK  407



>ref|XP_002281155.2| PREDICTED: FRIGIDA-like protein 4a isoform X2 [Vitis vinifera]
Length=533

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 64/109 (59%), Gaps = 13/109 (12%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +F PV LLK++L +++K AT IL++ N S  A   +   EL++I+ ++KC+E++KL
Sbjct  306  GLTERFSPVSLLKSYLHNSRKNATTILKNGNYSTAATEESGNVELNSIKTIIKCVEDHKL  365

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAK  435
            E+EF  + L+KR  QLEK K E             R + S G   PP K
Sbjct  366  ESEFSIDSLRKRATQLEKAKVE-------------RKKSSAGASKPPNK  401



>ref|XP_006600926.1| PREDICTED: FRIGIDA-like protein 3-like [Glycine max]
Length=553

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  656  AAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  516
            A + A  +ELSA+RAV+KCIEEYKLE+E+PP+ L+KR+ QLEK+K +
Sbjct  404  AKNDANAQELSALRAVIKCIEEYKLESEYPPDTLRKRVLQLEKSKGD  450



>gb|KHN44015.1| Protein FRIGIDA [Glycine soja]
Length=553

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  656  AAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  516
            A + A  +ELSA+RAV+KCIEEYKLE+E+PP+ L+KR+ QLEK+K +
Sbjct  404  AKNDANAQELSALRAVIKCIEEYKLESEYPPDTLRKRVLQLEKSKGD  450



>emb|CAN61251.1| hypothetical protein VITISV_004639 [Vitis vinifera]
Length=630

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 64/109 (59%), Gaps = 13/109 (12%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +F PV LLK++L +++K AT IL++ N S  A   +   EL++I+ ++KC+E++KL
Sbjct  403  GLTERFSPVSLLKSYLHNSRKNATTILKNGNYSTAATEESGNVELNSIKTIIKCVEDHKL  462

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAK  435
            E+EF  + L+KR  QLEK K E             R + S G   PP K
Sbjct  463  ESEFSIDSLRKRATQLEKAKVE-------------RKKSSAGASKPPNK  498



>ref|XP_006452513.1| hypothetical protein CICLE_v10007929mg [Citrus clementina]
 gb|ESR65753.1| hypothetical protein CICLE_v10007929mg [Citrus clementina]
Length=545

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L +K+PPV +L+ ++K++ K A  I ED  NS ++ + A  KE+ A++AV+K IEE KLE
Sbjct  315  LTSKYPPVPILETYVKESNKIAMKICEDGKNSLKSQNEATAKEIGALKAVIKVIEERKLE  374

Query  578  AEFPPEHLKKRLDQLEKTKS  519
            +E+P   L+KR++QLEK K+
Sbjct  375  SEYPKGTLEKRIEQLEKQKA  394



>ref|XP_010915057.1| PREDICTED: FRIGIDA-like protein 4b isoform X1 [Elaeis guineensis]
Length=509

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 89/149 (60%), Gaps = 12/149 (8%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +F P+ +LK++L+ +++ A AIL+D N+S  +   A   E+S +R++++C+E  +L
Sbjct  306  GLTERFSPLPVLKSYLQSSREKANAILKDGNHSTASTEQATGAEMSDLRSIIRCVETCRL  365

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMP--PAKAGRSTNAYV  408
            E+EF  + LKKR+ Q+EK K+EKKK A A    +KR R + G  +   PAKA R+ N   
Sbjct  366  ESEFSIDGLKKRVAQMEKAKAEKKKAATANKSGSKRKRSTGGTALSFRPAKATRTFN---  422

Query  407  SSFPAAAPTFVRSPSHTQYPTGLPAYPAS  321
                  AP+  RSP+  Q P G   Y  S
Sbjct  423  ------APSH-RSPTVPQLPVGRQPYSCS  444



>gb|AEW08332.1| hypothetical protein 2_6510_01, partial [Pinus radiata]
 gb|AFG67821.1| hypothetical protein 2_6510_01, partial [Pinus taeda]
 gb|AFG67822.1| hypothetical protein 2_6510_01, partial [Pinus taeda]
 gb|AFG67823.1| hypothetical protein 2_6510_01, partial [Pinus taeda]
 gb|AFG67824.1| hypothetical protein 2_6510_01, partial [Pinus taeda]
 gb|AFG67825.1| hypothetical protein 2_6510_01, partial [Pinus taeda]
 gb|AFG67826.1| hypothetical protein 2_6510_01, partial [Pinus taeda]
 gb|AFG67827.1| hypothetical protein 2_6510_01, partial [Pinus taeda]
 gb|AFG67828.1| hypothetical protein 2_6510_01, partial [Pinus taeda]
 gb|AFG67829.1| hypothetical protein 2_6510_01, partial [Pinus taeda]
 gb|AFG67830.1| hypothetical protein 2_6510_01, partial [Pinus taeda]
 gb|AFG67831.1| hypothetical protein 2_6510_01, partial [Pinus taeda]
 gb|AFG67832.1| hypothetical protein 2_6510_01, partial [Pinus taeda]
 gb|AFG67833.1| hypothetical protein 2_6510_01, partial [Pinus taeda]
 gb|AFG67834.1| hypothetical protein 2_6510_01, partial [Pinus taeda]
 gb|AFG67835.1| hypothetical protein 2_6510_01, partial [Pinus taeda]
 gb|AFG67836.1| hypothetical protein 2_6510_01, partial [Pinus taeda]
 gb|AFG67837.1| hypothetical protein 2_6510_01, partial [Pinus taeda]
Length=162

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -1

Query  617  RAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTR-VSNGGPMPP  441
            RAV+KCIEE+KL +E+P E L+KR+ QLEK K++KK+ A A    +KR R  S GG +PP
Sbjct  1    RAVIKCIEEHKLGSEYPVEGLQKRVAQLEKEKADKKRSADAVKNQSKRPRNNSGGGYLPP  60

Query  440  AKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPT  345
                  +  Y SS  A   +F R      YPT
Sbjct  61   PTGIERSGGYASSN-AGDRSFYRPADRVPYPT  91



>gb|AFK43654.1| unknown [Medicago truncatula]
Length=539

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +F P+ LL +++++ +     IL+  NNS  A   A   EL++I+ V+KC+E++KL
Sbjct  303  GLTERFKPIELLNSYVRNYENNVATILKSGNNSQVATDEANTLELTSIKDVIKCVEDHKL  362

Query  581  EAEFPPEHLKKRLDQLEKTKSE  516
            E++F  + LK+R+ QL+K K E
Sbjct  363  ESKFRLDKLKRRVSQLDKNKFE  384



>ref|XP_003629646.1| Protein FRIGIDA [Medicago truncatula]
 ref|XP_003630808.1| Protein FRIGIDA [Medicago truncatula]
 gb|AET04122.1| frigida-LIKE protein [Medicago truncatula]
Length=539

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +F P+ LL +++++ +     IL+  NNS  A   A   EL++I+ V+KC+E++KL
Sbjct  303  GLTERFKPIELLNSYVRNYENNVATILKSGNNSQVATDEANTLELTSIKDVIKCVEDHKL  362

Query  581  EAEFPPEHLKKRLDQLEKTKSE  516
            E++F  + LK+R+ QL+K K E
Sbjct  363  ESKFRLDKLKRRVSQLDKNKFE  384



>ref|XP_006579918.1| PREDICTED: FRIGIDA-like protein 3-like isoform X2 [Glycine max]
Length=559

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  656  AAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  516
            A + A  +EL+A+RAV+KCIEEYKLE+++PP+ L+KR+ QLEK+K +
Sbjct  410  AKNDANAQELAALRAVIKCIEEYKLESDYPPDTLRKRVLQLEKSKGD  456



>gb|KHN41556.1| Protein FRIGIDA [Glycine soja]
Length=568

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  656  AAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  516
            A + A  +EL+A+RAV+KCIEEYKLE+++PP+ L+KR+ QLEK+K +
Sbjct  419  AKNDANAQELAALRAVIKCIEEYKLESDYPPDTLRKRVLQLEKSKGD  465



>ref|XP_006579919.1| PREDICTED: FRIGIDA-like protein 3-like isoform X3 [Glycine max]
Length=454

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -1

Query  644  AAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  516
            A  +EL+A+RAV+KCIEEYKLE+++PP+ L+KR+ QLEK+K +
Sbjct  309  ANAQELAALRAVIKCIEEYKLESDYPPDTLRKRVLQLEKSKGD  351



>ref|XP_003524673.1| PREDICTED: FRIGIDA-like protein 3-like isoform X1 [Glycine max]
Length=553

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  656  AAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  516
            A + A  +EL+A+RAV+KCIEEYKLE+++PP+ L+KR+ QLEK+K +
Sbjct  404  AKNDANAQELAALRAVIKCIEEYKLESDYPPDTLRKRVLQLEKSKGD  450



>gb|KDP39236.1| hypothetical protein JCGZ_00993 [Jatropha curcas]
Length=562

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL +KF PV LLK +LKD  + +  I  D  NS +A + A  +E++A+++VLK ++EYKL
Sbjct  325  GLTDKFEPVSLLKDYLKDCNELSKKICMDTKNSIKAQNEARSREVNALKSVLKVVDEYKL  384

Query  581  EAEFPPEHLKKRLDQLEKTKS  519
            E+E+P   L+KR++ LEK K+
Sbjct  385  ESEYPRPELEKRIETLEKQKA  405



>ref|XP_008366422.1| PREDICTED: FRIGIDA-like protein 2 [Malus domestica]
Length=561

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL NKFPPV +LK+++K++KK A  + +D   + ++ + A  KE  A+++V+K IE+ KL
Sbjct  341  GLTNKFPPVPILKSYIKESKKLAKKVCKD--GTRQSMNEATAKESGALKSVIKVIEDLKL  398

Query  581  EAEFPPEHLKKRLDQLEKTKSE  516
            E+E+PP  L+KRL+QLEK K++
Sbjct  399  ESEYPPAFLQKRLEQLEKEKAD  420



>ref|XP_010097278.1| hypothetical protein L484_009510 [Morus notabilis]
 gb|EXB67430.1| hypothetical protein L484_009510 [Morus notabilis]
Length=536

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L ++FPPV LLK ++K++KK A  + E+  NS ++ + A  KE SA++AV+K IEE++LE
Sbjct  290  LTDEFPPVPLLKDYVKESKKIAKKVCEEGKNSLKSQNEATAKETSALKAVIKIIEEHELE  349

Query  578  AEFPPEHLKKRLDQLEKTKSE  516
            +E+P E L+K+++ LEK K++
Sbjct  350  SEYPKEFLEKQIENLEKQKAD  370



>ref|XP_010915058.1| PREDICTED: FRIGIDA-like protein 4b isoform X2 [Elaeis guineensis]
Length=507

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 89/149 (60%), Gaps = 14/149 (9%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +F P+ +LK++L+ +++ A AIL+D N+S   A  A   E+S +R++++C+E  +L
Sbjct  306  GLTERFSPLPVLKSYLQSSREKANAILKDGNHS--TASTATGAEMSDLRSIIRCVETCRL  363

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMP--PAKAGRSTNAYV  408
            E+EF  + LKKR+ Q+EK K+EKKK A A    +KR R + G  +   PAKA R+ N   
Sbjct  364  ESEFSIDGLKKRVAQMEKAKAEKKKAATANKSGSKRKRSTGGTALSFRPAKATRTFN---  420

Query  407  SSFPAAAPTFVRSPSHTQYPTGLPAYPAS  321
                  AP+  RSP+  Q P G   Y  S
Sbjct  421  ------APSH-RSPTVPQLPVGRQPYSCS  442



>ref|XP_010271588.1| PREDICTED: FRIGIDA-like protein 3 isoform X2 [Nelumbo nucifera]
 ref|XP_010271594.1| PREDICTED: FRIGIDA-like protein 3 isoform X2 [Nelumbo nucifera]
Length=573

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = -1

Query  635  KELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNG  456
            +EL+A+RAV++C+EEYKLEAE+P + L+KR+ QLEK+KSEKK+          +   +NG
Sbjct  415  QELAALRAVIRCVEEYKLEAEYPLDPLQKRVAQLEKSKSEKKRTGEVVKHQPPKKARANG  474

Query  455  G  453
            G
Sbjct  475  G  475



>ref|XP_010271580.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Nelumbo nucifera]
 ref|XP_010271586.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Nelumbo nucifera]
Length=617

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = -1

Query  635  KELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNG  456
            +EL+A+RAV++C+EEYKLEAE+P + L+KR+ QLEK+KSEKK+          +   +NG
Sbjct  459  QELAALRAVIRCVEEYKLEAEYPLDPLQKRVAQLEKSKSEKKRTGEVVKHQPPKKARANG  518

Query  455  G  453
            G
Sbjct  519  G  519



>ref|XP_004242450.1| PREDICTED: FRIGIDA-like protein 3 [Solanum lycopersicum]
 ref|XP_010323105.1| PREDICTED: FRIGIDA-like protein 3 [Solanum lycopersicum]
Length=545

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 92/164 (56%), Gaps = 26/164 (16%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAA----HLAAKKELSAIRAVLKCIEE  591
            L  +FPPV LLK++L +A KA+T     P+NSG A+    +   +KELSA++AVLKCIE+
Sbjct  374  LTEQFPPVSLLKSYLNEASKAST-----PSNSGNASPTVQNDVNEKELSALKAVLKCIED  428

Query  590  YKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAG------  429
            +KLE ++  + L+KR+ QLEK KS+KKK      P +KR R +  G  P           
Sbjct  429  HKLEEQYLVDPLQKRVHQLEKAKSDKKKATEVTKPQSKRPRPNGVGNGPRVNNVVTEKNF  488

Query  428  --RSTNAY---VSSFPAAAPTFVRSPSHTQYPT--GLPAYPASP  318
              R T+ Y   V   P A P     P++T  P+  G PAY  SP
Sbjct  489  YPRMTDRYPQPVYDGPYAYP----GPTNTHVPSFIGAPAYNFSP  528



>ref|XP_001752883.1| predicted protein [Physcomitrella patens]
 gb|EDQ82387.1| predicted protein, partial [Physcomitrella patens]
Length=436

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            G++++  P+ LLKA+LK+A++ A +IL+  ++S  A + A  KEL+A++AVLKCIEEY+L
Sbjct  337  GIMDRVLPIPLLKAYLKEARRTAQSILKSGSSSAAAQNDATMKELAALKAVLKCIEEYQL  396

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVS  462
            E+++P   L+KR+  LEK KS++K+ A A     KR R S
Sbjct  397  ESQYPSMPLQKRVLHLEKAKSDRKRAAVAVKAQTKRPRAS  436



>ref|XP_009401032.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009401033.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=594

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -1

Query  644  AAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRV  465
            +A  EL AIRAV+KCIEEYKL+ E+P + L+K++ QLEK K++KK+    A    KR R 
Sbjct  407  SASDELGAIRAVIKCIEEYKLQEEYPLDPLQKQVAQLEKAKADKKRGGDTAKFQPKRPRA  466

Query  464  SNGGPMPPAKAGRSTN  417
            S GG +P   AG   N
Sbjct  467  S-GGYVPRRHAGAVNN  481



>ref|XP_009401034.1| PREDICTED: FRIGIDA-like protein 3 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=562

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -1

Query  644  AAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRV  465
            +A  EL AIRAV+KCIEEYKL+ E+P + L+K++ QLEK K++KK+    A    KR R 
Sbjct  375  SASDELGAIRAVIKCIEEYKLQEEYPLDPLQKQVAQLEKAKADKKRGGDTAKFQPKRPRA  434

Query  464  SNGGPMPPAKAGRSTN  417
            S GG +P   AG   N
Sbjct  435  S-GGYVPRRHAGAVNN  449



>gb|EYU27415.1| hypothetical protein MIMGU_mgv1a005047mg [Erythranthe guttata]
Length=499

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L N+FPPV LLK ++  +K+ A  I +   NS ++ + AA KE+S++R+V+KCIE++ LE
Sbjct  290  LTNEFPPVPLLKDYVMYSKRIAQKIRKSGKNSRQSVNEAAMKEISSLRSVIKCIEDHNLE  349

Query  578  AEFPPEHLKKRLDQLEKTKSE  516
            +++P   L  R+++LEK K++
Sbjct  350  SQYPKAELVARVEKLEKEKAD  370



>ref|XP_010938943.1| PREDICTED: truncated FRIGIDA-like protein 1 [Elaeis guineensis]
Length=513

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L++K+PPV +LKA+LK++KKAA  + +  NNS ++ + A  KEL+A++AV+  I+EYKLE
Sbjct  280  LMDKYPPVPILKAYLKESKKAAQEVRKKGNNSIKSQNEAIVKELAALKAVIGAIKEYKLE  339

Query  578  AEFPPEHLKKRLDQLEKTKS  519
            +E+  E LKKR+ QLE+ K+
Sbjct  340  SEYSCETLKKRIAQLEQQKA  359



>ref|XP_004956399.1| PREDICTED: protein FRIGIDA-like [Setaria italica]
Length=534

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 65/103 (63%), Gaps = 4/103 (4%)
 Frame = -1

Query  638  KKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSN  459
            ++ELSA++AV+KCIEE+KLE ++P + L+KR+ QLEK K++K++   AA P +KR R +N
Sbjct  402  ERELSALKAVIKCIEEHKLEEQYPVDPLQKRVLQLEKAKADKRRAVEAAKPQSKRPR-AN  460

Query  458  GGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAY  330
            G    P   G +  ++  + P   P++   P   Q+  G  A+
Sbjct  461  GSAFAPRATGFADKSFYPATPERLPSY---PYERQFVYGAEAH  500



>ref|XP_002960412.1| hypothetical protein SELMODRAFT_34543, partial [Selaginella moellendorffii]
 gb|EFJ37951.1| hypothetical protein SELMODRAFT_34543, partial [Selaginella moellendorffii]
Length=292

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            G++++  PV LLK +LKDA++ A ++L+  ++   A + +  KELSA R+VLKCIEEY L
Sbjct  193  GIMDRIQPVSLLKNYLKDARRIAHSMLKSGHSPAAAQNDSMMKELSATRSVLKCIEEYNL  252

Query  581  EAEFPPEHLKKRLDQLEKTK  522
            EA+FP   L KR+ QLEK K
Sbjct  253  EADFPSSPLHKRIFQLEKAK  272



>dbj|BAF47121.1| hydroxyproline-rich glycoprotein like protein [Nicotiana tabacum]
Length=113

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 65/115 (57%), Gaps = 17/115 (15%)
 Frame = -1

Query  638  KKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTR---  468
            +K+L+A++AV+KCIEE+KLEA++P + L+KR+ QLEK K++KK+    A P  KR R   
Sbjct  11   EKQLTALKAVIKCIEEHKLEAQYPVDPLQKRVLQLEKEKADKKRATEVAKPQPKRPRANC  70

Query  467  VSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYP-ASPIYTH  306
            V NG       A R TN       A    F  S    +YP  +   P A P+ TH
Sbjct  71   VGNG-------AARVTNV------ATDKNFYASRMTDRYPQYMYDRPYAYPVPTH  112



>ref|XP_003588287.1| Hydroxyproline-rich glycoprotein like protein [Medicago truncatula]
Length=215

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -1

Query  686  ILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  516
            IL+  NNS  A   A   EL++I+ V+KC+E++KLE++F  + LK+R+ QL+K K E
Sbjct  17   ILKSGNNSQVATDEANTLELTSIKDVIKCVEDHKLESKFRLDKLKRRVSQLDKNKFE  73



>ref|XP_008780981.1| PREDICTED: truncated FRIGIDA-like protein 1 [Phoenix dactylifera]
Length=496

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L+ K PPV LLKA++ ++KKAA  I +  NNS ++ + A  KEL A+++VLK +EEYKLE
Sbjct  283  LVEKCPPVPLLKAYVMESKKAAQEIRKKGNNSNQSQNEAISKELGALKSVLKAVEEYKLE  342

Query  578  AEFPPEHLKKRLDQLEK  528
            A +P E+L+K++ +LEK
Sbjct  343  AVYPCENLEKQIAKLEK  359



>ref|XP_006426018.1| hypothetical protein CICLE_v10025275mg [Citrus clementina]
 gb|ESR39258.1| hypothetical protein CICLE_v10025275mg [Citrus clementina]
Length=418

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 68/134 (51%), Gaps = 17/134 (13%)
 Frame = -1

Query  668  NSGRAA---HLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaa  498
            NSG A    + A  +EL+A++AV+ CIE YKLEAE+P + L+KR+ QLE++KS+KK+   
Sbjct  246  NSGGATGAQNDANAQELAALKAVISCIERYKLEAEYPLDPLQKRVAQLERSKSDKKRGRD  305

Query  497  aaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYPASP  318
             +     +   +NGG     +  R++    +S   A P +              AY A P
Sbjct  306  FSKHQQSKKHRANGG----YRGFRASGGNAASSRQAPPVYADR----------TAYGAMP  351

Query  317  IYTHGSMSPQYVYS  276
               H + S  Y Y 
Sbjct  352  ARYHQAASNHYDYQ  365



>ref|XP_007155867.1| hypothetical protein PHAVU_003G238500g [Phaseolus vulgaris]
 gb|ESW27861.1| hypothetical protein PHAVU_003G238500g [Phaseolus vulgaris]
Length=551

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  656  AAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  516
            A + A  +EL+A+RAV+KCIEEYKLE+++P + LKKR+ QLEK+K +
Sbjct  404  AKNDANAQELAALRAVIKCIEEYKLESDYPLDTLKKRVLQLEKSKGD  450



>ref|XP_006426019.1| hypothetical protein CICLE_v10025275mg [Citrus clementina]
 ref|XP_006426020.1| hypothetical protein CICLE_v10025275mg [Citrus clementina]
 gb|ESR39259.1| hypothetical protein CICLE_v10025275mg [Citrus clementina]
 gb|ESR39260.1| hypothetical protein CICLE_v10025275mg [Citrus clementina]
Length=568

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 68/133 (51%), Gaps = 17/133 (13%)
 Frame = -1

Query  668  NSGRAA---HLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaa  498
            NSG A    + A  +EL+A++AV+ CIE YKLEAE+P + L+KR+ QLE++KS+KK+   
Sbjct  396  NSGGATGAQNDANAQELAALKAVISCIERYKLEAEYPLDPLQKRVAQLERSKSDKKRGRD  455

Query  497  aaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYPASP  318
             +     +   +NGG     +  R++    +S   A P +              AY A P
Sbjct  456  FSKHQQSKKHRANGG----YRGFRASGGNAASSRQAPPVYADR----------TAYGAMP  501

Query  317  IYTHGSMSPQYVY  279
               H + S  Y Y
Sbjct  502  ARYHQAASNHYDY  514



>gb|KDO79035.1| hypothetical protein CISIN_1g008359mg [Citrus sinensis]
 gb|KDO79036.1| hypothetical protein CISIN_1g008359mg [Citrus sinensis]
 gb|KDO79037.1| hypothetical protein CISIN_1g008359mg [Citrus sinensis]
Length=568

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 68/133 (51%), Gaps = 17/133 (13%)
 Frame = -1

Query  668  NSGRAA---HLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaa  498
            NSG A    + A  +EL+A++AV+ CIE YKLEAE+P + L+KR+ QLE++KS+KK+   
Sbjct  396  NSGGATGAQNDANAQELAALKAVISCIERYKLEAEYPLDPLQKRVAQLERSKSDKKRGRD  455

Query  497  aaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYPASP  318
             +     +   +NGG     +  R++    +S   A P +              AY A P
Sbjct  456  FSKHQQSKKHRANGG----YRGFRASGGNAASSRQAPPVYADR----------TAYGAMP  501

Query  317  IYTHGSMSPQYVY  279
               H + S  Y Y
Sbjct  502  ARYHQAASNHYDY  514



>tpg|DAA60796.1| TPA: hypothetical protein ZEAMMB73_698906 [Zea mays]
Length=151

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 58/85 (68%), Gaps = 5/85 (6%)
 Frame = -1

Query  638  KKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSN  459
            ++ELSA+++V+KCIEE+KLE ++P + L+KR+ QLEK K++K+    AA P +KR R +N
Sbjct  19   ERELSALKSVIKCIEEHKLEQQYPVDPLQKRVLQLEKAKADKRMAVEAAKPQSKRPR-AN  77

Query  458  GGPMPPAKAGRSTNAYVSSFPAAAP  384
            G     A A R+T     SF +A P
Sbjct  78   GS----AFATRATGFADKSFYSATP  98



>ref|XP_008462976.1| PREDICTED: FRIGIDA-like protein 1 [Cucumis melo]
Length=576

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L  KF PV +LK ++K++KKAA A+ ++  NS RA + A  KE+ A+++V++ IEEYKL+
Sbjct  294  LTEKFSPVPILKDYVKESKKAAKAVSKEGKNSLRALNEATAKEVGALKSVIRLIEEYKLD  353

Query  578  AEFPPEHLKKRLDQLEKTKS  519
            +++P  +L+KR++QLEK ++
Sbjct  354  SDYPRVNLEKRIEQLEKQQA  373



>ref|XP_011463627.1| PREDICTED: FRIGIDA-like protein 3 [Fragaria vesca subsp. vesca]
Length=574

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 66/130 (51%), Gaps = 18/130 (14%)
 Frame = -1

Query  671  NNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaa  492
            +++G A      KELS ++AV+ C++EYKLEAE+P + L+KRL QLE+++++        
Sbjct  396  DSNGDAQEDVNAKELSGLKAVVGCVQEYKLEAEYPLDPLQKRLVQLERSRAD--------  447

Query  491  apaaKRTRVSNGGPMPPA-KAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYPASPI  315
                 R R  + G      K  ++T  +     +  P  + + S T    G PAY   P 
Sbjct  448  -----RKRSGDSGKRQQLPKKQKATGRWRGY--SGGPGLLIASSPTVGRHGQPAYGERPA  500

Query  314  YTHGSMSPQY  285
            YT   MS +Y
Sbjct  501  YT--GMSERY  508



>ref|XP_010251408.1| PREDICTED: FRIGIDA-like protein 3 [Nelumbo nucifera]
 ref|XP_010251409.1| PREDICTED: FRIGIDA-like protein 3 [Nelumbo nucifera]
Length=545

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 60/96 (63%), Gaps = 5/96 (5%)
 Frame = -1

Query  671  NNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaa  492
            N S  A +   ++ELSA++AV+KCIE++KLE ++P + L KR+ QLEK K++KK+ A  A
Sbjct  403  NTSPTAQNEVNERELSALKAVIKCIEDHKLEEQYPVDPLHKRVAQLEKAKADKKRVAETA  462

Query  491  apaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAP  384
             P +KR R + GG  P     R TN    SF   AP
Sbjct  463  KPQSKRPRANGGGYGP-----RVTNFPDKSFYTRAP  493



>ref|XP_008813697.1| PREDICTED: truncated FRIGIDA-like protein 1 [Phoenix dactylifera]
Length=510

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            +++K+PPV +LKA+LK++KKAA  + +  NNS ++ + A  KEL+A++AV+  I+EYKLE
Sbjct  280  VMDKYPPVPILKAYLKESKKAAQEVRKKGNNSIKSQNEAIVKELAALKAVIGAIKEYKLE  339

Query  578  AEFPPEHLKKRLDQLEKTKS  519
            +E+  E LKKR+ QLE+ K+
Sbjct  340  SEYSCETLKKRIAQLEQQKA  359



>gb|KHN16599.1| Protein FRIGIDA [Glycine soja]
Length=367

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +FPP+ LLK++ ++ KK  +AI +  NN+      ++  EL++I+A++KC+E++KL
Sbjct  141  GLTERFPPIDLLKSYHRNYKKNVSAIFKKGNNNHATMDDSSTSELNSIKAIIKCVEDHKL  200

Query  581  EAEFPPEHLKKR  546
            E+EF  ++L+KR
Sbjct  201  ESEFNLDNLRKR  212



>ref|XP_002455057.1| hypothetical protein SORBIDRAFT_03g003680 [Sorghum bicolor]
 gb|EES00177.1| hypothetical protein SORBIDRAFT_03g003680 [Sorghum bicolor]
Length=611

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 73/115 (63%), Gaps = 1/115 (1%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L+ +FPPV LLK++L+++   A A+L+   +S  A   A   E +A R++++C+E  +L+
Sbjct  428  LLERFPPVPLLKSYLRNSTDKAQAVLKSGRHSSSALEEANNLEGNAYRSIIRCVESCQLQ  487

Query  578  AEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNG-GPMPPAKAGRSTN  417
            +  P E +KK+L +LEK KSE+KK A  +    KR+R + G  P P AKA R +N
Sbjct  488  SVCPIEVMKKKLAKLEKDKSERKKAAGPSRFQNKRSRGAAGPYPFPAAKAARGSN  542



>ref|XP_006660447.1| PREDICTED: FRIGIDA-like protein 3-like [Oryza brachyantha]
Length=545

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 65/108 (60%), Gaps = 13/108 (12%)
 Frame = -1

Query  638  KKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSN  459
            ++ELS ++AV+KCIEE+KLE +FP + L+KR+ QLEK K++K++   AA P +KR R +N
Sbjct  411  ERELSTLKAVIKCIEEHKLEEQFPIDPLQKRVIQLEKAKADKRRAVEAAKPQSKRPR-AN  469

Query  458  GGPMPPAKAGRSTNAYVSSFP-----AAAPTFVRSPSHTQYPTGLPAY  330
            G    PA        +++SFP      AAP     P   QY  G  A+
Sbjct  470  GSVYAPA-------PHITSFPDKSFYQAAPQRHSYPYERQYVYGAEAH  510



>ref|XP_011080559.1| PREDICTED: LOW QUALITY PROTEIN: FRIGIDA-like protein 3 [Sesamum 
indicum]
Length=645

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 71/139 (51%), Gaps = 31/139 (22%)
 Frame = -1

Query  638  KKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSN  459
            +KEL+A+++V+KCIE++KLE +FP EHL+K++ ++EK K++KK+    A P +KR R + 
Sbjct  510  EKELAALKSVIKCIEDHKLEEQFPLEHLQKQVLEIEKAKADKKRATEVAKPQSKRPRANG  569

Query  458  GGPMPPAKA----------GRSTNAY------------------VSSFPAAAPTFVRSPS  363
             G  P              GR T+ Y                  + SF  AAP +  SPS
Sbjct  570  VGHAPRVANAATDKNLNFHGRMTDRYPQYIYERPYAYPGPTDHHLPSFMGAAP-YNFSPS  628

Query  362  HTQYPTGLPAYPASPIYTH  306
            H  +     AYP    Y H
Sbjct  629  HGNFFGN--AYPYQTAYLH  645



>ref|XP_010679002.1| PREDICTED: FRIGIDA-like protein 3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679003.1| PREDICTED: FRIGIDA-like protein 3 [Beta vulgaris subsp. vulgaris]
Length=563

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 60/111 (54%), Gaps = 5/111 (5%)
 Frame = -1

Query  638  KKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSN  459
            ++ELSA++AV+KC+EE+KLE  F  + L KR+ QLEK K++KK+      P +KR R +N
Sbjct  425  ERELSALKAVIKCVEEHKLEGHFSVDTLAKRVLQLEKAKADKKRGTEVTKPQSKRPRATN  484

Query  458  GGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYPASPIYTH  306
             G  P     R TN   ++ P AA    R P    +      Y A P   H
Sbjct  485  VGYGP-----RITNIAPNASPYAARLTDRYPPQYVFDNRPYVYTAGPTDNH  530



>ref|XP_006466524.1| PREDICTED: FRIGIDA-like protein 3-like isoform X1 [Citrus sinensis]
 ref|XP_006466525.1| PREDICTED: FRIGIDA-like protein 3-like isoform X2 [Citrus sinensis]
Length=568

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = -1

Query  668  NSGRAA---HLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaa  498
            NSG A    + A  +EL+A++AV+ CIE YKLEAE+P + L+KR+ QLE++KS+KK+   
Sbjct  396  NSGGATGAQNDANAQELAALKAVISCIERYKLEAEYPLDPLQKRVAQLERSKSDKKRGRD  455

Query  497  aaapaaKRTRVSNGG  453
             +     +   +NGG
Sbjct  456  FSKHQQSKKHRANGG  470



>gb|KDP45205.1| hypothetical protein JCGZ_15070 [Jatropha curcas]
Length=538

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 57/95 (60%), Gaps = 10/95 (11%)
 Frame = -1

Query  674  PNNSGRAA-----HLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkk  510
            P  SG A+     H   ++EL+A++AV+KCIEE+KLE ++P + ++KRL QLEK K++KK
Sbjct  393  PVKSGNASPTAVQHEVNERELAALKAVIKCIEEHKLEEQYPIDPVQKRLSQLEKAKADKK  452

Query  509  kpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVS  405
            +    A P  KR R +  G  P     R TN  V 
Sbjct  453  RATEVAKPQCKRPRANGAGCAP-----RVTNVAVD  482



>ref|XP_003608453.1| ABI3-interacting protein, partial [Medicago truncatula]
Length=230

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L   FPPV LL+ +LK+ ++ +    ++  +   A   A  +EL+A+R V+KCIEEY+ E
Sbjct  48   LQESFPPVPLLRTYLKNQRRNSQVKADNVRDIATAKIDANAQELAALRNVIKCIEEYEFE  107

Query  578  AEFPPEHLKKRLDQLEKTKSE  516
            +E+P + L KR+ QLEK K+E
Sbjct  108  SEYPLDTLHKRVHQLEKAKTE  128



>ref|XP_010688181.1| PREDICTED: FRIGIDA-like protein 4a [Beta vulgaris subsp. vulgaris]
Length=566

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +F P  LLK++L+++KK    IL+  N+S  A   A   E++ I+++++C+E++KL
Sbjct  318  GLTERFQPASLLKSYLRNSKKNTAEILKKGNHSAGATDEANNYEINYIKSIVRCVEDHKL  377

Query  581  EAEFPPEHLKKRLDQLEKTKSE  516
            EAEF  + LKKRL  LE+ K +
Sbjct  378  EAEFGVDSLKKRLSSLERAKVD  399



>ref|XP_008786398.1| PREDICTED: FRIGIDA-like protein 4a [Phoenix dactylifera]
Length=486

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 72/108 (67%), Gaps = 1/108 (1%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +F P  LLK++L+ ++K A A+++  N+S  A   A+  E+S +R+++KC+E   L
Sbjct  313  GLTERFSPASLLKSYLQSSRKKANAMVKSGNHSAAATEEASAAEMSDLRSIIKCVESCHL  372

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPA  438
            E++F  + LKKRL Q+EK K+++KK AAA     KRTR S GG  PP+
Sbjct  373  ESKFSVDGLKKRLAQMEKVKADRKKSAAARKTQGKRTR-STGGTGPPS  419



>ref|XP_011010336.1| PREDICTED: FRIGIDA-like protein 3 [Populus euphratica]
 ref|XP_011010338.1| PREDICTED: FRIGIDA-like protein 3 [Populus euphratica]
 ref|XP_011010339.1| PREDICTED: FRIGIDA-like protein 3 [Populus euphratica]
 ref|XP_011010340.1| PREDICTED: FRIGIDA-like protein 3 [Populus euphratica]
Length=545

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 54/88 (61%), Gaps = 0/88 (0%)
 Frame = -1

Query  638  KKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSN  459
            ++EL+A++AV+KCIEE+KLE ++P + L+KRL QLEK K+EKK+   AA P  KR R S 
Sbjct  411  ERELAALKAVIKCIEEHKLEEQYPEDPLQKRLLQLEKAKAEKKRATEAAKPQPKRPRASG  470

Query  458  GGPMPPAKAGRSTNAYVSSFPAAAPTFV  375
             G  P    G     +    P   P +V
Sbjct  471  VGCGPRITNGAPERTFYPIVPDRYPQYV  498



>gb|KJB81662.1| hypothetical protein B456_013G155600 [Gossypium raimondii]
Length=578

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  KF PV LL+ +L + KK A  + E+  N+ ++ + AA KE+ A+++V+K IEE+KL
Sbjct  343  GLAEKFSPVPLLEEYLNETKKLAQQVCENGKNTLKSQNEAASKEIGALKSVIKIIEEHKL  402

Query  581  EAEFPPEHLKKRLDQLEK  528
            E ++  E L+KR++QLEK
Sbjct  403  ETQYSREPLQKRIEQLEK  420



>emb|CDY48750.1| BnaA02g30110D [Brassica napus]
Length=527

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 66/126 (52%), Gaps = 14/126 (11%)
 Frame = -1

Query  638  KKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSN  459
            ++EL+ ++AV+KC+EE+ LE ++P E L KR+ QLEKTK+EKK+      P  KR R   
Sbjct  397  ERELTGLKAVIKCVEEHNLEEQYPVEPLHKRILQLEKTKAEKKRATEPTKPQTKRPR---  453

Query  458  GGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQ-YV  282
             GP P      +   Y    P   P ++    + Q+ +G       PI    +  PQ Y 
Sbjct  454  -GPQPRVTDNNNKTGYGRVIPERYPQYLY--DNRQFLSG-------PIMAAQAPPPQTYT  503

Query  281  YSPEAA  264
            +SP AA
Sbjct  504  FSPAAA  509



>ref|XP_003532490.1| PREDICTED: FRIGIDA-like protein 4a-like [Glycine max]
Length=520

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +FPP+ LLK++ ++ KK  +AI +  NN+      ++  EL++I+A++KC+E++KL
Sbjct  294  GLTERFPPIDLLKSYHRNYKKNVSAIFKKGNNNHATMDDSSTSELNSIKAIIKCVEDHKL  353

Query  581  EAEFPPEHLKKR  546
            E+EF  ++L+KR
Sbjct  354  ESEFNLDNLRKR  365



>ref|XP_006366815.1| PREDICTED: FRIGIDA-like protein 3-like isoform X1 [Solanum tuberosum]
 ref|XP_006366816.1| PREDICTED: FRIGIDA-like protein 3-like isoform X2 [Solanum tuberosum]
Length=545

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 91/164 (55%), Gaps = 26/164 (16%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAA----HLAAKKELSAIRAVLKCIEE  591
            L  +FPPV LLK++L +A KA+T +     NSG A+    +   +KELSA++AVLKCIE+
Sbjct  374  LTEQFPPVSLLKSYLNEASKASTLL-----NSGNASPTVQNDVNEKELSALKAVLKCIED  428

Query  590  YKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAG------  429
            +KLE ++  + L+KR+ QLEK K++KKK    A P +KR R +  G  P           
Sbjct  429  HKLEEQYLVDPLQKRVHQLEKVKADKKKATEVAKPQSKRPRPNGVGNGPRVNNVVTEKNF  488

Query  428  --RSTNAY---VSSFPAAAPTFVRSPSHTQYPT--GLPAYPASP  318
              R T+ Y   V   P A P     P+ T  P+  G PAY  SP
Sbjct  489  YPRMTDRYPQPVYDRPYAYP----GPTSTHVPSFMGAPAYNFSP  528



>ref|XP_008652494.1| PREDICTED: FRIGIDA-like protein 3 [Zea mays]
 tpg|DAA60797.1| TPA: hypothetical protein ZEAMMB73_698906 [Zea mays]
Length=534

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 68/120 (57%), Gaps = 12/120 (10%)
 Frame = -1

Query  638  KKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSN  459
            ++ELSA+++V+KCIEE+KLE ++P + L+KR+ QLEK K++K+    AA P +KR R +N
Sbjct  402  ERELSALKSVIKCIEEHKLEQQYPVDPLQKRVLQLEKAKADKRMAVEAAKPQSKRPR-AN  460

Query  458  GGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG----LPAYPASPIYT----HG  303
            G        G +  ++ S+ P   P    +P   Q+  G    LP    S  YT    HG
Sbjct  461  GSAFATRATGFADKSFYSATPERHPF---NPCERQFVYGAEVHLPPMMTSASYTMQPAHG  517



>ref|XP_006829297.1| hypothetical protein AMTR_s00001p00273060 [Amborella trichopoda]
 gb|ERM96713.1| hypothetical protein AMTR_s00001p00273060 [Amborella trichopoda]
Length=578

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 45/61 (74%), Gaps = 6/61 (10%)
 Frame = -1

Query  680  EDPN-NSGRAAHLAAKK-----ELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKS  519
            +DP  N+G A+  +++K     EL A+RAV++CIEE+KLE ++P E L+KR++ LEK K+
Sbjct  389  KDPQGNNGNASAASSQKDANSRELVALRAVIRCIEEHKLEEQYPLEQLQKRVNNLEKAKA  448

Query  518  E  516
            +
Sbjct  449  Q  449



>ref|XP_009598293.1| PREDICTED: FRIGIDA-like protein 4a [Nicotiana tomentosiformis]
Length=562

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 90/165 (55%), Gaps = 25/165 (15%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +FPPV LLKA+L++ ++ +  I +    S  A   A   E  A +A++KC+E++KL
Sbjct  310  GLAERFPPVSLLKAYLRNCRRNSNNISKKGRFSSAAVDKANIIEWEATKAIIKCVEDHKL  369

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaa-aaapaaKRTRVSNGGPM------PPAKAGRS  423
            E EF  E LKKR+ +LE++++++KK  A     + KR R S  G         P K+GR 
Sbjct  370  EQEFSLEGLKKRVTELEQSRAKRKKGTAPGHKHSKKRGRGSGSGKAIDQSTSRPVKSGRL  429

Query  422  TNAYVSSFPAAAPTFVRS----PSHTQYP----TGLPAYPASPIY  312
            +N        A+P+F RS    PSH Q P    TG  +Y +  +Y
Sbjct  430  SN--------ASPSF-RSRNPPPSH-QVPPVRYTGAHSYTSQSVY  464



>ref|XP_009766201.1| PREDICTED: FRIGIDA-like protein 4a [Nicotiana sylvestris]
Length=563

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 90/165 (55%), Gaps = 25/165 (15%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  +FPPV LLKA+L++ ++ +  I +    S  A   A   E  A +A++KC+E++KL
Sbjct  310  GLAERFPPVSLLKAYLRNCRRNSNNISKKGRFSSAAVDKANIIEWEATKAIIKCVEDHKL  369

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaa-aaapaaKRTRVSNGGPMP------PAKAGRS  423
            E EF  E LKKR+ +LE++++++KK  A     + KR R S  G         P K+GR 
Sbjct  370  EQEFSLEGLKKRVTELEESRAKRKKGTAPRDKHSKKRGRRSGTGKSSDPSTSRPVKSGRL  429

Query  422  TNAYVSSFPAAAPTFVRS----PSHTQYP----TGLPAYPASPIY  312
            +N        A+P+F RS    PSH Q P    TG  +Y +  +Y
Sbjct  430  SN--------ASPSF-RSRNPPPSH-QVPPVRYTGAHSYTSQSVY  464



>dbj|BAD19899.1| putative ABI3-interacting protein 2 [Oryza sativa Japonica Group]
 dbj|BAD26003.1| putative ABI3-interacting protein 2 [Oryza sativa Japonica Group]
Length=370

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 63/103 (61%), Gaps = 4/103 (4%)
 Frame = -1

Query  638  KKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSN  459
            ++ELSA++AV+KCIEE+KL+ ++P + L++R+ QLEK K++K++   A  P +KR R +N
Sbjct  237  ERELSALKAVIKCIEEHKLDEKYPIDPLQRRVIQLEKAKADKRRAVEAGKPQSKRPR-AN  295

Query  458  GGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAY  330
            G    P     S  ++   + AAAP     P   QY  G  A+
Sbjct  296  GSVYAPHITSFSDKSF---YQAAAPQRHSYPYERQYVYGAEAH  335



>ref|XP_010550845.1| PREDICTED: FRIGIDA-like protein 1 [Tarenaya hassleriana]
Length=551

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -1

Query  755  INKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEA  576
            + +F PV +LK++L+ + KA+  +LE   NS +A   A  KE+  +RAV+K I+E+KLEA
Sbjct  289  VVQFNPVTILKSYLEKSGKASQKVLEKRRNSLKAQIEATDKEIGVLRAVIKVIKEHKLEA  348

Query  575  EFPPEHLKKRLDQLEKTKS  519
            EF  E+L++R+ +LEK K+
Sbjct  349  EFSLENLEERVKELEKEKA  367



>gb|AIN75612.1| FRIGIDA3a-1 [Dimocarpus longan]
Length=567

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = -1

Query  635  KELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNG  456
            +EL+A++AV+ C+EEYKLEA++P + L KR+ QLE++KS++K+          + + +NG
Sbjct  409  QELAALKAVIGCVEEYKLEADYPLDPLHKRVAQLERSKSDRKRSGDFGKHQHNKKQRANG  468

Query  455  G  453
            G
Sbjct  469  G  469



>ref|XP_011008039.1| PREDICTED: truncated FRIGIDA-like protein 1 [Populus euphratica]
Length=539

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 84/162 (52%), Gaps = 6/162 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KF PV LLKA LK++K+    I +D  NS    + A  +E+  +++ L  I+EYKL
Sbjct  323  GLVDKFQPVPLLKAHLKESKRLTKKICQDGKNSINQQNEARSREVKTLKSALVLIDEYKL  382

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
             +E+P   L+KR++ LEK K+         +   K+ + + G   P   A    N+   S
Sbjct  383  GSEYPQMDLEKRIEMLEKQKAAAASADDEPSHQPKKQQQA-GSKRPRTSATAVQNSNNGS  441

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYS  276
             PA  P      SH Q  + L A  A P  + GS+SP  +Y+
Sbjct  442  NPAIPPF---KQSHVQPASLLLA--AGPYGSVGSISPAILYA  478



>gb|AIN75614.1| FRIGIDA3b-1 [Dimocarpus longan]
 gb|AIN75615.1| FRIGIDA3b-2 [Dimocarpus longan]
Length=550

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 65/120 (54%), Gaps = 29/120 (24%)
 Frame = -1

Query  638  KKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSN  459
            ++EL+A++AV+KCIEE+ LE ++P + L+KR+ QLEK K++KK+   A+ P  KR R + 
Sbjct  413  ERELAALKAVIKCIEEHSLEEQYPVDPLQKRILQLEKAKADKKRATEASKPQPKRPRANG  472

Query  458  GGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVY  279
             G +PP    R TN       AA  TF        YPT +               PQYVY
Sbjct  473  AGYVPP----RVTNV------AADKTF--------YPTRV-----------ADRYPQYVY  503



>gb|AIN75613.1| FRIGIDA3a-2 [Dimocarpus longan]
Length=567

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = -1

Query  635  KELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNG  456
            +EL+A++AV+ C+EEYKLEA++P + L KR+ QLE++KS++K+          + + +NG
Sbjct  409  QELAALKAVIGCVEEYKLEADYPLDPLHKRVAQLERSKSDRKRSGDFGKHQHNKKQRANG  468

Query  455  G  453
            G
Sbjct  469  G  469



>ref|XP_010907692.1| PREDICTED: FRIGIDA-like protein 1 [Elaeis guineensis]
Length=498

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  671  NNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  516
            NNS ++ + A  KEL A+++VL+ +EEYKLEA +P E+L+K++ +LEK K++
Sbjct  314  NNSSQSQNEAISKELGALKSVLRAVEEYKLEAAYPRENLEKQIARLEKLKAD  365



>ref|XP_009629152.1| PREDICTED: FRIGIDA-like protein 3 [Nicotiana tomentosiformis]
 ref|XP_009629153.1| PREDICTED: FRIGIDA-like protein 3 [Nicotiana tomentosiformis]
Length=614

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -1

Query  671  NNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKS  519
            N  G+  +   ++EL+A+RAV++CI +YKLEAE+P + L++R+ QLEK  S
Sbjct  395  NAQGKGGNSGNREELAAVRAVVRCIRDYKLEAEYPLDPLQRRVGQLEKAIS  445



>dbj|BAF47124.1| hydroproline-rich glycoprotein like protein [Nicotiana tabacum]
Length=153

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  638  KKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  516
            +K+L+A++AV+KCIEE+KLEA++P + L+KR+ QLE+ K++
Sbjct  11   EKQLTALKAVIKCIEEHKLEAQYPVDPLQKRVLQLEEEKAD  51



>gb|ADR31574.1| frigida-like 1, partial [Populus trichocarpa]
Length=200

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 83/162 (51%), Gaps = 6/162 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KF PV LLKA LK++K+    + +D  NS    + A  +E+  +++ L  I+EYKL
Sbjct  9    GLVDKFQPVPLLKAHLKESKRLTKKVCQDGKNSINQQNEARSREVKTLKSALVLIDEYKL  68

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
             +E+P   LKKR++ LEK K+         +   K+ + + G   P   A    N+   S
Sbjct  69   GSEYPRMDLKKRIEMLEKQKAAAASAVDEPSHQPKKQQQA-GSKRPRTSATAVQNSNNGS  127

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYS  276
             P   P      SH Q  + L A  A P  + GS+SP  +Y+
Sbjct  128  NPVIPPF---KQSHLQPASLLLA--AGPYGSVGSISPAILYA  164



>gb|KHG07820.1| Protein FRIGIDA -like protein [Gossypium arboreum]
 gb|KHG16881.1| Protein FRIGIDA -like protein [Gossypium arboreum]
Length=578

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL  KF PV LL+ ++ + KK A  + ++  N+ ++ + AA KE+ A+++V+K IEE+KL
Sbjct  343  GLAEKFSPVPLLEEYMNETKKLAQQVCQNGKNTLKSQNEAASKEIGALKSVIKIIEEHKL  402

Query  581  EAEFPPEHLKKRLDQLEK  528
            E ++  E L+KR++QLEK
Sbjct  403  ETQYSREPLQKRIEQLEK  420



>ref|XP_002457174.1| hypothetical protein SORBIDRAFT_03g002730 [Sorghum bicolor]
 gb|EES02294.1| hypothetical protein SORBIDRAFT_03g002730 [Sorghum bicolor]
Length=536

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 74/123 (60%), Gaps = 16/123 (13%)
 Frame = -1

Query  638  KKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSN  459
            ++ELSA+++V+KCIEE+KLE ++P + L+KR+ QLEK K++K++   AA P +KR R +N
Sbjct  402  ERELSALKSVIKCIEEHKLEEQYPVDPLQKRVLQLEKAKADKRRAVEAAKPQSKRPR-AN  460

Query  458  GGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSH---TQYPTG----LPAYPASPIYT---  309
            G     A A R+T     SF  AA T  R PS+    Q+  G    LP   +S  YT   
Sbjct  461  GS----AFAHRATGFADKSFYPAAATPERHPSNPYERQFVYGAEAHLPPMVSSASYTMQP  516

Query  308  -HG  303
             HG
Sbjct  517  AHG  519



>ref|XP_009794659.1| PREDICTED: FRIGIDA-like protein 3 [Nicotiana sylvestris]
 ref|XP_009794660.1| PREDICTED: FRIGIDA-like protein 3 [Nicotiana sylvestris]
Length=615

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -1

Query  671  NNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKS  519
            N  G+  +   ++EL+A+RAV++CI +YKLEAE+P + L++R+ QLEK  S
Sbjct  395  NAQGKGGNSGNREELAAVRAVVRCIRDYKLEAEYPLDPLQRRVGQLEKAIS  445



>ref|XP_011008572.1| PREDICTED: FRIGIDA-like protein 3 isoform X2 [Populus euphratica]
Length=573

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  632  ELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  516
            EL+A++ V++C+EEYKLEA++P + L+KRL QLEK+KS+
Sbjct  416  ELAALKVVIRCVEEYKLEADYPLDPLQKRLAQLEKSKSD  454



>ref|XP_006380669.1| hypothetical protein POPTR_0007s10310g [Populus trichocarpa]
 gb|ERP58466.1| hypothetical protein POPTR_0007s10310g [Populus trichocarpa]
Length=570

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  632  ELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  516
            EL+A++ V++C+EEYKLEA++P + L+KRL QLEK+KS+
Sbjct  413  ELAALKVVIRCVEEYKLEADYPLDPLQKRLAQLEKSKSD  451



>ref|XP_011008571.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Populus euphratica]
Length=594

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  632  ELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  516
            EL+A++ V++C+EEYKLEA++P + L+KRL QLEK+KS+
Sbjct  437  ELAALKVVIRCVEEYKLEADYPLDPLQKRLAQLEKSKSD  475



>ref|NP_001062668.1| Os09g0248300 [Oryza sativa Japonica Group]
 dbj|BAF24582.1| Os09g0248300 [Oryza sativa Japonica Group]
 dbj|BAG94353.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84155.1| hypothetical protein OsI_30526 [Oryza sativa Indica Group]
 gb|EEE69257.1| hypothetical protein OsJ_28511 [Oryza sativa Japonica Group]
Length=542

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 63/103 (61%), Gaps = 4/103 (4%)
 Frame = -1

Query  638  KKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSN  459
            ++ELSA++AV+KCIEE+KL+ ++P + L++R+ QLEK K++K++   A  P +KR R +N
Sbjct  409  ERELSALKAVIKCIEEHKLDEKYPIDPLQRRVIQLEKAKADKRRAVEAGKPQSKRPR-AN  467

Query  458  GGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAY  330
            G    P     S  ++   + AAAP     P   QY  G  A+
Sbjct  468  GSVYAPHITSFSDKSF---YQAAAPQRHSYPYERQYVYGAEAH  507



>ref|XP_009406027.1| PREDICTED: truncated FRIGIDA-like protein 1 [Musa acuminata subsp. 
malaccensis]
Length=494

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L +K+PPV LL+A+L++++KAA    +  NNS +  + A  KEL+A +AV+K +EE KLE
Sbjct  274  LFDKYPPVPLLEAYLRESRKAAQGARKRGNNSSQLQNEAISKELAAAKAVIKTVEECKLE  333

Query  578  AEFPPEHLKKRLDQLEKTKSE  516
            +EF  E L+KR+ +LE+ K++
Sbjct  334  SEFSCEDLQKRITRLEQQKAD  354



>ref|XP_008458098.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Cucumis melo]
Length=638

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  671  NNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  516
            N S  A +  + +EL+A++AV+KCIEE+KLE ++P + L+KR+ QLEK K++
Sbjct  491  NTSQTAQNDVSDRELTALKAVIKCIEEHKLEEQYPVDPLQKRVIQLEKAKAD  542



>gb|ADR31573.1| frigida-like 1, partial [Populus trichocarpa]
Length=216

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 83/162 (51%), Gaps = 6/162 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KF PV LLKA LK++K+    + +D  NS    + A  +E+  +++ L  I+EYKL
Sbjct  9    GLVDKFQPVPLLKAHLKESKRLTKKVCQDGKNSINQQNEARSREVKTLKSALVLIDEYKL  68

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
             +E+P   LKKR++ LEK K+         +   K+ + + G   P   A    N+   S
Sbjct  69   GSEYPRMDLKKRIEMLEKQKAAAASAVDEPSHQPKKQQQA-GSKRPRTSATAVQNSNNGS  127

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYS  276
             P   P      SH Q  + L A  A P  + GS+SP  +Y+
Sbjct  128  NPVIPPF---KQSHLQPASLLLA--AGPYGSVGSISPAILYA  164



>gb|ADR31569.1| frigida-like 1, partial [Populus trichocarpa]
 gb|ADR31570.1| frigida-like 1, partial [Populus trichocarpa]
Length=216

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 83/162 (51%), Gaps = 6/162 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KF PV LLKA LK++K+    + +D  NS    + A  +E+  +++ L  I+EYKL
Sbjct  9    GLVDKFQPVPLLKAHLKESKRLTKKVCQDGKNSINQQNEARSREVKTLKSALVLIDEYKL  68

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
             +E+P   LKKR++ LEK K+         +   K+ + + G   P   A    N+   S
Sbjct  69   GSEYPRMDLKKRIEMLEKQKAAAASAVDEPSHQPKKQQQA-GSKRPRTSATAVQNSNNGS  127

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYS  276
             P   P      SH Q  + L A  A P  + GS+SP  +Y+
Sbjct  128  NPVIPPF---KQSHLQPASLLLA--AGPYGSVGSISPAILYA  164



>ref|XP_009416846.1| PREDICTED: truncated FRIGIDA-like protein 1 [Musa acuminata subsp. 
malaccensis]
Length=506

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  758  LINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  579
            L+ K+PPV LLKA++K+ KKAA  +    NNS  + ++A  KEL A+R+V+K +EEYKLE
Sbjct  298  LVEKYPPVPLLKAYIKEIKKAAQDVRNKGNNSSESENVATSKELGALRSVIKAVEEYKLE  357

Query  578  AEFPPEHLKKRL  543
            +++P E L+K++
Sbjct  358  SQYPREFLEKQV  369



>gb|ADR31560.1| frigida-like 1, partial [Populus trichocarpa]
 gb|ADR31561.1| frigida-like 1, partial [Populus trichocarpa]
 gb|ADR31562.1| frigida-like 1, partial [Populus trichocarpa]
 gb|ADR31563.1| frigida-like 1, partial [Populus trichocarpa]
 gb|ADR31564.1| frigida-like 1, partial [Populus trichocarpa]
 gb|ADR31566.1| frigida-like 1, partial [Populus trichocarpa]
 gb|ADR31567.1| frigida-like 1, partial [Populus trichocarpa]
 gb|ADR31568.1| frigida-like 1, partial [Populus trichocarpa]
 gb|ADR31571.1| frigida-like 1, partial [Populus trichocarpa]
 gb|ADR31572.1| frigida-like 1, partial [Populus trichocarpa]
 gb|ADR31575.1| frigida-like 1, partial [Populus trichocarpa]
Length=216

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 83/162 (51%), Gaps = 6/162 (4%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            GL++KF PV LLKA LK++K+    + +D  NS    + A  +E+  +++ L  I+EYKL
Sbjct  9    GLVDKFQPVPLLKAHLKESKRLTKKVCQDGKNSINQQNEARSREVKTLKSALVLIDEYKL  68

Query  581  EAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSS  402
             +E+P   LKKR++ LEK K+         +   K+ + + G   P   A    N+   S
Sbjct  69   GSEYPRMDLKKRIEMLEKQKAAAASAVDEPSHQPKKQQQA-GSKRPRTSATAVQNSNNGS  127

Query  401  FPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYS  276
             P   P      SH Q  + L A  A P  + GS+SP  +Y+
Sbjct  128  NPVIPPF---KQSHLQPASLLLA--AGPYGSVGSISPAILYA  164



>ref|XP_002320559.2| hypothetical protein POPTR_0014s17360g [Populus trichocarpa]
 ref|XP_006375598.1| hypothetical protein POPTR_0014s17360g [Populus trichocarpa]
 gb|EEE98874.2| hypothetical protein POPTR_0014s17360g [Populus trichocarpa]
 gb|ERP53395.1| hypothetical protein POPTR_0014s17360g [Populus trichocarpa]
Length=545

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 54/88 (61%), Gaps = 0/88 (0%)
 Frame = -1

Query  638  KKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSN  459
            ++EL+A++AV+KCIEE+KLE ++P + L+KRL QLEK K+EKK+   AA P  KR R S 
Sbjct  411  ERELAALKAVIKCIEEHKLEEQYPGDPLQKRLLQLEKAKAEKKRATEAAKPQPKRPRASG  470

Query  458  GGPMPPAKAGRSTNAYVSSFPAAAPTFV  375
             G  P   +      +    P   P +V
Sbjct  471  VGCGPRVTSSVPERTFYPRVPERYPQYV  498



>gb|KFK25859.1| protein frigida like 1 [Arabis alpina]
Length=470

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -1

Query  761  GLINKFPPVxllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKL  582
            G+I+ F P+  LK+++K+ + AA  I  + N S ++ + A  KE+SA++AV+K ++++ L
Sbjct  279  GVIDGFEPITTLKSYVKELRVAAYRICVEGNYSLKSQNEATDKEVSALKAVIKIVKDHTL  338

Query  581  EAEFPPEHLKKRLDQLEKTKS  519
            E+EF  E L++R+D+LEK K+
Sbjct  339  ESEFCDEKLEQRVDELEKQKA  359



>ref|XP_004149315.1| PREDICTED: uncharacterized protein LOC101212341 [Cucumis sativus]
 ref|XP_004164047.1| PREDICTED: uncharacterized protein LOC101226383 [Cucumis sativus]
 gb|KGN44673.1| hypothetical protein Csa_7G368740 [Cucumis sativus]
Length=550

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  671  NNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  516
            N S  A +  + +EL+A++AV+KCIEE+KLE ++P + L+KR+ QLEK K++
Sbjct  402  NTSQTAQNDVSDRELTALKAVIKCIEEHKLEEQYPVDPLQKRVIQLEKAKAD  453



>ref|XP_003577079.1| PREDICTED: FRIGIDA-like protein 3 [Brachypodium distachyon]
Length=538

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 68/117 (58%), Gaps = 8/117 (7%)
 Frame = -1

Query  638  KKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSN  459
            ++ELSA++AV+KCIEE+KLE ++P + L+KR+ QLEK K++K++   AA P +KR R + 
Sbjct  406  ERELSALKAVIKCIEEHKLEEQYPVDPLQKRVIQLEKAKADKRRAVEAAKPQSKRPRANG  465

Query  458  GGPMPPAKAGRSTNAYVSSFPAAAP-----TFVRSPSHTQYPTGLPA--YPASPIYT  309
                P   +    N Y ++ P   P      FV S     +PT + A  Y  +P +T
Sbjct  466  SVYAPRVTSFGDKNIYQAT-PERHPYPYERQFVYSAEAHHHPTMINAAPYTMTPAHT  521



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470